Diaphorina citri psyllid: psy4090


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110--
MATVIPPNEQFKKLLDFNQKLDITLLDNIVECMYTGMGVEQKAAQEVLTALKEHPDAWTRVDTILEYSSNQQTKFYALQILEQVIKTRWKALPREQCDVKEEKEREQNWFQR
cccccccHHHHHHHHcccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHc
**********FKKLLDFNQKLDITLLDNIVECMYTGMGVEQKAAQEVLTALKEHPDAWTRVDTILEYSSNQQTKFYALQILEQVIKTRWKALPREQCD*KEEKEREQNWF**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATVIPPNEQFKKLLDFNQKLDITLLDNIVECMYTGMGVEQKAAQEVLTALKEHPDAWTRVDTILEYSSNQQTKFYALQILEQVIKTRWKALPREQCDVKEEKEREQNWFQR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Exportin-1 Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase Ran in its active GTP-bound form. Docking of this complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of an nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the cargo from the export receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in U3 snoRNA transport from Cajal bodies to nucleoli. Binds to late precursor U3 snoRNA bearing a TMG cap.confidentQ6P5F9
Exportin-1 Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase RAN in its active GTP-bound form (Ran-GTP). Docking of this complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of an nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the cargo from the export receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in U3 snoRNA transport from Cajal bodies to nucleoli. Binds to late precursor U3 snoRNA bearing a TMG cap. Several viruses, among them HIV-1, HTLV-1 and influenza A use it to export their unspliced or incompletely spliced RNAs out of the nucleus. Interacts with, and mediates the nuclear export of HIV-1 Rev and HTLV-1 Rex proteins. Involved in HTLV-1 Rex multimerization.confidentO14980
Exportin-1 Mediates the nuclear export of cellular proteins (cargos) bearing a leucine-rich nuclear export signal (NES) and of RNAs. In the nucleus, in association with RANBP3, binds cooperatively to the NES on its target protein and to the GTPase Ran in its active GTP-bound form. Docking of this complex to the nuclear pore complex (NPC) is mediated through binding to nucleoporins. Upon transit of an nuclear export complex into the cytoplasm, disassembling of the complex and hydrolysis of Ran-GTP to Ran-GDP (induced by RANBP1 and RANGAP1, respectively) cause release of the cargo from the export receptor. The directionality of nuclear export is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus. Involved in U3 snoRNA transport from Cajal bodies to nucleoli. Binds to late precursor U3 snoRNA bearing a TMG cap.confidentQ80U96

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0042176 [BP]regulation of protein catabolic processprobableGO:0009894, GO:0080090, GO:0019222, GO:0060255, GO:0051246, GO:0065007, GO:0008150, GO:0050789
GO:0000122 [BP]negative regulation of transcription from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0045892, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0008150, GO:0010558, GO:0048523
GO:0010824 [BP]regulation of centrosome duplicationprobableGO:0051726, GO:0051493, GO:0033043, GO:0010564, GO:0050794, GO:0051128, GO:0046605, GO:0065007, GO:0008150, GO:0032886, GO:0070507, GO:0050789
GO:0005643 [CC]nuclear poreprobableGO:0005635, GO:0031975, GO:0043229, GO:0043227, GO:0043226, GO:0031224, GO:0044446, GO:0046930, GO:0016021, GO:0016020, GO:0031967, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044428, GO:0044424, GO:0044425, GO:0005634, GO:0044422
GO:0005642 [CC]annulate lamellaeprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0042175, GO:0012505, GO:0044425
GO:0046825 [BP]regulation of protein export from nucleusprobableGO:0033157, GO:0070201, GO:0032879, GO:0060341, GO:0051049, GO:0032386, GO:0050794, GO:0008150, GO:0046822, GO:0065007, GO:0051223, GO:0050789, GO:0032880
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0019904 [MF]protein domain specific bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0034504 [BP]protein localization to nucleusprobableGO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0033365, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0000776 [CC]kinetochoreprobableGO:0043234, GO:0005575, GO:0005622, GO:0032991, GO:0043232, GO:0044464, GO:0005623, GO:0043226, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0000775, GO:0044422
GO:0006611 [BP]protein export from nucleusprobableGO:0051169, GO:0051168, GO:0016482, GO:0008104, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0033036, GO:0034613, GO:0006810, GO:0006913, GO:0045184, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0046907, GO:0015031, GO:0008150, GO:0009987
GO:0030529 [CC]ribonucleoprotein complexprobableGO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0000236 [BP]mitotic prometaphaseprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007067, GO:0007049, GO:0022403
GO:0016071 [BP]mRNA metabolic processprobableGO:0016070, GO:0006139, GO:0044260, GO:0044238, GO:0009987, GO:0006725, GO:0044237, GO:0043170, GO:0090304, GO:0071704, GO:0034641, GO:0006807, GO:0008150, GO:0008152, GO:1901360, GO:0046483
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0005049 [MF]nuclear export signal receptor activityprobableGO:0008565, GO:0005215, GO:0022892, GO:0003674
GO:0000087 [BP]M phase of mitotic cell cycleprobableGO:0044699, GO:0000279, GO:0000278, GO:0009987, GO:0008150, GO:0044763, GO:0022403, GO:0022402, GO:0007049
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051028 [BP]mRNA transportprobableGO:0015931, GO:0050658, GO:0051234, GO:0033036, GO:0050657, GO:0071705, GO:0008150, GO:0006810, GO:0071702, GO:0051236, GO:0006403, GO:0051179
GO:0005816 [CC]spindle pole bodyprobableGO:0043234, GO:0005575, GO:0005819, GO:0032991, GO:0005622, GO:0043232, GO:0005856, GO:0044464, GO:0005623, GO:0005815, GO:0044446, GO:0043229, GO:0044430, GO:0044422, GO:0044424, GO:0043228, GO:0000922, GO:0043226, GO:0015630
GO:0019058 [BP]viral infectious cycleprobableGO:0044703, GO:0000003, GO:0009987, GO:0022415, GO:0022414, GO:0044764, GO:0008150, GO:0016032, GO:0051704
GO:0007179 [BP]transforming growth factor beta receptor signaling pathwayprobableGO:0007166, GO:0023052, GO:0007165, GO:0070887, GO:0007167, GO:0050789, GO:0044699, GO:0009719, GO:0051716, GO:0070848, GO:0071310, GO:0065007, GO:0071559, GO:0071495, GO:0009987, GO:0050794, GO:0042221, GO:0044763, GO:0007154, GO:0010033, GO:0007178, GO:0044700, GO:0071363, GO:0050896, GO:0071560, GO:0008150
GO:0031965 [CC]nuclear membraneprobableGO:0005575, GO:0005635, GO:0031090, GO:0005634, GO:0016020, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005623, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0030512 [BP]negative regulation of transforming growth factor beta receptor signaling pathwayprobableGO:0090287, GO:0009968, GO:0090101, GO:0009966, GO:0048583, GO:0048585, GO:0017015, GO:0090288, GO:0050794, GO:0090092, GO:0023057, GO:0065007, GO:0010648, GO:0008150, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0034399 [CC]nuclear peripheryprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0010467 [BP]gene expressionprobableGO:0071704, GO:0008150, GO:0008152, GO:0043170

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3GJX, chain A
Confidence level:very confident
Coverage over the Query: 10-106
View the alignment between query and template
View the model in PyMOL