Diaphorina citri psyllid: psy4094

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660---

MEDILTPPDTPENTKSSRKSVKYSTLPGASSLAVISNEKTNLKFGSVFSLSSQSDQSEKSPRKTSISSPEEKQKRRRFSFLSDKTEKLARKLSISSEKLDKKSAKQSTEKVNEKPVKKSSIEQVNERGVDVEFSTSAPLESTTSKKSPLKFKLLKKLSFSKKPKTKEKPVKKSSIEQVNERGVDVEFSTSAPLESTTSKKSPLKFKLLKKLSFSKKPKTKEESSEDTMDGKNGGKSKKKGGKTKFKKIVPVEPSALASPNTIPDTPPTPQNSKVFLEKEREVKEREGEQQEGGSVTSSPSITPTPPTQSDTSLLSTPAQSQDLDSATDNDETYDTPMGTSPNSSVMNQAPGDSDQDLDVTLKENTELPSAAAAASDVKSPSDLKKEILSITTPIVTEAGRKKHNEPKPFTSPNSSSNGEKETAASPNTSVVAGKTSITNGSSKEVSPYSKMPDKREFLYKILVIGELGAGKTSIIKRYVHQFFSPHYRATIGVDFALKVLSWDHETIIRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRAATFDAVLKWKQDLDAKVTLPDGNPIPCVLLANKCDQPKEGIANNPAKIDEFIKEHNFSGWFETSAKDNINIDDAAKTLVQKILENDKVQANGDSHATSEAVFSLNRNSQETKNGRNCAC

ccccccccccccccccccccEEEcccccccEEEEEEccccccccccEEEEccccccccccccccccccHHHHHHccccEEEEcHHHHHHHHHHccHHHHHHHHHccccccccccccccccHHHHcccccEEEccccccccccccccccccHHccccccccccccccccccccccHHHHccccccccccccccccccccccccccEEEEEHHcccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHccccccccHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEccccccHHHHHHHHHcccccccccccccccccccEEEEcccEEEEEEEEEcccccccccccHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHHccccccccccEEEEEEccccccccccccHHHHHHHHHHccccCEEEccccccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccc

*****T*******************LPGASSLAVISNEKTNLKFGS***********************************SDKTEK****************************************************************************************************************************************************************IVPVEPSAL*******************************************************************************************************************************************************************************************************EFLYKILVIGELGAGKTSIIKRYVHQFFSPHYRATIGVDFALKVLSWDHETIIRLQLWDIAGQERFGNMTRVYYKEAVGAFIVFDVTRAATFDAVLKWKQDLDAKVTLPDGNPIPCVLLANKCDQPKEGIANNPAKIDEFIKEHNFSGWFETSAKDNINIDDAAKTLVQKIL************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ras-related protein Rab-32	Acts as an A-kinase anchoring protein by binding to the type II regulatory subunit of protein kinase A and anchoring it to the mitochondrion. Also involved in synchronization of mitochondrial fission.	confident	Q06AU5
Ras-related protein Rab-32	Acts as an A-kinase anchoring protein by binding to the type II regulatory subunit of protein kinase A and anchoring it to the mitochondrion. Also involved in synchronization of mitochondrial fission.	confident	Q13637
Ras-related protein Rab-32	Acts as an A-kinase anchoring protein by binding to the type II regulatory subunit of protein kinase A and anchoring it to the mitochondrion. Also involved in synchronization of mitochondrial fission.	confident	Q9CZE3

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0003924 [MF]	GTPase activity	probable	GO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0044425 [CC]	membrane part	probable	GO:0005575, GO:0016020
GO:0043025 [CC]	neuronal cell body	probable	GO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0030670 [CC]	phagocytic vesicle membrane	probable	GO:0030139, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0030666, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0030659, GO:0045335, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0010008 [CC]	endosome membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044440, GO:0044424, GO:0005768, GO:0043226, GO:0044422, GO:0043231
GO:0044463 [CC]	cell projection part	probable	GO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0044765 [BP]	single-organism transport	probable	GO:0051234, GO:0006810, GO:0008150, GO:0051179, GO:0044699
GO:0005764 [CC]	lysosome	probable	GO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0060155 [BP]	platelet dense granule organization	probable	GO:0006996, GO:0071840, GO:0009987, GO:0016050, GO:0044763, GO:0033363, GO:0008150, GO:0044699, GO:0016043
GO:0090383 [BP]	phagosome acidification	probable	GO:0050801, GO:0042592, GO:0016043, GO:0051453, GO:0051452, GO:0044699, GO:0006885, GO:0090382, GO:0065007, GO:0071840, GO:0065008, GO:0019725, GO:0045851, GO:0030641, GO:0009987, GO:0006873, GO:0030004, GO:0008150, GO:0055067, GO:0030003, GO:0055080, GO:0055082, GO:0006996, GO:0048878, GO:0044763
GO:0055037 [CC]	recycling endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0043234 [CC]	protein complex	probable	GO:0005575, GO:0032991
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0044430 [CC]	cytoskeletal part	probable	GO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0030141 [CC]	secretory granule	probable	GO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0019003 [MF]	GDP binding	probable	GO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0007264 [BP]	small GTPase mediated signal transduction	probable	GO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0007154, GO:0035556, GO:0050789, GO:0044699
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005770 [CC]	late endosome	probable	GO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005774 [CC]	vacuolar membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044437, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0016192 [BP]	vesicle-mediated transport	probable	GO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0005525 [MF]	GTP binding	probable	GO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0046907 [BP]	intracellular transport	probable	GO:0009987, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0005634 [CC]	nucleus	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0017157 [BP]	regulation of exocytosis	probable	GO:0051046, GO:0060341, GO:0051049, GO:0050794, GO:0060627, GO:0065007, GO:0008150, GO:0032879, GO:0050789
GO:0009504 [CC]	cell plate	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005802 [CC]	trans-Golgi network	probable	GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0006184 [BP]	GTP catabolic process	probable	GO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005795 [CC]	Golgi stack	probable	GO:0005737, GO:0005794, GO:0043231, GO:0043229, GO:0044464, GO:0044444, GO:0005623, GO:0005622, GO:0044446, GO:0044431, GO:0005575, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0044456 [CC]	synapse part	probable	GO:0005575, GO:0045202
GO:0030136 [CC]	clathrin-coated vesicle	probable	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0031982
GO:0015031 [BP]	protein transport	probable	GO:0033036, GO:0008104, GO:0006810, GO:0045184, GO:0008150, GO:0071702, GO:0051234, GO:0051179
GO:0005886 [CC]	plasma membrane	probable	GO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BCG, chain Y
Confidence level:very confident
Coverage over the Query: 455-633
View the alignment between query and template
View the model in PyMOL

Template: 4DKX, chain A
Confidence level:very confident
Coverage over the Query: 458-484,495-626
View the alignment between query and template
View the model in PyMOL