Psyllid ID: psy4099

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190
MAVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLASDLEFD
cEEEEEcccccEEEccccEEEccccccccccccccEEEEEcccccEEEEEEcEEEEEEcccccccccccEEEEEcccccccccEEEEccccccccEEEEccEEEEEEEEcccccccccEEEEEEEEccccccEEEcccEEEEccccccccccccccEEEEEEccccEEEEEEEEEEEccccccccccccc
cccEEEcccccEEEccccEEEccccccccccccEEEEEEEEccccEEEEEEEEEEEccccccccccccEEEEEEcccccccccccccccccccccEEEcccEEEEEEEEcccccccccEEEEEEEcccccccEEcccccEEEccccccccccccEEEEEEEEccccEEEEEEEEEEEccccccccccccc
mavnlsttcggnfyspegtltspqypdpyppnmlcvwtltvprgqqirlNFTTFQLEryfcnptcgdtdylevrdggyesspqlgiyccknhpgeitssghQLYIKFfsdddrfkypgfkitwdsastgcggiltgssgsiispgypypyayrtTCYWKIYVSQGSSITLWSLDVQLDCNKLlasdlefd
mavnlsttcggnfyspEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLASDLEFD
MAVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSAstgcggiltgssgsiispgypypyAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLASDLEFD
************F***************YPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLA******
MAVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLASDLEFD
********CGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLASDLEFD
MAVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLASDLEFD
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLDCNKLLASDLEFD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query190 2.2.26 [Sep-21-2011]
Q9JLB4 3623 Cubilin OS=Mus musculus G yes N/A 0.910 0.047 0.435 2e-34
O70244 3623 Cubilin OS=Rattus norvegi yes N/A 0.910 0.047 0.423 5e-33
O60494 3623 Cubilin OS=Homo sapiens G yes N/A 0.910 0.047 0.446 2e-28
Q9TU53 3620 Cubilin OS=Canis familiar yes N/A 0.915 0.048 0.406 3e-25
P98070707 Bone morphogenetic protei N/A N/A 0.831 0.223 0.338 9e-24
O57460 1022 Dorsal-ventral patterning no N/A 0.957 0.178 0.297 2e-22
Q9Y6L7 1015 Tolloid-like protein 2 OS no N/A 0.936 0.175 0.298 2e-22
Q9WVM6 1012 Tolloid-like protein 2 OS no N/A 0.921 0.172 0.298 2e-22
O57382 1019 Tolloid-like protein 2 OS N/A N/A 0.915 0.170 0.308 7e-22
Q62381 1013 Tolloid-like protein 1 OS no N/A 0.957 0.179 0.293 1e-21
>sp|Q9JLB4|CUBN_MOUSE Cubilin OS=Mus musculus GN=Cubn PE=1 SV=3 Back     alignment and function desciption
 Score =  145 bits (365), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 77/177 (43%), Positives = 108/177 (61%), Gaps = 4/177 (2%)

Query: 2    AVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFC 61
            A+N S+ C  ++    G L+SP +P+ YP N  CV+ +TV   QQI L+FT F LE YF 
Sbjct: 1041 AINASSVCLYDYTDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYF- 1099

Query: 62   NPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKI 121
             P C   D++E+RDGG+E+SP +GIYC    P  I S  ++L+++F SD       GF  
Sbjct: 1100 GPKC--VDFVEIRDGGFETSPLIGIYCGSVFPPRIISHSNKLWLRFKSDT-ALTARGFSA 1156

Query: 122  TWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLD 178
             WD++STGCGG LT  +G + SP YP PY + + CYW++  S+GS   L   D  L+
Sbjct: 1157 YWDASSTGCGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASRGSPFLLEFQDFHLE 1213
Cotransporter which plays a role in lipoprotein, vitamin and iron metabolism, by facilitating their uptake. Binds to ALB, MB, Kappa and lambda-light chains, TF, hemoglobin, GC, SCGB1A1, APOA1, high density lipoprotein, and the GIF-cobalamin complex. The binding of all ligands requires calcium. Serves as important transporter in several absorptive epithelia, including intestine, renal proximal tubules and embryonic yolk sac. Interaction with LRP2 mediates its trafficking throughout vesicles and facilitates the uptake of specific ligands like GC, hemoglobin, ALB, TF and SCGB1A1. Interaction with AMN controls its trafficking to the plasma membrane and facilitates endocytosis of ligands. May play an important role in the development of the peri-implantation embryo through internalization of APOA1 and cholesterol. Binds to LGALS3 at the maternal-fetal interface.
Mus musculus (taxid: 10090)
>sp|O70244|CUBN_RAT Cubilin OS=Rattus norvegicus GN=Cubn PE=1 SV=2 Back     alignment and function description
>sp|O60494|CUBN_HUMAN Cubilin OS=Homo sapiens GN=CUBN PE=1 SV=5 Back     alignment and function description
>sp|Q9TU53|CUBN_CANFA Cubilin OS=Canis familiaris GN=CUBN PE=1 SV=1 Back     alignment and function description
>sp|P98070|BMP1_XENLA Bone morphogenetic protein 1 OS=Xenopus laevis GN=bmp1 PE=1 SV=1 Back     alignment and function description
>sp|O57460|TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio GN=tll1 PE=2 SV=1 Back     alignment and function description
>sp|Q9Y6L7|TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens GN=TLL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9WVM6|TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus GN=Tll2 PE=1 SV=1 Back     alignment and function description
>sp|O57382|TLL2_XENLA Tolloid-like protein 2 OS=Xenopus laevis GN=tll2 PE=2 SV=1 Back     alignment and function description
>sp|Q62381|TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus GN=Tll1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
328777634 3691 PREDICTED: LOW QUALITY PROTEIN: cubilin 0.910 0.046 0.483 2e-42
380015478 3703 PREDICTED: LOW QUALITY PROTEIN: cubilin- 0.9 0.046 0.477 8e-42
242006366 2238 cubilin, putative [Pediculus humanus cor 0.915 0.077 0.5 9e-39
340712800 3686 PREDICTED: cubilin-like [Bombus terrestr 0.910 0.046 0.443 4e-38
350409211 3686 PREDICTED: cubilin-like [Bombus impatien 0.910 0.046 0.443 5e-38
312374507 3045 hypothetical protein AND_15824 [Anophele 0.915 0.057 0.435 6e-38
158294318 3745 AGAP005526-PA [Anopheles gambiae str. PE 0.910 0.046 0.438 6e-38
270005018 4051 hypothetical protein TcasGA2_TC007013 [T 0.926 0.043 0.469 5e-37
189236895 3759 PREDICTED: C3PO protein [Tribolium casta 0.926 0.046 0.469 6e-37
241599043 1203 cubilin, putative [Ixodes scapularis] gi 0.878 0.138 0.470 7e-37
>gi|328777634|ref|XP_394526.3| PREDICTED: LOW QUALITY PROTEIN: cubilin [Apis mellifera] Back     alignment and taxonomy information
 Score =  177 bits (450), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 86/178 (48%), Positives = 114/178 (64%), Gaps = 5/178 (2%)

Query: 1    MAVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYF 60
            M V+ S  CGG+F  P G + SP YP+ YP    CVW +     Q++ +N   F LER+ 
Sbjct: 1067 MFVDASKVCGGHFVKPIGVIKSPNYPNRYPHGRECVWVIEAANKQRVIINVEKFSLERH- 1125

Query: 61   CNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFK 120
               TCG +DYLE+R+GGYE+SP +G +C  + P EI S  +QLY+KF S   R  YPGF 
Sbjct: 1126 --ATCG-SDYLEIRNGGYETSPLIGKFCGTDIPSEIISQTNQLYLKFVSRS-RESYPGFS 1181

Query: 121  ITWDSASTGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQLD 178
            I WDS + GCGG LT + G IISP YP PY ++  CYWKI V++GS + L  LD++L+
Sbjct: 1182 IRWDSTTIGCGGSLTAAQGDIISPNYPMPYMHQAECYWKIAVAEGSVVRLIILDLELE 1239

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|380015478|ref|XP_003691728.1| PREDICTED: LOW QUALITY PROTEIN: cubilin-like [Apis florea] Back     alignment and taxonomy information
>gi|242006366|ref|XP_002424022.1| cubilin, putative [Pediculus humanus corporis] gi|212507314|gb|EEB11284.1| cubilin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340712800|ref|XP_003394943.1| PREDICTED: cubilin-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350409211|ref|XP_003488654.1| PREDICTED: cubilin-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|312374507|gb|EFR22050.1| hypothetical protein AND_15824 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158294318|ref|XP_315526.4| AGAP005526-PA [Anopheles gambiae str. PEST] gi|157015509|gb|EAA11854.4| AGAP005526-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|270005018|gb|EFA01466.1| hypothetical protein TcasGA2_TC007013 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189236895|ref|XP_967977.2| PREDICTED: C3PO protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|241599043|ref|XP_002404947.1| cubilin, putative [Ixodes scapularis] gi|215502410|gb|EEC11904.1| cubilin, putative [Ixodes scapularis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query190
MGI|MGI:1931256 3623 Cubn "cubilin (intrinsic facto 0.910 0.047 0.350 5.8e-23
UNIPROTKB|E1BRZ8 3529 CUBN "Uncharacterized protein" 0.921 0.049 0.342 1.1e-21
RGD|68355 3623 Cubn "cubilin (intrinsic facto 0.910 0.047 0.344 1.1e-21
UNIPROTKB|O70244 3623 Cubn "Cubilin" [Rattus norvegi 0.910 0.047 0.344 1.1e-21
UNIPROTKB|F1NZQ3 3633 CUBN "Uncharacterized protein" 0.921 0.048 0.342 1.1e-21
UNIPROTKB|F1NIW7 3634 CUBN "Uncharacterized protein" 0.921 0.048 0.342 1.1e-21
UNIPROTKB|F1MKV7 3620 CUBN "Uncharacterized protein" 0.957 0.050 0.340 1.8e-21
UNIPROTKB|O60494 3623 CUBN "Cubilin" [Homo sapiens ( 0.910 0.047 0.344 4.7e-21
UNIPROTKB|Q9TU53 3620 CUBN "Cubilin" [Canis lupus fa 0.915 0.048 0.338 7.6e-21
UNIPROTKB|F1PK03 3620 CUBN "Cubilin" [Canis lupus fa 0.915 0.048 0.338 7.6e-21
MGI|MGI:1931256 Cubn "cubilin (intrinsic factor-cobalamin receptor)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
 Score = 284 (105.0 bits), Expect = 5.8e-23, P = 5.8e-23
 Identities = 62/177 (35%), Positives = 91/177 (51%)

Query:     2 AVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFC 61
             A+N S+ C  ++    G L+SP +P+ YP N  CV+ +TV   QQI L+FT F LE YF 
Sbjct:  1041 AINASSVCLYDYTDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALEDYF- 1099

Query:    62 NPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKI 121
              P C   D++E+RDGG+E+SP +GIYC    P  I S  ++L+++F SD       GF  
Sbjct:  1100 GPKC--VDFVEIRDGGFETSPLIGIYCGSVFPPRIISHSNKLWLRFKSDT-ALTARGFSA 1156

Query:   122 TWDSAXXXXXXXXXXXXXXXXXXXXXXXXAYRTTCYWKIYVSQGSSITLWSLDVQLD 178
              WD++                         + + CYW++  S+GS   L   D  L+
Sbjct:  1157 YWDASSTGCGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASRGSPFLLEFQDFHLE 1213
GO:0001701 "in utero embryonic development" evidence=ISO
GO:0004872 "receptor activity" evidence=ISO;TAS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0005737 "cytoplasm" evidence=IDA
GO:0005764 "lysosome" evidence=IEA
GO:0005768 "endosome" evidence=IDA
GO:0005783 "endoplasmic reticulum" evidence=IDA
GO:0005794 "Golgi apparatus" evidence=IDA
GO:0005903 "brush border" evidence=IDA
GO:0005905 "coated pit" evidence=IDA
GO:0006629 "lipid metabolic process" evidence=IEA
GO:0006810 "transport" evidence=IEA
GO:0006898 "receptor-mediated endocytosis" evidence=ISO;IMP
GO:0007584 "response to nutrient" evidence=ISO
GO:0008202 "steroid metabolic process" evidence=IEA
GO:0008203 "cholesterol metabolic process" evidence=IEA
GO:0015031 "protein transport" evidence=IEA
GO:0016020 "membrane" evidence=ISO
GO:0016324 "apical plasma membrane" evidence=IDA
GO:0020028 "hemoglobin import" evidence=ISO
GO:0030139 "endocytic vesicle" evidence=IDA
GO:0030492 "hemoglobin binding" evidence=ISO
GO:0030666 "endocytic vesicle membrane" evidence=ISO
GO:0031419 "cobalamin binding" evidence=IEA
GO:0031526 "brush border membrane" evidence=ISO
GO:0042802 "identical protein binding" evidence=ISO
GO:0042803 "protein homodimerization activity" evidence=ISO
GO:0042953 "lipoprotein transport" evidence=IDA
GO:0043202 "lysosomal lumen" evidence=ISO
GO:0043234 "protein complex" evidence=ISO
GO:0045177 "apical part of cell" evidence=IDA
GO:0046872 "metal ion binding" evidence=IEA
GO:0070207 "protein homotrimerization" evidence=ISO
UNIPROTKB|E1BRZ8 CUBN "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|68355 Cubn "cubilin (intrinsic factor-cobalamin receptor)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|O70244 Cubn "Cubilin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NZQ3 CUBN "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1NIW7 CUBN "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MKV7 CUBN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O60494 CUBN "Cubilin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TU53 CUBN "Cubilin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK03 CUBN "Cubilin" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
cd00041113 cd00041, CUB, CUB domain; extracellular domain; pr 4e-38
pfam00431110 pfam00431, CUB, CUB domain 9e-36
smart00042102 smart00042, CUB, Domain first found in C1r, C1s, u 4e-31
cd00041113 cd00041, CUB, CUB domain; extracellular domain; pr 1e-08
pfam00431110 pfam00431, CUB, CUB domain 1e-08
smart00042102 smart00042, CUB, Domain first found in C1r, C1s, u 9e-05
>gnl|CDD|238001 cd00041, CUB, CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast Back     alignment and domain information 
 Score =  126 bits (319), Expect = 4e-38
 Identities = 52/116 (44%), Positives = 66/116 (56%), Gaps = 6/116 (5%)

Query: 9   CGGNFYSP-EGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGD 67
           CGG   +   GT++SP YP+ YP N+ CVWT+  P G +IRL F  F LE    +P C  
Sbjct: 1   CGGTLTASTSGTISSPNYPNNYPNNLNCVWTIEAPPGYRIRLTFEDFDLE---SSPNC-S 56

Query: 68  TDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITW 123
            DYLE+ DG   SSP LG +C    P  I SSG+ L ++F SD       GFK T+
Sbjct: 57  YDYLEIYDGPSTSSPLLGRFCGSTLPPPIISSGNSLTVRFRSDSSV-TGRGFKATY 111

Length = 113
>gnl|CDD|215916 pfam00431, CUB, CUB domain Back     alignment and domain information
>gnl|CDD|214483 smart00042, CUB, Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein Back     alignment and domain information
>gnl|CDD|238001 cd00041, CUB, CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast Back     alignment and domain information
>gnl|CDD|215916 pfam00431, CUB, CUB domain Back     alignment and domain information
>gnl|CDD|214483 smart00042, CUB, Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 190
PF00431110 CUB: CUB domain CUB domain entry Spermadhesins fam 99.94
cd00041113 CUB CUB domain; extracellular domain; present in p 99.94
smart00042102 CUB Domain first found in C1r, C1s, uEGF, and bone 99.91
KOG4586|consensus156 99.87
KOG4292|consensus 454 99.82
PF00431110 CUB: CUB domain CUB domain entry Spermadhesins fam 99.63
KOG4292|consensus454 99.59
cd00041113 CUB CUB domain; extracellular domain; present in p 99.59
smart00042102 CUB Domain first found in C1r, C1s, uEGF, and bone 99.49
KOG4586|consensus156 98.55
PF05428311 CRF-BP: Corticotropin-releasing factor binding pro 98.29
PF02408120 CUB_2: CUB-like domain; InterPro: IPR003366 This d 97.18
PF02408120 CUB_2: CUB-like domain; InterPro: IPR003366 This d 94.17
>PF00431 CUB: CUB domain CUB domain entry Spermadhesins family entry Link to schematic domain picture by Peer Bork Back     alignment and domain information 
Probab=99.94  E-value=2.2e-26  Score=150.31  Aligned_cols=110  Identities=47%  Similarity=0.926  Sum_probs=101.1

Q ss_pred             CCceEecCceEEECCCCCCCCCCCCceEEEEEcCCCCeEEEEEeEeEEeecCCCCCCCCCcEEEEEeCCCCCCCceeeec
Q psy4099           9 CGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFCNPTCGDTDYLEVRDGGYESSPQLGIYC   88 (190)
Q Consensus         9 Cg~~~~~~~G~i~SP~~p~~y~~~~~C~w~I~~~~~~~i~l~f~~f~l~~~~~~~~C~~~d~l~i~~~~~~~~~~~~~~c   88 (190)
                      ||+.++..+|.|+||+||..|+.+.+|.|.|+++++.+|+|+|..|+|+.   ...|. .|+|.|+++.......++++|
T Consensus         1 Cg~~~~~~~g~i~Sp~yp~~y~~~~~C~w~i~~~~~~~I~l~f~~~~~~~---~~~c~-~d~l~v~~g~~~~~~~~~~~c   76 (110)
T PF00431_consen    1 CGGRLTNNSGIISSPNYPSNYPSNSDCTWTITAPPGHRIRLTFLSFDLES---SDSCC-QDYLEVYDGNDESSPLLGRFC   76 (110)
T ss_dssp             SEEEECSSEEEEESTTTTS-SSSSEEEEEEEE-STTEEEEEEEEEEEB-----TTTST-SSEEEEESSSSTTSEEEEEES
T ss_pred             CcCEEECCeEEEECCCCCCCCCCCCcEeEEEEecccceeeecccccccee---eeeec-ccceeEEeeccccceeeeecc
Confidence            99999999999999999999999999999999999999999999999998   77798 999999999998888899999


Q ss_pred             CCCCCCceEeeCCEEEEEEEeCCCCCccCCceEEE
Q psy4099          89 CKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITW  123 (190)
Q Consensus        89 g~~~~~~~~s~~~~~~i~f~s~~~~~~~~gf~~~y  123 (190)
                      |...+..+++.++.|+|+|+++... ...||+|+|
T Consensus        77 g~~~~~~i~s~~~~l~i~f~s~~~~-~~~gF~~~y  110 (110)
T PF00431_consen   77 GSSPPPSIISSSNSLFIRFHSDSSN-SSRGFKATY  110 (110)
T ss_dssp             SSSCCEEEEESSSEEEEEEEESSSS-TTSEEEEEE
T ss_pred             CCcCCccEEECCCEEEEEEEECCCC-CCccEEEEC
Confidence            9878889999999999999999999 999999987

; InterPro: IPR000859 The CUB domain (for complement C1r/C1s, Uegf, Bmp1) is a structural motif of approximately 110 residues found almost exclusively in extracellular and plasma membrane-associated proteins, many of which are developmentally regulated [, ]. These proteins are involved in a diverse range of functions, including complement activation, developmental patterning, tissue repair, axon guidance and angiogenesis, cell signalling, fertilisation, haemostasis, inflammation, neurotransmission, receptor-mediated endocytosis, and tumour suppression [, ]. Many CUB-containing proteins are peptidases belonging to MEROPS peptidase families M12A (astacin) and S1A (chymotrypsin). Proteins containing a CUB domain include: Mammalian complement subcomponents C1s/C1r, which form the calcium-dependent complex C1, the first component of the classical pathway of the complement system. Cricetidae sp. (Hamster) serine protease Casp, which degrades type I and IV collagen and fibronectin in the presence of calcium. Mammalian complement-activating component of Ra-reactive factor (RARF), a protease that cleaves the C4 component of complement. Vertebrate enteropeptidase (3.4.21.9 from EC), a type II membrane protein of the intestinal brush border, which activates trypsinogen. Vertebrate bone morphogenic protein 1 (BMP-1), a protein which induces cartilage and bone formation and expresses metalloendopeptidase activity. Sea urchin blastula proteins BP10 and SpAN. Caenorhabditis elegans hypothetical proteins F42A10.8 and R151.5. Neuropilin (A5 antigen), a calcium-independent cell adhesion molecule that functions during the formation of certain neuronal circuits. Fibropellins I and III from Strongylocentrotus purpuratus (Purple sea urchin). Mammalian hyaluronate-binding protein TSG-6 (or PS4), a serum and growth factor induced protein. Mammalian spermadhesins. Xenopus laevis embryonic protein UVS.2, which is expressed during dorsoanterior development. Several of the above proteins consist of a catalytic domain together with several CUB domains interspersed by calcium-binding EGF domains. Some CUB domains appear to be involved in oligomerisation and/or recognition of substrates and binding partners. For example, in the complement proteases, the CUB domains mediate dimerisation and binding to collagen-like regions of target proteins (e.g. C1q for C1r/C1s). The structure of CUB domains consists of a beta-sandwich with a jelly-roll fold. Almost all CUB domains contain four conserved cysteines that probably form two disulphide bridges (C1-C2, C3-C4). The CUB1 domains of C1s and Map19 have calcium-binding sites [].; PDB: 1SFP_A 3KQ4_B 2WNO_A 2QQK_A 2QQL_A 2QQO_B 2QQM_A 3POJ_A 3POB_A 3POG_B ....
>cd00041 CUB CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast Back     alignment and domain information
>smart00042 CUB Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein Back     alignment and domain information
>KOG4586|consensus Back     alignment and domain information
>KOG4292|consensus Back     alignment and domain information
>PF00431 CUB: CUB domain CUB domain entry Spermadhesins family entry Link to schematic domain picture by Peer Bork Back     alignment and domain information
>KOG4292|consensus Back     alignment and domain information
>cd00041 CUB CUB domain; extracellular domain; present in proteins mostly known to be involved in development; not found in prokaryotes, plants and yeast Back     alignment and domain information
>smart00042 CUB Domain first found in C1r, C1s, uEGF, and bone morphogenetic protein Back     alignment and domain information
>KOG4586|consensus Back     alignment and domain information
>PF05428 CRF-BP: Corticotropin-releasing factor binding protein (CRF-BP); InterPro: IPR008435 This family consists of several eukaryotic corticotropin-releasing factor binding proteins (CRF-BP or CRH-BP) Back     alignment and domain information
>PF02408 CUB_2: CUB-like domain; InterPro: IPR003366 This domain is found in a family of hypothetical Caenorhabditis elegans proteins Back     alignment and domain information
>PF02408 CUB_2: CUB-like domain; InterPro: IPR003366 This domain is found in a family of hypothetical Caenorhabditis elegans proteins Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
3kq4_B 457 Structure Of Intrinsic Factor-Cobalamin Bound To It 2e-16
2qqk_A 579 Neuropilin-2 A1a2b1b2 Domains In Complex With A Sem 2e-14
4gz9_A 577 Mouse Neuropilin-1, Extracellular Domains 1-4 (A1a2 7e-13
2wno_A149 X-Ray Structure Of Cub_c Domain From Tsg-6 Length = 1e-12
2qqm_A 450 Crystal Structure Of The A2b1b2 Domains From Human 5e-12
2qqo_A 460 Crystal Structure Of The A2b1b2 Domains From Human 8e-12
3pob_A115 Crystal Structure Of Masp-1 Cub2 Domain In Complex 8e-08
3dem_A278 Cub1-egf-cub2 Domain Of Human Masp-1/3 Length = 278 6e-07
4aqb_A361 Mbl-Ficolin Associated Protein-1, Map-1 Aka Map44 L 6e-07
1nt0_A286 Crystal Structure Of The Cub1-Egf-Cub2 Region Of Ma 2e-04
>pdb|3KQ4|B Chain B, Structure Of Intrinsic Factor-Cobalamin Bound To Its Receptor Cubilin Length = 457 Back     alignment and structure 
Iteration: 1

 Score = 82.4 bits (202), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 61/177 (34%), Positives = 87/177 (49%), Gaps = 4/177 (2%)
Query: 2   AVNLSTTCGGNFYSPEGTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYFC 61
           A++ +T C  ++    GT TSP +P+ YP N  C++ +TV  GQ I ++FT F LE    
Sbjct: 110 AISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITVRTGQLIAVHFTNFSLEEAIG 169
Query: 62  NPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKI 121
           N     TD+LE+RDGGYE SP LGI+   N P  I S  ++L++KF SD    +  GF  
Sbjct: 170 NYY---TDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLWLKFKSDQIDTR-SGFSA 225
Query: 122 TWDSAXXXXXXXXXXXXXXXXXXXXXXXXAYRTTCYWKIYVSQGSSITLWSLDVQLD 178
            WD +                         + + CYW +  S GS+  L   D  L+
Sbjct: 226 YWDGSSTGCGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHGSAFELEFKDFHLE 282
>pdb|2QQK|A Chain A, Neuropilin-2 A1a2b1b2 Domains In Complex With A Semaphorin-Blocking Fab Length = 579 Back     alignment and structure
>pdb|4GZ9|A Chain A, Mouse Neuropilin-1, Extracellular Domains 1-4 (A1a2b1b2) Length = 577 Back     alignment and structure
>pdb|2WNO|A Chain A, X-Ray Structure Of Cub_c Domain From Tsg-6 Length = 149 Back     alignment and structure
>pdb|2QQM|A Chain A, Crystal Structure Of The A2b1b2 Domains From Human Neuropilin-1 Length = 450 Back     alignment and structure
>pdb|2QQO|A Chain A, Crystal Structure Of The A2b1b2 Domains From Human Neuropilin-2 Length = 460 Back     alignment and structure
>pdb|3POB|A Chain A, Crystal Structure Of Masp-1 Cub2 Domain In Complex With The Collagen- Like Domain Of Mbl Length = 115 Back     alignment and structure
>pdb|3DEM|A Chain A, Cub1-egf-cub2 Domain Of Human Masp-1/3 Length = 278 Back     alignment and structure
>pdb|4AQB|A Chain A, Mbl-Ficolin Associated Protein-1, Map-1 Aka Map44 Length = 361 Back     alignment and structure
>pdb|1NT0|A Chain A, Crystal Structure Of The Cub1-Egf-Cub2 Region Of Masp2 Length = 286 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query190
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 5e-51
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 7e-34
3kq4_B 457 Cubilin; protein-protein complex, cobalt, cobalt t 3e-50
3kq4_B 457 Cubilin; protein-protein complex, cobalt, cobalt t 2e-45
3kq4_B457 Cubilin; protein-protein complex, cobalt, cobalt t 8e-45
3kq4_B457 Cubilin; protein-protein complex, cobalt, cobalt t 3e-27
2wno_A149 Tumor necrosis factor-inducible gene 6 protein; gl 4e-44
2wno_A149 Tumor necrosis factor-inducible gene 6 protein; gl 1e-11
3dem_A278 Complement factor MAsp-3; complement system, innat 4e-39
3dem_A278 Complement factor MAsp-3; complement system, innat 1e-31
2qqm_A 450 Neuropilin-1; VEGF receptor, semaphorin receptor, 2e-38
1nt0_A286 MAsp2, mannose-binding protein associated serine p 1e-37
1nt0_A286 MAsp2, mannose-binding protein associated serine p 5e-30
1nt0_A 286 MAsp2, mannose-binding protein associated serine p 2e-05
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 5e-37
4aqb_A 361 Mannan-binding lectin serine protease 1; blood clo 4e-36
4aqb_A 361 Mannan-binding lectin serine protease 1; blood clo 5e-07
1szb_A170 Mannose binding lectin-associated serine protease- 6e-37
1szb_A 170 Mannose binding lectin-associated serine protease- 5e-09
2qqo_A 460 Neuropilin-2; VEGF receptor, semaphorin receptor, 8e-37
2qqo_A 460 Neuropilin-2; VEGF receptor, semaphorin receptor, 3e-12
3poj_A115 Mannan-binding lectin serine protease 1; CUB domai 4e-35
3poj_A115 Mannan-binding lectin serine protease 1; CUB domai 7e-10
1nzi_A159 Complement C1S component; calcium, innate immunity 8e-35
1nzi_A 159 Complement C1S component; calcium, innate immunity 7e-06
1sfp_A114 ASFP; spermadhesin, bovine seminal plasma protein, 3e-32
1sfp_A114 ASFP; spermadhesin, bovine seminal plasma protein, 2e-11
1spp_A109 Major seminal plasma glycoprotein PSP-I; seminal p 1e-29
1spp_A109 Major seminal plasma glycoprotein PSP-I; seminal p 1e-10
1spp_B116 Major seminal plasma glycoprotein PSP-II; seminal 4e-29
1spp_B116 Major seminal plasma glycoprotein PSP-II; seminal 7e-12
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 Back     alignment and structure
 Score =  171 bits (435), Expect = 5e-51
 Identities = 63/175 (36%), Positives = 82/175 (46%), Gaps = 10/175 (5%)

Query: 8   TCGGNFYSPE-GTLTSPQYPDPYPPNMLCVWTLTVP-RGQQIRLNFTTFQLERYFCNPTC 65
            CGG   S + G +TSP YP  YP +  C W +  P   Q+I LNF             C
Sbjct: 5   PCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVYAPEPNQKIVLNFNPHFEIE---KHDC 61

Query: 66  GDTDYLEVRDGGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDS 125
              D++E+RDG  ES+  LG +C    P  I SSG  LYIKF SD  R +  GF + ++ 
Sbjct: 62  KY-DFIEIRDGDSESADLLGKHCGNIAPPTIISSGSMLYIKFTSDYAR-QGAGFSLRYEI 119

Query: 126 ASTG---CGGILTGSSGSIISPGYPYPYAYRTTCYWKIYVSQGSSITLWSLDVQL 177
             TG   C    T  +G+I SPG+P  Y +   C + I       I L  L   L
Sbjct: 120 FKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTILAKPKMEIILQFLIFDL 174
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Length = 579 Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Length = 457 Back     alignment and structure
>2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} Length = 149 Back     alignment and structure
>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Length = 278 Back     alignment and structure
>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Length = 278 Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Length = 450 Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Length = 286 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Length = 361 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 170 Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Length = 460 Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Length = 460 Back     alignment and structure
>3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A Length = 115 Back     alignment and structure
>3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A Length = 115 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Length = 159 Back     alignment and structure
>1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 Length = 114 Back     alignment and structure
>1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 Length = 114 Back     alignment and structure
>1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 109 Back     alignment and structure
>1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 109 Back     alignment and structure
>1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 116 Back     alignment and structure
>1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Length = 116 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
4gz9_A 577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 100.0
3kq4_B457 Cubilin; protein-protein complex, cobalt, cobalt t 100.0
3kq4_B 457 Cubilin; protein-protein complex, cobalt, cobalt t 100.0
1nt0_A286 MAsp2, mannose-binding protein associated serine p 100.0
3dem_A278 Complement factor MAsp-3; complement system, innat 100.0
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 100.0
4aqb_A 361 Mannan-binding lectin serine protease 1; blood clo 100.0
2wno_A149 Tumor necrosis factor-inducible gene 6 protein; gl 99.98
3poj_A115 Mannan-binding lectin serine protease 1; CUB domai 99.96
2qqm_A 450 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.95
2qqo_A 460 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.94
1spp_B116 Major seminal plasma glycoprotein PSP-II; seminal 99.94
1spp_A109 Major seminal plasma glycoprotein PSP-I; seminal p 99.94
1sfp_A114 ASFP; spermadhesin, bovine seminal plasma protein, 99.94
1szb_A170 Mannose binding lectin-associated serine protease- 99.94
1nzi_A159 Complement C1S component; calcium, innate immunity 99.93
4gz9_A 577 Neuropilin-1, A5 protein; multi-domain, cell-CELL 99.93
1nt0_A286 MAsp2, mannose-binding protein associated serine p 99.92
4aqb_A361 Mannan-binding lectin serine protease 1; blood clo 99.92
2qqk_A 579 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.92
3dem_A278 Complement factor MAsp-3; complement system, innat 99.92
2wno_A149 Tumor necrosis factor-inducible gene 6 protein; gl 99.76
3poj_A115 Mannan-binding lectin serine protease 1; CUB domai 99.71
1szb_A 170 Mannose binding lectin-associated serine protease- 99.68
1nzi_A 159 Complement C1S component; calcium, innate immunity 99.66
2qqm_A 450 Neuropilin-1; VEGF receptor, semaphorin receptor, 99.57
2qqo_A 460 Neuropilin-2; VEGF receptor, semaphorin receptor, 99.56
1spp_A109 Major seminal plasma glycoprotein PSP-I; seminal p 99.52
1spp_B116 Major seminal plasma glycoprotein PSP-II; seminal 99.49
1sfp_A114 ASFP; spermadhesin, bovine seminal plasma protein, 99.49
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
Probab=100.00  E-value=3.2e-43  Score=286.81  Aligned_cols=176  Identities=35%  Similarity=0.630  Sum_probs=162.2

Q ss_pred             CCCCceEecC-ceEEECCCCCCCCCCCCceEEEEEcCCC-CeEEEEEe-EeEEeecCCCCCCCCCcEEEEEeCCCCCCCc
Q psy4099           7 TTCGGNFYSP-EGTLTSPQYPDPYPPNMLCVWTLTVPRG-QQIRLNFT-TFQLERYFCNPTCGDTDYLEVRDGGYESSPQ   83 (190)
Q Consensus         7 ~~Cg~~~~~~-~G~i~SP~~p~~y~~~~~C~w~I~~~~~-~~i~l~f~-~f~l~~~~~~~~C~~~d~l~i~~~~~~~~~~   83 (190)
                      ..||+.++.. .|.|+||+||..|+++.+|.|.|++|.+ .+|+|+|. .|+|+.    .+|. +|+|+|+||.....++
T Consensus         7 ~~CGg~l~~~~~G~i~SPnyP~~Yp~n~~C~W~I~~p~~~~~I~L~F~~~f~le~----~~C~-~Dyl~I~dG~~~~~~~   81 (577)
T 4gz9_A            7 DKCGGTIKIENPGYLTSPGYPHSYHPSEKCEWLIQAPEPYQRIMINFNPHFDLED----RDCK-YDYVEVIDGENEGGRL   81 (577)
T ss_dssp             CCSSEEEECSSCEEEECTTTTTCCCSSCEEEEEEECSSTTCCEEEEECSCCBCCC----GGGT-SSEEEEEESSSTTSEE
T ss_pred             CCCCCEEEcCCCEEEeCCCCCCCCCCCCeEEEEEEECCCCcEEEEEEEeeeeecC----CCCC-ccEEEEEeCCCCCCcE
Confidence            5799999864 6999999999999999999999999855 78999996 799985    4699 9999999999988899


Q ss_pred             eeeecCCCCCCceEeeCCEEEEEEEeCCCCCccCCceEEEeccc--CCCCCeeecCeeeEECCCCCCCCCCCcceEEEEE
Q psy4099          84 LGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITWDSAS--TGCGGILTGSSGSIISPGYPYPYAYRTTCYWKIY  161 (190)
Q Consensus        84 ~~~~cg~~~~~~~~s~~~~~~i~f~s~~~~~~~~gf~~~y~~~~--~~C~~~~~~~~g~i~Sp~yp~~y~~~~~C~w~i~  161 (190)
                      ++++||...|..++|+++.|+|+|+++... ..+||.|.|+++.  ..|++.+++..|.|.||+||..||++.+|.|.|+
T Consensus        82 lg~~CG~~~p~~i~S~~n~l~v~F~SD~s~-~~~GF~a~y~~~~~~~~C~~~~~~~~G~i~SPnyP~~Yp~n~~C~W~I~  160 (577)
T 4gz9_A           82 WGKFCGKIAPSPVVSSGPFLFIKFVSDYET-HGAGFSIRYEIFKRGPECSQNYTAPTGVIKSPGFPEKYPNSLECTYIIF  160 (577)
T ss_dssp             EEEECSSSCCCCEECSSSEEEEEEECCSSC-CCCBCEEEEEECCCCCEEEEEECSSEEEEECTTTTSCCCSSCEEEEEEE
T ss_pred             EEEecCCCCCCCEEEeCCeEEEEEEECCCC-CCCCeEEEEEEeecCcccceeecCCCccccCCCCCCCCCCCceEEEEEE
Confidence            999999999999999999999999999999 9999999999874  3589999999999999999999999999999999


Q ss_pred             eCCCCEEEEEEeEEeeCCCC------CCCcccc
Q psy4099         162 VSQGSSITLWSLDVQLDCNK------LLASDLE  188 (190)
Q Consensus       162 ~~~~~~i~l~f~~f~l~~~~------~C~~d~~  188 (190)
                      +|+|++|.|.|.+|+||.+.      .|.+||.
T Consensus       161 ~p~g~~I~L~F~~F~lE~~~~~~~~~~C~~D~l  193 (577)
T 4gz9_A          161 APKMSEIILEFESFDLEQDSNPPGGMFCRYDRL  193 (577)
T ss_dssp             CGGGCCEEEEEEEEECCCCCSCSTTCCCCSSEE
T ss_pred             ECCCCEEEEEEEEEEeeecCCCCCCCccCccEE
Confidence            99999999999999999864      4999964
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Back     alignment and structure
>3kq4_B Cubilin; protein-protein complex, cobalt, cobalt transport, disease M disulfide bond, glycoprotein, secreted, transport, choleste metabolism; HET: NAG BMA MAN B12; 3.30A {Homo sapiens} Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Back     alignment and structure
>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Back     alignment and structure
>2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} Back     alignment and structure
>3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Back     alignment and structure
>1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Back     alignment and structure
>1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>4gz9_A Neuropilin-1, A5 protein; multi-domain, cell-CELL signaling, plexin, semaphorin, VEGF, glycosilated, transmembrane, signaling protein; HET: NAG BMA; 2.70A {Mus musculus} PDB: 4gza_H Back     alignment and structure
>1nt0_A MAsp2, mannose-binding protein associated serine proteas; CUB domain, EGF like domain., hydrolase, sugar binding protein; HET: NAG EDO; 2.70A {Rattus norvegicus} SCOP: b.23.1.1 b.23.1.1 g.3.11.1 Back     alignment and structure
>4aqb_A Mannan-binding lectin serine protease 1; blood clotting, mannan-binding protein, complement, ficolins complement pathway, mannose- binding lectin; HET: NAG BMA MAN; 4.20A {Homo sapiens} Back     alignment and structure
>2qqk_A Neuropilin-2; VEGF receptor, semaphorin receptor, phage-derived antibody, developmental protein, differentiation, glycoprotein; HET: NAG; 2.75A {Homo sapiens} PDB: 2qql_A Back     alignment and structure
>3dem_A Complement factor MAsp-3; complement system, innate immunity, calcium binding sites, C pathway, EGF-like domain, glycoprotein, hydrolase; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2wno_A Tumor necrosis factor-inducible gene 6 protein; glycoprotein, cell adhesion, extracellular matrix; 2.30A {Homo sapiens} Back     alignment and structure
>3poj_A Mannan-binding lectin serine protease 1; CUB domain, Ca2+ binding site, complex with ethylamine, COMP protein, lectin pathway of complement; 1.45A {Rattus norvegicus} PDB: 3pob_A 3pof_A 3pog_A 3poi_A 3poe_A Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>1nzi_A Complement C1S component; calcium, innate immunity, modular structure, CUB, EGF, hydrolase; 1.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2qqm_A Neuropilin-1; VEGF receptor, semaphorin receptor, calcium-binding domain, angiogenesis, developmental protein, differentiation; HET: NAG FUC; 2.00A {Homo sapiens} SCOP: b.18.1.2 b.18.1.2 b.23.1.1 Back     alignment and structure
>2qqo_A Neuropilin-2; VEGF receptor, semaphorin receptor, calcium-binding domain, developmental protein, differentiation, glycoprotein, membr neurogenesis; 2.30A {Homo sapiens} Back     alignment and structure
>1spp_A Major seminal plasma glycoprotein PSP-I; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Back     alignment and structure
>1spp_B Major seminal plasma glycoprotein PSP-II; seminal plasma proteins, spermadhesins, CUB domain architecture, complex (seminal plasma protein/SPP); 2.40A {Sus scrofa} SCOP: b.23.1.1 Back     alignment and structure
>1sfp_A ASFP; spermadhesin, bovine seminal plasma protein, acidic seminal fluid protein, CUB domain, X-RAY growth factor; 1.90A {Bos taurus} SCOP: b.23.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 190
d2qqma3108 b.23.1.1 (A:156-263) Mannose-binding protein assoc 1e-22
d2qqma3108 b.23.1.1 (A:156-263) Mannose-binding protein assoc 6e-04
d1nzia1117 b.23.1.1 (A:1-117) Complement C1S component {Human 4e-19
d1nzia1117 b.23.1.1 (A:1-117) Complement C1S component {Human 0.002
d1szba1121 b.23.1.1 (A:3-123) Mannose-binding protein associa 1e-18
d1szba1121 b.23.1.1 (A:3-123) Mannose-binding protein associa 6e-05
d1nt0a2114 b.23.1.1 (A:165-278) Mannose-binding protein assoc 4e-18
d1nt0a2114 b.23.1.1 (A:165-278) Mannose-binding protein assoc 4e-06
d1sfpa_111 b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) 5e-12
d1sfpa_111 b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) 9e-05
d1sppb_112 b.23.1.1 (B:) Major seminal plasma glycoprotein PS 2e-11
d1sppb_112 b.23.1.1 (B:) Major seminal plasma glycoprotein PS 2e-05
d1sppa_109 b.23.1.1 (A:) Major seminal plasma glycoprotein PS 1e-09
d1sppa_109 b.23.1.1 (A:) Major seminal plasma glycoprotein PS 7e-05
>d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure

class: All beta proteins
fold: CUB-like
superfamily: Spermadhesin, CUB domain
family: Spermadhesin, CUB domain
domain: Mannose-binding protein associated serine protease 2, MASP2
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 85.8 bits (211), Expect = 1e-22
 Identities = 33/108 (30%), Positives = 51/108 (47%), Gaps = 3/108 (2%)

Query: 18  GTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLER--YFCNPTCGDTDYLEVRD 75
           G + SP +P+ YP ++ C + +  P+  +I L F +F LE             D LE+ D
Sbjct: 1   GVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCRYDRLEIWD 60

Query: 76  GGYESSPQLGIYCCKNHPGEITSSGHQLYIKFFSDDDRFKYPGFKITW 123
           G  +  P +G YC +  PG I SS   L + F++ D      GF   +
Sbjct: 61  GFPDVGPHIGRYCGQKTPGRIRSSSGILSMVFYT-DSAIAKEGFSANY 107
>d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 114 Back     information, alignment and structure
>d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 114 Back     information, alignment and structure
>d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} Length = 111 Back     information, alignment and structure
>d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} Length = 111 Back     information, alignment and structure
>d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} Length = 112 Back     information, alignment and structure
>d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} Length = 112 Back     information, alignment and structure
>d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]} Length = 109 Back     information, alignment and structure
>d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]} Length = 109 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query190
d2qqma3108 Mannose-binding protein associated serine protease 99.96
d1nt0a2114 Mannose-binding protein associated serine protease 99.95
d1nzia1117 Complement C1S component {Human (Homo sapiens) [Ta 99.94
d1szba1121 Mannose-binding protein associated serine protease 99.94
d1sppb_112 Major seminal plasma glycoprotein PSP-II {Pig (Sus 99.93
d1sppa_109 Major seminal plasma glycoprotein PSP-I {Pig (Sus 99.92
d1sfpa_111 Acidic seminal fluid protein (ASFP) {Cow (Bos taur 99.9
d1szba1121 Mannose-binding protein associated serine protease 99.71
d1nzia1117 Complement C1S component {Human (Homo sapiens) [Ta 99.68
d1nt0a2114 Mannose-binding protein associated serine protease 99.65
d2qqma3108 Mannose-binding protein associated serine protease 99.63
d1sppb_112 Major seminal plasma glycoprotein PSP-II {Pig (Sus 99.48
d1sppa_109 Major seminal plasma glycoprotein PSP-I {Pig (Sus 99.47
d1sfpa_111 Acidic seminal fluid protein (ASFP) {Cow (Bos taur 99.35
>d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: CUB-like
superfamily: Spermadhesin, CUB domain
family: Spermadhesin, CUB domain
domain: Mannose-binding protein associated serine protease 2, MASP2
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.96  E-value=3e-28  Score=156.33  Aligned_cols=105  Identities=32%  Similarity=0.649  Sum_probs=95.9

Q ss_pred             eEEECCCCCCCCCCCCceEEEEEcCCCCeEEEEEeEeEEeecC---CCCCCCCCcEEEEEeCCCCCCCceeeecCCCCCC
Q psy4099          18 GTLTSPQYPDPYPPNMLCVWTLTVPRGQQIRLNFTTFQLERYF---CNPTCGDTDYLEVRDGGYESSPQLGIYCCKNHPG   94 (190)
Q Consensus        18 G~i~SP~~p~~y~~~~~C~w~I~~~~~~~i~l~f~~f~l~~~~---~~~~C~~~d~l~i~~~~~~~~~~~~~~cg~~~~~   94 (190)
                      |.|+||+||..|+++.+|.|.|+++++++|+|+|..|+|+...   ....|. .|+|+|+++.....+.++++||...|.
T Consensus         1 G~i~SP~yP~~Y~~~~~C~w~I~~p~~~~I~l~f~~f~l~~~~~~~~~~~C~-~D~l~i~dg~~~~~~~~~~~Cg~~~p~   79 (108)
T d2qqma3           1 GVIKSPGFPEKYPNSLECTYIVFAPKMSEIILEFESFDLEPDSNPPGGMFCR-YDRLEIWDGFPDVGPHIGRYCGQKTPG   79 (108)
T ss_dssp             EEEECTTTTSCCCSSCEEEEEEECGGGCCEEEEEEEEECCCC----CCCSSC-SSEEEEESSSTTTSCEEEEECTTCCCC
T ss_pred             CEEeCCCCCCCCCCCCeEEEEEEeCCCceeeeEEEEEEeecccccccCCCcc-ccEEEEEeccccCCccccEEeeccCCC
Confidence            8999999999999999999999999999999999999997621   123588 899999999888888899999999899


Q ss_pred             ceEeeCCEEEEEEEeCCCCCccCCceEEEe
Q psy4099          95 EITSSGHQLYIKFFSDDDRFKYPGFKITWD  124 (190)
Q Consensus        95 ~~~s~~~~~~i~f~s~~~~~~~~gf~~~y~  124 (190)
                      .++|.++.|+|+|+++... .++||+|.|+
T Consensus        80 ~~~S~~n~l~i~F~Sd~~~-~~~GF~~~yt  108 (108)
T d2qqma3          80 RIRSSSGILSMVFYTDSAI-AKEGFSANYS  108 (108)
T ss_dssp             EEEECSSEEEEEEECCSSC-CCCEEEEEEE
T ss_pred             CEEEcCCEEEEEEEECCCC-CCCCEEEEEC
Confidence            9999999999999999988 8999999985
>d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1szba1 b.23.1.1 (A:3-123) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia1 b.23.1.1 (A:1-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a2 b.23.1.1 (A:165-278) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2qqma3 b.23.1.1 (A:156-263) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sppb_ b.23.1.1 (B:) Major seminal plasma glycoprotein PSP-II {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sppa_ b.23.1.1 (A:) Major seminal plasma glycoprotein PSP-I {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1sfpa_ b.23.1.1 (A:) Acidic seminal fluid protein (ASFP) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure