Psyllid ID: psy4056


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MNKILQTRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI
cccccccHHHHHHHHHHHHHHHHHHEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccEEEHHHHHHHccccccHHHHHHHHHHHHccccccHHHHHHHHHHHccccHHHHHccccccHHHHHHHHHHHEEEcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHcc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcHHHHHHHHHHHHHcccEEEEEcHHHcccHccccHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHcccccEHHHHHHHHHEEEcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHccc
MNKILQTRRHIKYALGVGSVIGGTGillhrnnydvNSLVAVRLVRAASCVFNIAYIYKKALyqkatpdptseeysnLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLhskapmspmKDILAVLKEdlgkdpseifasiepnpmgaASLAQVHKATlhdgstiaLKVQhrnvrdnanIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI
MNKILQTRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVlhskapmspMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEfkflwlvdetkrni
MNKILQTRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI
*****QTRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQ***********************EQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHS********DILAVLK***********************LAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVD******
***********KYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPD***********KVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI
********RHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQK**************SKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI
MNKILQTRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI
iiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooo
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKILQTRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query227 2.2.26 [Sep-21-2011]
Q9D0L4 525 Uncharacterized aarF doma yes N/A 0.955 0.413 0.488 2e-55
Q86TW2 530 Uncharacterized aarF doma yes N/A 0.955 0.409 0.491 4e-54
Q5ZMT7 519 Uncharacterized aarF doma yes N/A 0.881 0.385 0.514 4e-52
Q6INL7 520 Uncharacterized aarF doma N/A N/A 0.881 0.384 0.470 7e-51
Q5M7P6 523 Uncharacterized aarF doma yes N/A 0.885 0.384 0.461 5e-50
O04212 538 Putative ABC1 protein At2 yes N/A 0.925 0.390 0.384 2e-34
Q54P00 695 Probable serine/threonine yes N/A 0.797 0.260 0.390 1e-31
O60111 557 ABC1 family protein C15C4 yes N/A 0.823 0.335 0.376 3e-29
Q06567 569 ABC1 family protein YLR25 yes N/A 0.947 0.377 0.326 1e-26
Q80V03 582 Uncharacterized aarF doma no N/A 0.691 0.269 0.369 1e-25
>sp|Q9D0L4|ADCK1_MOUSE Uncharacterized aarF domain-containing protein kinase 1 OS=Mus musculus GN=Adck1 PE=2 SV=1 Back     alignment and function desciption
 Score =  215 bits (547), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 108/221 (48%), Positives = 152/221 (68%), Gaps = 4/221 (1%)

Query: 8   RRHIKYALGVGSVIGGTGILLHRNNY-DVNSLVAVRLVRAASCVFNIAYIYKKALYQKAT 66
           R+ +K A      +  +G+ L+ NNY D N   AVR+ RA +    I+Y Y  +L  ++ 
Sbjct: 3   RKALKLASWTSVALAASGVYLYSNNYLDPNDFGAVRVGRAVATTAVISYDYLTSL--RSV 60

Query: 67  PDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLH 126
           P   SEEY   +S+VH  +A +L ELC  N+G +IKVGQH+GAL+YLLP+EY  T+KVLH
Sbjct: 61  P-YGSEEYLQRRSQVHLRSARRLFELCCANRGTFIKVGQHLGALDYLLPEEYTSTLKVLH 119

Query: 127 SKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQH 186
           S+AP S M+++  V++EDLGK+  ++F S +  P+GAASLAQVHKA LHDG T+A+KVQH
Sbjct: 120 SQAPQSSMQEVRQVIREDLGKEIHDLFLSFDDTPLGAASLAQVHKAVLHDGRTVAVKVQH 179

Query: 187 RNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI 227
             V+  ++ DI  ME LV  V  +FP+F+F+WLVDE K+N+
Sbjct: 180 PKVQAQSSKDILLMEVLVLAVKQLFPDFEFMWLVDEAKKNL 220




