Diaphorina citri psyllid: psy4097


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MTPYVECINTQGYRKCGQCPHGWVGDGTTCRQGTTGCSVQNGGCHPLATCRETSDTVRSVISCTCPPGMGGSGVGLMGCAYGMSGNPCGGVTCEHGGICAPIGDRGYRCQCEPGFTGESELLVPLLSVF
cccccEEECccccccccccccccccccccEEcccccccccccccccccEEEEcccccccEEEEEcccccCCccccccccccccccccccccccccccEEEEcccccEEEEcccccCCcccccccccccc
MTPYVECINTQGYRKCGQCPHGWVGDGTTCRQGTTGCSVQNGGCHPLATCRETSDTVRSVISCTCPPGMGGSGVGLMGCAYGMSGNPCGGVTCEHGGICAPIGDRGYRCQCEPGFTGESELLVPLLSVF
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTPYVECINTQGYRKCGQCPHGWVGDGTTCRQGTTGCSVQNGGCHPLATCRETSDTVRSVISCTCPPGMGGSGVGLMGCAYGMSGNPCGGVTCEHGGICAPIGDRGYRCQCEPGFTGESELLVPLLSVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0006355 [BP]regulation of transcription, DNA-dependentprobableGO:0009889, GO:0080090, GO:0019222, GO:0060255, GO:0031326, GO:0031323, GO:0051252, GO:2000112, GO:0050794, GO:0050789, GO:0019219, GO:0010556, GO:0065007, GO:0051171, GO:2001141, GO:0008150, GO:0010468
GO:0016337 [BP]cell-cell adhesionprobableGO:0009987, GO:0008150, GO:0007155, GO:0044763, GO:0022610, GO:0044699
GO:0043167 [MF]ion bindingprobableGO:0003674, GO:0005488
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0009967 [BP]positive regulation of signal transductionprobableGO:0009966, GO:0048584, GO:0048583, GO:0050794, GO:0023056, GO:0065007, GO:0023051, GO:0048518, GO:0008150, GO:0010647, GO:0010646, GO:0050789, GO:0048522
GO:0045596 [BP]negative regulation of cell differentiationprobableGO:0051093, GO:0050793, GO:0050794, GO:0008150, GO:0045595, GO:0065007, GO:0048519, GO:0050789, GO:0048523
GO:0005887 [CC]integral to plasma membraneprobableGO:0031226, GO:0016021, GO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0044459, GO:0031224
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0045177 [CC]apical part of cellprobableGO:0005575, GO:0044464, GO:0005623
GO:0044767 [BP]single-organism developmental processprobableGO:0032502, GO:0008150, GO:0044699
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0042127 [BP]regulation of cell proliferationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0009986 [CC]cell surfaceprobableGO:0005575, GO:0044464, GO:0005623
GO:0048699 [BP]generation of neuronsprobableGO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0009987, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0022008, GO:0007275, GO:0044699
GO:0042995 [CC]cell projectionprobableGO:0005575, GO:0044464, GO:0005623
GO:0042221 [BP]response to chemical stimulusprobableGO:0050896, GO:0008150

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YO8, chain A
Confidence level:very confident
Coverage over the Query: 3-121
View the alignment between query and template
View the model in PyMOL