Diaphorina citri psyllid: psy4089


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220---
MINKDFEEYPEHRTNFFLLLQAVNLHCFPAFLLIPQPQFKLVLDSIIWAFKHTMRNVADTGLMILHQLLVNVCHDAQSAAQSFYVTYFTEILTHVFSVVTDTSHSASLAHHAQILSYMFKLVETREVAAPLAPGVTDNVVYVQEFVARTLKSAFPHLTENQIKVTVQGMFDFNNDLPAFKEHLRDFLVQIREFTGEDDSDLFLDEIEQTLKQAQEKKRQTQLY
cccccccccHHHHHHHHHHHHHHHHccHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHcc
*INKDFEEYPEHRTNFFLLLQAVNLHCFPAFLLIPQPQFKLVLDSIIWAFKHTMRNVADTGLMILHQLLVNVCHDAQSAAQSFYVTYFTEILTHVFSVVTDTSHSASLAHHAQILSYMFKLVETREVAAPLAPGVTDNVVYVQEFVARTLKSAFPHLTENQIKVTVQGMFDFNNDLPAFKEHLRDFLVQIREFTGEDDSDLFLD*******************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MINKDFEEYPEHRTNFFLLLQAVNLHCFPAFLLIPQPQFKLVLDSIIWAFKHTMRNVADTGLMILHQLLVNVCHDAQSAAQSFYVTYFTEILTHVFSVVTDTSHSASLAHHAQILSYMFKLVETREVAAPLAPGVTDNVVYVQEFVARTLKSAFPHLTENQIKVTVQGMFDFNNDLPAFKEHLRDFLVQIREFTGEDDSDLFxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Exportin-1 Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase Ran in its active GTP-bound form. Docking of this complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of an nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the cargo from the export receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in U3 snoRNA transport from Cajal bodies to nucleoli. Binds to late precursor U3 snoRNA bearing a TMG cap.confidentQ80U96
Exportin-1 Receptor for the leucine-rich nuclear export signal (NES). Binds cooperatively to the NES on its target protein and to the small GTPase Ran in its active GTP-bound form. Required for the function or maintenance of certain tissues such as brain and gut. Involved in the export of dl from the nucleus to the cytoplasm.confidentQ9TVM2
Exportin-1 Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase Ran in its active GTP-bound form. Docking of this complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of an nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the cargo from the export receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in U3 snoRNA transport from Cajal bodies to nucleoli. Binds to late precursor U3 snoRNA bearing a TMG cap.confidentQ6P5F9

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0051168 [BP]nuclear exportprobableGO:0051169, GO:0051234, GO:0046907, GO:0006810, GO:0006913, GO:0044763, GO:0051649, GO:0008150, GO:0009987, GO:0051641, GO:0051179, GO:0044699, GO:0016482
GO:0008565 [MF]protein transporter activityprobableGO:0005215, GO:0022892, GO:0003674
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0048523 [BP]negative regulation of cellular processprobableGO:0008150, GO:0048519, GO:0065007, GO:0050789, GO:0050794
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005642 [CC]annulate lamellaeprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0042175, GO:0012505, GO:0044425
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0000776 [CC]kinetochoreprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0015031 [BP]protein transportprobableGO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W9C, chain A
Confidence level:very confident
Coverage over the Query: 1-195
View the alignment between query and template
View the model in PyMOL
Template: 3GB8, chain A
Confidence level:very confident
Coverage over the Query: 1-222
View the alignment between query and template
View the model in PyMOL