Diaphorina citri psyllid: psy4099

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MAVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLASDLEFD
cCEEEEcccccEEEccccEEEccccccccccccccEEEEEcccccEEEEEEcEEEEECcccccccccccEEEEEcccccccccCEECccccccccEEECccEEEEEEEEcccccccccEEEEEEECccccccEECcccCEEEccccccccccccccEEEEEEccccEEEEEEEEEEEccccccccccccc
MAVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLASDLEFD
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLASDLEFD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044421 [CC]extracellular region partprobableGO:0005575, GO:0005576
GO:0044463 [CC]cell projection partprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0007275 [BP]multicellular organismal developmentprobableGO:0032502, GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:2000026 [BP]regulation of multicellular organismal developmentprobableGO:0050793, GO:0008150, GO:0065007, GO:0050789, GO:0051239
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0044430 [CC]cytoskeletal partprobableGO:0005856, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0043226, GO:0044422
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789
GO:0005518 [MF]collagen bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0048519 [BP]negative regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0006508 [BP]proteolysisprobableGO:0044238, GO:0019538, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0030659 [CC]cytoplasmic vesicle membraneprobableGO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0005575, GO:0031090, GO:0016023, GO:0031410, GO:0016020, GO:0031988, GO:0044433, GO:0012505, GO:0012506, GO:0031982, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0044422
GO:0071310 [BP]cellular response to organic substanceprobableGO:0051716, GO:0050896, GO:0009987, GO:0008150, GO:0044763, GO:0070887, GO:0042221, GO:0010033, GO:0044699
GO:0030424 [CC]axonprobableGO:0044464, GO:0005623, GO:0005575, GO:0097458, GO:0043005, GO:0042995
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0031012 [CC]extracellular matrixprobableGO:0005575
GO:0016043 [BP]cellular component organizationprobableGO:0008150, GO:0071840
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0043085 [BP]positive regulation of catalytic activityprobableGO:0019222, GO:0050790, GO:0065007, GO:0044093, GO:0008150, GO:0065009, GO:0050789
GO:0044459 [CC]plasma membrane partprobableGO:0016020, GO:0044464, GO:0005623, GO:0005575, GO:0071944, GO:0005886, GO:0044425
GO:0071495 [BP]cellular response to endogenous stimulusprobableGO:0009719, GO:0050896, GO:0008150
GO:0030139 [CC]endocytic vesicleprobableGO:0005737, GO:0031982, GO:0016023, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3KQ4, chain B
Confidence level:very confident
Coverage over the Query: 4-188
View the alignment between query and template
View the model in PyMOL