The function of this protein is not yet clear. It is not known if it has protein kinase activity and what type of substrate it would phosphorylate (Ser, Thr or Tyr).
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: -
>sp|Q86TW2|ADCK1_HUMAN Uncharacterized aarF domain-containing protein kinase 1 OS=Homo sapiens GN=ADCK1 PE=2 SV=2 Back     alignment and function description
>sp|Q5ZMT7|ADCK1_CHICK Uncharacterized aarF domain-containing protein kinase 1 OS=Gallus gallus GN=ADCK1 PE=2 SV=1 Back     alignment and function description
>sp|Q6INL7|ADCK1_XENLA Uncharacterized aarF domain-containing protein kinase 1 OS=Xenopus laevis GN=adck1 PE=2 SV=1 Back     alignment and function description
>sp|Q5M7P6|ADCK1_XENTR Uncharacterized aarF domain-containing protein kinase 1 OS=Xenopus tropicalis GN=adck1 PE=2 SV=1 Back     alignment and function description
>sp|O04212|Y2090_ARATH Putative ABC1 protein At2g40090 OS=Arabidopsis thaliana GN=At2g40090 PE=2 SV=2 Back     alignment and function description
>sp|Q54P00|ABKD_DICDI Probable serine/threonine-protein kinase abkD OS=Dictyostelium discoideum GN=abkD PE=2 SV=1 Back     alignment and function description
>sp|O60111|YG62_SCHPO ABC1 family protein C15C4.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.02 PE=3 SV=2 Back     alignment and function description
>sp|Q06567|YL253_YEAST ABC1 family protein YLR253W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR253W PE=1 SV=1 Back     alignment and function description
>sp|Q80V03|ADCK5_MOUSE Uncharacterized aarF domain-containing protein kinase 5 OS=Mus musculus GN=Adck5 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
170049278 518 ABC1 family protein [Culex quinquefascia 0.969 0.424 0.601 3e-73
157167182 518 hypothetical protein AaeL_AAEL006808 [Ae 0.969 0.424 0.597 1e-72
189241943 517 PREDICTED: similar to CG3608 CG3608-PA [ 0.973 0.427 0.605 9e-72
58393697 518 AGAP012287-PA [Anopheles gambiae str. PE 0.964 0.422 0.586 2e-71
312374237 609 hypothetical protein AND_16295 [Anophele 0.925 0.344 0.595 6e-71
345482947 344 PREDICTED: uncharacterized aarF domain-c 0.973 0.642 0.573 2e-65
350417281 522 PREDICTED: uncharacterized aarF domain-c 0.925 0.402 0.604 6e-65
340714268 522 PREDICTED: uncharacterized aarF domain-c 0.925 0.402 0.604 6e-65
380025085 522 PREDICTED: uncharacterized aarF domain-c 0.929 0.404 0.593 2e-64
307192549 522 Uncharacterized aarF domain-containing p 0.964 0.419 0.574 3e-64
>gi|170049278|ref|XP_001855172.1| ABC1 family protein [Culex quinquefasciatus] gi|167871114|gb|EDS34497.1| ABC1 family protein [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  280 bits (716), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 133/221 (60%), Positives = 167/221 (75%), Gaps = 1/221 (0%)

Query: 7   TRRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKAT 66
           TRR IKY L  GS++G T + LH N+YD+NS+  VRL RA   VF+IA  YK  LY++  
Sbjct: 4   TRRLIKYGLVGGSLLG-TAVSLHANDYDINSIGIVRLGRAGMTVFDIAVTYKTNLYKREW 62

Query: 67  PDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLH 126
           PD    EY  LKS+ H+ AAE+LL LC+ N+GVYIKVGQHIGALEYLLP EYV TMK+LH
Sbjct: 63  PDKKDPEYVKLKSETHRLAAEKLLNLCRTNRGVYIKVGQHIGALEYLLPYEYVNTMKILH 122

Query: 127 SKAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQH 186
           S AP +P++D+  V+++DL KDP EIF+S +P P+G ASLAQVH+ATL DG+ +A+KVQH
Sbjct: 123 SNAPQNPIEDLYKVIRQDLKKDPEEIFSSFDPEPLGTASLAQVHRATLKDGTEVAVKVQH 182

Query: 187 RNVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI 227
             VR N+ +DIK ME LV +V W FP+FKF WLV ETKRN+
Sbjct: 183 PYVRGNSLVDIKTMELLVKLVTWTFPDFKFQWLVKETKRNL 223




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|157167182|ref|XP_001652210.1| hypothetical protein AaeL_AAEL006808 [Aedes aegypti] gi|108877336|gb|EAT41561.1| AAEL006808-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|189241943|ref|XP_971607.2| PREDICTED: similar to CG3608 CG3608-PA [Tribolium castaneum] gi|270015338|gb|EFA11786.1| hypothetical protein TcasGA2_TC008565 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|58393697|ref|XP_320250.2| AGAP012287-PA [Anopheles gambiae str. PEST] gi|55234370|gb|EAA00298.2| AGAP012287-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|312374237|gb|EFR21831.1| hypothetical protein AND_16295 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|345482947|ref|XP_001599917.2| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350417281|ref|XP_003491345.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340714268|ref|XP_003395652.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380025085|ref|XP_003696310.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like isoform 1 [Apis florea] gi|380025087|ref|XP_003696311.1| PREDICTED: uncharacterized aarF domain-containing protein kinase 1-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|307192549|gb|EFN75737.1| Uncharacterized aarF domain-containing protein kinase 1 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query227
FB|FBgn0035039 518 CG3608 [Drosophila melanogaste 0.960 0.420 0.545 8.4e-58
UNIPROTKB|E2RSN4 513 ADCK1 "Uncharacterized protein 0.955 0.423 0.502 6.3e-53
UNIPROTKB|F1MYG8 523 ADCK1 "Uncharacterized protein 0.955 0.414 0.506 1.3e-52
MGI|MGI:1919363 525 Adck1 "aarF domain containing 0.955 0.413 0.488 5.6e-52
ZFIN|ZDB-GENE-080401-5 521 adck1 "aarF domain containing 0.951 0.414 0.493 5.1e-51
UNIPROTKB|Q86TW2 530 ADCK1 "Uncharacterized aarF do 0.955 0.409 0.491 1.3e-50
UNIPROTKB|F1NNJ1 519 ADCK1 "Uncharacterized aarF do 0.929 0.406 0.5 3.2e-49
UNIPROTKB|Q5ZMT7 519 ADCK1 "Uncharacterized aarF do 0.929 0.406 0.5 3.2e-49
UNIPROTKB|F1SE04 455 ADCK1 "Uncharacterized protein 0.651 0.325 0.567 1.7e-43
TAIR|locus:2047746 538 ATH9 "AT2G40090" [Arabidopsis 0.925 0.390 0.384 4.4e-36
FB|FBgn0035039 CG3608 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 594 (214.2 bits), Expect = 8.4e-58, P = 8.4e-58
 Identities = 120/220 (54%), Positives = 160/220 (72%)

Query:     8 RRHIKYALGVGSVIGGTGILLHRNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATP 67
             RR + Y + VG+ +   G  LH N+YD NSL  VRL R+A+ V ++A  YK+ LY K   
Sbjct:     4 RRVLGYGV-VGAGLASAGWSLHTNDYDPNSLGIVRLSRSAAAVVDVALTYKRELYYKEW- 61

Query:    68 DPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHS 127
             D  + EY   KS+VHK AAE+LL+L  +NKGVYIKVGQHIGALEYLLPKE+V+TMKVLHS
Sbjct:    62 DKETPEYKAEKSRVHKIAAEKLLQLICINKGVYIKVGQHIGALEYLLPKEFVQTMKVLHS 121

Query:   128 KAPMSPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHR 187
              AP +P++D+  V+++DL  +P EIF S E  P+G ASLAQVHKA L  G  +A+KVQH 
Sbjct:   122 DAPQNPIEDLYKVIRQDLHCNPEEIFDSFEREPLGTASLAQVHKARLKTGELVAVKVQHP 181

Query:   188 NVRDNANIDIKCMEALVHVVAWVFPEFKFLWLVDETKRNI 227
              V+ N+ +D+K ME  V+V+A +FP+FK  WLV+E+K+N+
Sbjct:   182 YVKGNSRVDMKTMELAVNVLARIFPDFKIHWLVEESKKNL 221




GO:0004672 "protein kinase activity" evidence=IEA;NAS
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
UNIPROTKB|E2RSN4 ADCK1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1MYG8 ADCK1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:1919363 Adck1 "aarF domain containing kinase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080401-5 adck1 "aarF domain containing kinase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q86TW2 ADCK1 "Uncharacterized aarF domain-containing protein kinase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1NNJ1 ADCK1 "Uncharacterized aarF domain-containing protein kinase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q5ZMT7 ADCK1 "Uncharacterized aarF domain-containing protein kinase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1SE04 ADCK1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
TAIR|locus:2047746 ATH9 "AT2G40090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q5ZMT7ADCK1_CHICK2, ., 7, ., 1, 1, ., -0.51470.88100.3853yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query227
COG0661 517 COG0661, AarF, Predicted unusual protein kinase [G 4e-40
pfam03109117 pfam03109, ABC1, ABC1 family 5e-29
TIGR01982 437 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase 4e-23
PRK04750 537 PRK04750, ubiB, putative ubiquinone biosynthesis p 3e-12
>gnl|CDD|223733 COG0661, AarF, Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
 Score =  143 bits (363), Expect = 4e-40
 Identities = 54/196 (27%), Positives = 94/196 (47%), Gaps = 10/196 (5%)

Query: 30  RNNYDVNSLVAVRLVRAASCVFNIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQL 89
           R    +   +   L R       +A + +   +   +   +SEE   L+ K  +     L
Sbjct: 9   RLPRIIRVRLRYLLGRLLRLTGRLALLLRLLSWLGKSKLASSEE---LREKRAERLRLAL 65

Query: 90  LELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDP 149
            EL       +IK+GQ +     L+P EY E +  L  + P  P ++   +++E+LG+  
Sbjct: 66  EEL----GPTFIKLGQILSTRPDLVPPEYAEELAKLQDRVPPFPFEEAERIIEEELGRPI 121

Query: 150 SEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAW 209
            E+F+  EP P+ +AS+AQVH+A L  G  +A+KVQ   +R+    D+K +  L  ++  
Sbjct: 122 EELFSEFEPEPIASASIAQVHRAVLKSGEEVAVKVQRPGIRERIEADLKLLRRLARLIKR 181

Query: 210 VFPEFKFL---WLVDE 222
           + P  + L    +VDE
Sbjct: 182 LPPGGRRLDLVEVVDE 197


Length = 517

>gnl|CDD|111949 pfam03109, ABC1, ABC1 family Back     alignment and domain information
>gnl|CDD|233667 TIGR01982, UbiB, 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>gnl|CDD|235310 PRK04750, ubiB, putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 227
KOG1235|consensus 538 100.0
COG0661 517 AarF Predicted unusual protein kinase [General fun 100.0
TIGR01982 437 UbiB 2-polyprenylphenol 6-hydroxylase. This model 100.0
PRK04750 537 ubiB putative ubiquinone biosynthesis protein UbiB 100.0
KOG1236|consensus 565 99.97
PF03109119 ABC1: ABC1 family; InterPro: IPR004147 This entry 99.95
KOG1234|consensus 363 99.85
cd05145 190 RIO1_like RIO kinase family; RIO1, RIO3 and simila 97.51
cd05147 190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 97.17
cd05119 187 RIO RIO kinase family, catalytic domain. The RIO k 96.5
smart00090 237 RIO RIO-like kinase. 96.31
cd05144 198 RIO2_C RIO kinase family; RIO2, C-terminal catalyt 95.37
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 94.53
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 93.6
cd07879 342 STKc_p38delta_MAPK13 Catalytic domain of the Serin 93.21
cd00180 215 PKc Catalytic domain of Protein Kinases. Protein K 92.19
KOG1187|consensus 361 92.1
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 91.78
smart00221 225 STYKc Protein kinase; unclassified specificity. Ph 91.77
cd05151170 ChoK Choline Kinase (ChoK). The ChoK subfamily is 91.76
KOG0667|consensus 586 91.27
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 91.22
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 91.03
PF03881 288 Fructosamin_kin: Fructosamine kinase; InterPro: IP 90.95
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 90.82
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 90.5
KOG4236|consensus 888 90.37
PRK10593 297 hypothetical protein; Provisional 90.28
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 90.22
PLN00034 353 mitogen-activated protein kinase kinase; Provision 90.01
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 89.91
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 89.64
KOG0192|consensus 362 89.57
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 89.28
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 89.26
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 88.95
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 88.77
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 88.67
cd07877 345 STKc_p38alpha_MAPK14 Catalytic domain of the Serin 88.65
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 88.58
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 88.55
KOG0595|consensus 429 88.34
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 88.3
PRK14879 211 serine/threonine protein kinase; Provisional 88.16
PRK09188 365 serine/threonine protein kinase; Provisional 87.72
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 87.66
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 87.64
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 87.51
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 87.38
cd05120155 APH_ChoK_like Aminoglycoside 3'-phosphotransferase 87.35
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 87.34
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 87.21
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 87.21
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 87.17
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 87.02
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 86.85
cd05154 223 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 an 86.7
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 86.49
PTZ00263 329 protein kinase A catalytic subunit; Provisional 86.29
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 86.13
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 86.1
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 85.98
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 85.94
KOG1166|consensus 974 85.91
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 85.63
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 85.61
smart00220 244 S_TKc Serine/Threonine protein kinases, catalytic 85.45
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 85.32
cd07851 343 STKc_p38 Catalytic domain of the Serine/Threonine 85.31
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 85.29
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 85.2
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 85.13
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 85.08
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 84.91
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 84.73
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 84.57
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 84.43
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 84.3
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 84.19
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 84.06
KOG0574|consensus 502 84.04
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 84.0
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 83.95
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 83.93
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 83.51
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 83.43
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 83.42
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 83.12
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 83.12
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 83.12
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 83.04
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 83.03
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 83.03
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 82.67
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 82.57
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 82.51
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 82.46
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 82.42
PTZ00284 467 protein kinase; Provisional 82.37
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 82.36
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 82.34
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 82.31
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 82.18
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 82.12
PHA02988 283 hypothetical protein; Provisional 82.05
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 81.98
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 81.92
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 81.85
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 81.77
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 81.69
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 81.51
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 81.38
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 81.29
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 81.26
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 81.11
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 81.01
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 80.89
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 80.84
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 80.84
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 80.82
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 80.81
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 80.78
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 80.75
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 80.71
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 80.55
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 80.51
KOG1163|consensus 341 80.49
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 80.48
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 80.46
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 80.46
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 80.28
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 80.21
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 80.18
>KOG1235|consensus Back     alignment and domain information
Probab=100.00  E-value=1e-47  Score=367.58  Aligned_cols=176  Identities=39%  Similarity=0.617  Sum_probs=160.1

Q ss_pred             HHHHHHHHHhhcCCCCCCCcHHHHHHHHHHHHHHHHHHHHHHHhcChHHHHHHHHHHcCCCCCcHHHHHHHHHHhcCCCC
Q psy4056          52 NIAYIYKKALYQKATPDPTSEEYSNLKSKVHKEAAEQLLELCKMNKGVYIKVGQHIGALEYLLPKEYVETMKVLHSKAPM  131 (227)
Q Consensus        52 ~i~~~y~~~l~~~~~~~~~~~~~~~~~~~~h~~~a~~l~~~~~~lGg~~iKlGQ~lstr~dllP~~~~~~L~~Lqd~~p~  131 (227)
                      .+.++|.........+...++...+....+|.+.|++|+++|++|||+|||+||++|+++|++|+||.++|+.|||++||
T Consensus        60 ~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~~~a~~L~e~~~~nGg~yIKlGQ~lst~~dllP~Eyv~~L~~LqD~~Pp  139 (538)
T KOG1235|consen   60 PGVLDYKHSLSALAVSLASSESRLSKLSKVLLSAAERLLELFLRNGGTYIKLGQHLSTRPDLLPKEYVKTLSELQDQAPP  139 (538)
T ss_pred             ceEEehhhhcchhhccccchhhhHHHHHHHHHHHHHHHHHHHHHcCCeEEEechhhccccccCcHHHHHHHHHHhccCCC
Confidence            34455554442222324455656677788899999999999999999999999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHHhcCCChhhhccccCccccceeeccceEEEEecCCCEEEEEecCCCcHHHHHHHHHHHHHHHHHHHHhC
Q psy4056         132 SPMKDILAVLKEDLGKDPSEIFASIEPNPMGAASLAQVHKATLHDGSTIALKVQHRNVRDNANIDIKCMEALVHVVAWVF  211 (227)
Q Consensus       132 ~~~~~v~~~l~~elG~~~~~~F~~fd~~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~~~i~~Dl~~l~~l~~~~~~~~  211 (227)
                      .|++++.++|++|||.+++++|.+||++||||||+||||+|+|++|++|||||||||+++.+..|+.+++.++.+++++|
T Consensus       140 ~~~ee~~~i~e~ElG~~ie~if~~f~~~piaaASlaQVhrA~L~~G~~VaVKVQ~P~l~~~~~~Dl~~~~~~~~~l~k~~  219 (538)
T KOG1235|consen  140 FPWEEAFKIFEEELGAPIEDIFSEFDEEPIAAASLAQVHRARLKNGEDVAVKVQHPGLEKLIMLDLRNLRLLAKVLQKFF  219 (538)
T ss_pred             CCHHHHHHHHHHHhCCCHHHHHHhcCcchhhhcchhheEEEEecCCCEEEEEecCcChHHHHHHHHHHHHHHHHHHHHhC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCcchHHHHHHhcC
Q psy4056         212 PEFKFLWLVDETKRNI  227 (227)
Q Consensus       212 p~~~~~~l~~E~~~~l  227 (227)
                      |++++.|++||++++|
T Consensus       220 p~~~~~~lvdE~~~~L  235 (538)
T KOG1235|consen  220 PDFDLVWLVDEIAKSL  235 (538)
T ss_pred             cCCchhhHHHHHHhhh
Confidence            9999999999999876



>COG0661 AarF Predicted unusual protein kinase [General function prediction only] Back     alignment and domain information
>TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase Back     alignment and domain information
>PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed Back     alignment and domain information
>KOG1236|consensus Back     alignment and domain information
>PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] Back     alignment and domain information
>KOG1234|consensus Back     alignment and domain information
>cd05145 RIO1_like RIO kinase family; RIO1, RIO3 and similar proteins, catalytic domain Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>cd05119 RIO RIO kinase family, catalytic domain Back     alignment and domain information
>smart00090 RIO RIO-like kinase Back     alignment and domain information
>cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd00180 PKc Catalytic domain of Protein Kinases Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>smart00221 STYKc Protein kinase; unclassified specificity Back     alignment and domain information
>cd05151 ChoK Choline Kinase (ChoK) Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>PF03881 Fructosamin_kin: Fructosamine kinase; InterPro: IPR016477 Ketosamines derive from a non-enzymatic reaction between a sugar and a protein [] Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>PRK10593 hypothetical protein; Provisional Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>KOG0595|consensus Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>PRK14879 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05120 APH_ChoK_like Aminoglycoside 3'-phosphotransferase (APH) and Choline Kinase (ChoK) family Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>cd05154 ACAD10_11_like Acyl-CoA dehydrogenase (ACAD) 10 and 11, N-terminal domain, and similar proteins Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>KOG1166|consensus Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>smart00220 S_TKc Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>KOG1163|consensus Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.24
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 98.32
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 97.89
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 97.74
3d1u_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 96.98
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 96.41
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 96.31
3f7w_A 288 Putative fructosamine-3-kinase; YP_290396.1, struc 96.05
1zth_A 258 RIO1 serine protein kinase; ribosome biogenesis, r 96.01
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 95.57
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 95.42
1nd4_A 264 Aminoglycoside 3'-phosphotransferase; protein kina 95.04
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 94.98
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 94.9
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 94.82
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 94.62
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 94.49
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 94.46
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 94.33
3an0_A 340 Dual specificity mitogen-activated protein kinase; 94.2
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 94.17
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 94.16
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 93.94
4gyi_A 397 RIO2 kinase; protein kinase, ADP complex, phosphoa 93.93
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 93.91
1zar_A 282 RIO2 kinase; serine kinase, winged-helix, RIO doma 93.91
4aoj_A 329 High affinity nerve growth factor receptor; transf 93.33
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 93.32
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 93.12
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 93.1
3uqc_A 286 Probable conserved transmembrane protein; structur 93.06
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 93.03
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 93.02
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 92.97
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 92.91
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 92.81
3q4u_A 301 Activin receptor type-1; structural genomics conso 92.64
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 92.64
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 92.35
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 92.3
3jr1_A 312 Putative fructosamine-3-kinase; YP_719053.1, struc 92.28
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 92.15
2olc_A 397 MTR kinase, methylthioribose kinase; kinase ADP-2H 92.0
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 91.93
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 91.84
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 91.77
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 91.7
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 91.65
3niz_A 311 Rhodanese family protein; structural genomics, str 91.52
3bhy_A 283 Death-associated protein kinase 3; death associate 91.49
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 91.35
2a19_B 284 Interferon-induced, double-stranded RNA-activated 91.28
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 91.26
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 91.24
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 91.2
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 91.14
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 91.12
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 91.12
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 91.05
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 91.04
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 91.01
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 90.91
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 90.89
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 90.89
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 90.88
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 90.84
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 90.81
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 90.76
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 90.75
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 90.74
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 90.72
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 90.69
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 90.68
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 90.66
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 90.65
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 90.62
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 90.61
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 90.38
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 90.33
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 90.25
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 90.22
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 90.17
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 90.15
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 90.15
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 90.14
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 90.12
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 90.05
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 90.0
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 89.97
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 89.92
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 89.86
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 89.85
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 89.81
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 89.75
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 89.7
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 89.68
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 89.63
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 89.61
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 89.57
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 89.48
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 89.41
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 89.35
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 89.32
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 89.32
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 89.32
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 89.27
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 89.26
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 89.2
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 89.18
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 89.12
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 89.12
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 89.11
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 89.06
3o0g_A 292 Cell division protein kinase 5; kinase activator c 89.04
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 88.91
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 88.8
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 88.77
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 88.73
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 88.67
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 88.55
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 88.53
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 88.53
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 88.5
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 88.38
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 88.37
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 88.36
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 88.34
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 88.28
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 88.25
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 88.25
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 88.17
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 88.09
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 87.96
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 87.92
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 87.86
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 87.82
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 87.8
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 87.79
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 87.77
3aln_A 327 Dual specificity mitogen-activated protein kinase; 87.76
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 87.74
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 87.7
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 87.7
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 87.68
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 87.68
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 87.59
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 87.58
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 87.57
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 87.56
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 87.47
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 87.21
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 87.13
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 87.1
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 87.09
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 87.05
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 87.04
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 86.94
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 86.74
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 86.73
3ork_A 311 Serine/threonine protein kinase; structural genomi 86.67
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 86.64
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 86.56
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 86.56
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 86.49
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 86.43
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 86.4
2dyl_A 318 Dual specificity mitogen-activated protein kinase 86.26
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 86.16
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 86.13
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 86.1
3fme_A 290 Dual specificity mitogen-activated protein kinase; 85.83
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 85.77
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 85.73
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 85.68
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 85.67
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 85.54
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 85.53
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 85.52
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 85.51
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 85.5
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 85.46
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 85.45
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 85.45
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 85.37
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 85.24
3rp9_A 458 Mitogen-activated protein kinase; structural genom 85.21
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 85.16
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 85.12
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 85.09
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 85.07
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 85.07
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 84.81
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 84.79
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 84.71
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 84.69
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 84.65
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 84.63
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 84.49
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 84.49
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 84.27
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 84.27
1zyl_A 328 Hypothetical protein YIHE; putative protein kinase 84.13
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 84.01
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 83.96
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 83.9
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 83.81
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 83.79
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 83.78
3i1a_A 339 Spectinomycin phosphotransferase; protein kinase, 83.72
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 83.56
3soc_A 322 Activin receptor type-2A; structural genomics cons 83.45
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 83.4
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 83.38
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 83.28
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 83.22
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 82.94
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 82.82
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 82.78
3ovc_A 362 Hygromycin-B 4-O-kinase; aminoglycoside phosphotra 82.53
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 82.51
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 82.49
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 82.35
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 82.21
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 82.15
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 82.0
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 80.93
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 80.88
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 80.54
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 80.45
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 80.38
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
Probab=99.24  E-value=3.7e-12  Score=114.16  Aligned_cols=111  Identities=8%  Similarity=0.006  Sum_probs=41.6

Q ss_pred             HHHHHHHHHHHHHHHHhcChHHH-HHHHHHHcCCCCCcHHHHHHHHHHhcCCCCCCHHHHHHHHHHhcCCChhhhccccC
Q psy4056          79 SKVHKEAAEQLLELCKMNKGVYI-KVGQHIGALEYLLPKEYVETMKVLHSKAPMSPMKDILAVLKEDLGKDPSEIFASIE  157 (227)
Q Consensus        79 ~~~h~~~a~~l~~~~~~lGg~~i-KlGQ~lstr~dllP~~~~~~L~~Lqd~~p~~~~~~v~~~l~~elG~~~~~~F~~fd  157 (227)
                      +..|.+.|+++.+.+.++++..+ +++|.+...++.. ++++.++++++|.+|+.+++.+.+.++.++|.+..+.|.+|+
T Consensus        15 ~~~~~~r~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~-~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   93 (365)
T 2y7j_A           15 FNKERRRARREIRHLPNLNREQRRAFIRSLRDDPSQS-ANLLAEAKKLNDAQPKGTENLYFQSMGPEDELPDWAAAKEFY   93 (365)
T ss_dssp             --------------------------------------------------------------------CBCHHHHHHHHH
T ss_pred             chHHHHHHHHHHhcCccchhcccccccccccCCCchh-HHHHHHHHhhhhcCCCCccccccccCCchhhcccchhhhhhh
Confidence            35677889999999999999988 8888888777644 456678999999999999999999999999999988888888


Q ss_pred             c-----cccceeeccceEEEEec-CCCEEEEEecCCCcH
Q psy4056         158 P-----NPMGAASLAQVHKATLH-DGSTIALKVQHRNVR  190 (227)
Q Consensus       158 ~-----~PiasASIaQVHrA~L~-~G~~VAVKVq~P~i~  190 (227)
                      .     ++||+||.||||+|+.+ +|+.||||+++|+..
T Consensus        94 ~~y~~~~~lg~G~~g~Vy~a~~~~~g~~vavK~~~~~~~  132 (365)
T 2y7j_A           94 QKYDPKDVIGRGVSSVVRRCVHRATGHEFAVKIMEVTAE  132 (365)
T ss_dssp             HHEEEEEEEEECSSEEEEEEEETTTCCEEEEEEEETTSS
T ss_pred             hhcccceEEecCCCEEEEEEEECCCCcEEEEEEEEcccc
Confidence            7     89999999999999997 899999999999874



>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>3f7w_A Putative fructosamine-3-kinase; YP_290396.1, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI-2; 1.85A {Thermobifida fusca YX} Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>1nd4_A Aminoglycoside 3'-phosphotransferase; protein kinase, ATPase, kanamycin; HET: KAN; 2.10A {Klebsiella pneumoniae} SCOP: d.144.1.6 Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3jr1_A Putative fructosamine-3-kinase; YP_719053.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 2.32A {Haemophilus somnus 129PT} Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>2olc_A MTR kinase, methylthioribose kinase; kinase ADP-2HO complex, transferase; HET: CPS ADP; 2.00A {Bacillus subtilis} SCOP: d.144.1.6 PDB: 2pu8_A* 2pui_A* 2pul_A* 2pun_A* 2pup_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>1zyl_A Hypothetical protein YIHE; putative protein kinase, structural genomics, PSI, protein structure initiative; 2.80A {Escherichia coli} SCOP: d.144.1.6 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>3i1a_A Spectinomycin phosphotransferase; protein kinase, aminoglycoside phosphotransferase, antibiotic resistance; HET: MES PG4; 1.70A {Legionella pneumophila} PDB: 3i0q_A* 3i0o_A* 3q2m_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query227
d1zara2 191 Rio2 serine protein kinase C-terminal domain {Arch 97.19
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 96.19
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 96.15
d1zyla1 325 RdoA {Escherichia coli [TaxId: 562]} 96.15
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 96.1
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 95.94
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 95.4
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 95.31
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 95.27
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 95.07
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 94.99
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 94.87
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 94.81
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 94.74
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 94.61
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 94.55
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 94.5
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 94.32
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 94.26
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 94.15
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 94.13
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 94.02
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 93.97
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 93.94
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 93.91
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 93.89
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 93.88
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 93.88
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 93.86
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 93.78
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 93.73
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 93.49
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 93.4
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 93.25
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 93.23
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 93.1
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 93.09
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 92.85
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 92.85
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 92.78
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 92.58
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 92.38
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 92.33
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 92.27
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 92.12
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 91.91
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 91.82
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 91.75
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 91.61
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 91.36
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 91.26
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 91.12
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 91.08
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 90.92
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 90.7
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 90.66
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 90.63
d1nd4a_ 255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 89.95
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 89.9
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 89.68
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 89.37
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 88.3
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 87.8
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 87.39
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 85.55
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: RIO1-like kinases
domain: Rio2 serine protein kinase C-terminal domain
species: Archaeoglobus fulgidus [TaxId: 2234]
Probab=97.19  E-value=7.8e-05  Score=58.52  Aligned_cols=32  Identities=13%  Similarity=0.073  Sum_probs=27.7

Q ss_pred             cccceeeccceEEEEecCCCEEEEEecCCCcH
Q psy4056         159 NPMGAASLAQVHKATLHDGSTIALKVQHRNVR  190 (227)
Q Consensus       159 ~PiasASIaQVHrA~L~~G~~VAVKVq~P~i~  190 (227)
                      ++||+|+-|+||+|+..+|++|||||.+|+..
T Consensus         6 ~~IG~G~~g~Vy~a~~~~g~~vAvKi~r~~~~   37 (191)
T d1zara2           6 KLMGEGKESAVFNCYSEKFGECVVKFHKVGHT   37 (191)
T ss_dssp             EEEEECSSEEEEEEEETTTEEEEEEEECC---
T ss_pred             CEeeeCcceEEEEEECCCCCEEEEEEEecccc
Confidence            57999999999999999999999999998754



>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zyla1 d.144.1.6 (A:4-328) RdoA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure