Diaphorina citri psyllid: psy4109


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MKKNAFYTNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWSLH
ccccHHHHHHHHcccccccEEEEccccccccccccccccEEcccccEEECcccccccHHHHHHHHHHHHHHHHHHcc
MKKNAFYTNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWSLH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKNAFYTNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWSLH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable methyltransferase WBSCR22 homolog Probable DNA methyltransferase.confidentQ55DA6
Uncharacterized methyltransferase WBSCR22 Methyltransferase that may act on DNA.confidentO43709
Uncharacterized methyltransferase WBSCR22 Methyltransferase that may act on DNA.confidentQ58DP0

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006364 [BP]rRNA processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008168 [MF]methyltransferase activityprobableGO:0003824, GO:0016740, GO:0016741, GO:0003674

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VL5, chain A
Confidence level:confident
Coverage over the Query: 1-51,63-74
View the alignment between query and template
View the model in PyMOL