Psyllid ID: psy4109


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70-------
MKKNAFYTNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWSLH
ccccHHHHHHHHcccccccEEEEccccccccccccccccEEcccccEEEEcccccccHHHHHHHHHHHHHHHHHHcc
cccHHHHHHHHHHccccccEEEHccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcc
MKKNAFYTNVArdrevegdlvlsdlgqgvpfragafdGAISISALQWLcnadktshnpaKRLYKFFSSLFACLWSLH
mkknafytnvardreveGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWSLH
MKKNAFYTNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWSLH
*****FYTNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWS**
MKKNAFYTNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNA*****NPAKRLYKFFSSLFACLWSLH
MKKNAFYTNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWSLH
*******TNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWSL*
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKNAFYTNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWSLH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query77 2.2.26 [Sep-21-2011]
O43709 281 Uncharacterized methyltra yes N/A 0.818 0.224 0.714 6e-23
Q55DA6 287 Probable methyltransferas yes N/A 0.844 0.226 0.707 1e-22
Q9CY21 281 Uncharacterized methyltra yes N/A 0.844 0.231 0.676 3e-21
Q58DP0 281 Uncharacterized methyltra yes N/A 0.818 0.224 0.650 4e-20
P25627 275 Putative methyltransferas yes N/A 0.779 0.218 0.633 8e-19
Q10162 268 Putative methyltransferas yes N/A 0.740 0.212 0.631 6e-17
>sp|O43709|WBS22_HUMAN Uncharacterized methyltransferase WBSCR22 OS=Homo sapiens GN=WBSCR22 PE=1 SV=2 Back     alignment and function desciption
 Score =  105 bits (263), Expect = 6e-23,   Method: Composition-based stats.
 Identities = 45/63 (71%), Positives = 54/63 (85%)

Query: 11  ARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLF 70
           A DRE+EGDL+L D+GQG+PF+ G FDG ISISA+QWLCNA+K S NPAKRLY FF+SLF
Sbjct: 91  AVDREIEGDLLLGDMGQGIPFKPGTFDGCISISAVQWLCNANKKSENPAKRLYCFFASLF 150

Query: 71  ACL 73
           + L
Sbjct: 151 SVL 153




Methyltransferase that may act on DNA.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q55DA6|WBS22_DICDI Probable methyltransferase WBSCR22 homolog OS=Dictyostelium discoideum GN=DDB_G0269722 PE=3 SV=1 Back     alignment and function description
>sp|Q9CY21|WBS22_MOUSE Uncharacterized methyltransferase WBSCR22 OS=Mus musculus GN=Wbscr22 PE=2 SV=1 Back     alignment and function description
>sp|Q58DP0|WBS22_BOVIN Uncharacterized methyltransferase WBSCR22 OS=Bos taurus GN=WBSCR22 PE=2 SV=1 Back     alignment and function description
>sp|P25627|BUD23_YEAST Putative methyltransferase BUD23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BUD23 PE=1 SV=1 Back     alignment and function description
>sp|Q10162|YAU6_SCHPO Putative methyltransferase C26A3.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC26A3.06 PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
242024724 277 conserved hypothetical protein [Pediculu 0.844 0.234 0.738 2e-25
340711706 275 PREDICTED: uncharacterized methyltransfe 0.831 0.232 0.781 2e-25
189238660 274 PREDICTED: similar to CG10903 CG10903-PA 0.844 0.237 0.8 3e-25
380023875 275 PREDICTED: uncharacterized methyltransfe 0.831 0.232 0.75 6e-25
350405932 275 PREDICTED: uncharacterized methyltransfe 0.831 0.232 0.765 6e-25
332372630 272 unknown [Dendroctonus ponderosae] 0.844 0.238 0.8 7e-25
383865385 275 PREDICTED: uncharacterized methyltransfe 0.831 0.232 0.734 1e-24
260834245 278 hypothetical protein BRAFLDRAFT_282951 [ 0.948 0.262 0.698 2e-24
307194189 276 Uncharacterized methyltransferase WBSCR2 0.844 0.235 0.753 2e-24
66564535 275 PREDICTED: uncharacterized methyltransfe 0.844 0.236 0.738 3e-24
>gi|242024724|ref|XP_002432776.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212518285|gb|EEB20038.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  119 bits (299), Expect = 2e-25,   Method: Composition-based stats.
 Identities = 48/65 (73%), Positives = 61/65 (93%)

Query: 9   NVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSS 68
           N+A++RE+EGD++LSDLG+G+PFRAG+FDGAISISALQWLCNADK +H P KRLYKFFS+
Sbjct: 86  NIAKEREIEGDVILSDLGEGIPFRAGSFDGAISISALQWLCNADKATHKPTKRLYKFFST 145

Query: 69  LFACL 73
           LF+ +
Sbjct: 146 LFSAM 150




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|340711706|ref|XP_003394412.1| PREDICTED: uncharacterized methyltransferase WBSCR22-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|189238660|ref|XP_972432.2| PREDICTED: similar to CG10903 CG10903-PA [Tribolium castaneum] gi|270008360|gb|EFA04808.1| hypothetical protein TcasGA2_TC014857 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|380023875|ref|XP_003695735.1| PREDICTED: uncharacterized methyltransferase WBSCR22-like [Apis florea] Back     alignment and taxonomy information
>gi|350405932|ref|XP_003487597.1| PREDICTED: uncharacterized methyltransferase WBSCR22-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|332372630|gb|AEE61457.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|383865385|ref|XP_003708154.1| PREDICTED: uncharacterized methyltransferase WBSCR22-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|260834245|ref|XP_002612122.1| hypothetical protein BRAFLDRAFT_282951 [Branchiostoma floridae] gi|229297495|gb|EEN68131.1| hypothetical protein BRAFLDRAFT_282951 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|307194189|gb|EFN76606.1| Uncharacterized methyltransferase WBSCR22 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|66564535|ref|XP_623810.1| PREDICTED: uncharacterized methyltransferase WBSCR22-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query77
FB|FBgn0037543 276 CG10903 [Drosophila melanogast 0.844 0.235 0.676 1.1e-21
UNIPROTKB|Q5ZI10 282 WBSCR22 "Uncharacterized prote 0.844 0.230 0.692 1.1e-21
ZFIN|ZDB-GENE-070410-68 282 wbscr22 "Williams Beuren syndr 0.844 0.230 0.692 1.5e-21
DICTYBASE|DDB_G0269722 287 DDB_G0269722 "methyltransferas 0.844 0.226 0.707 4.9e-21
UNIPROTKB|C9K060 298 WBSCR22 "Uncharacterized methy 0.818 0.211 0.714 4.9e-21
UNIPROTKB|O43709 281 WBSCR22 "Uncharacterized methy 0.818 0.224 0.714 4.9e-21
MGI|MGI:1913388 281 Wbscr22 "Williams Beuren syndr 0.844 0.231 0.676 7.2e-20
RGD|1589742 281 Wbscr22 "Williams Beuren syndr 0.844 0.231 0.676 7.2e-20
RGD|1597085 281 LOC360830 [Rattus norvegicus ( 0.844 0.231 0.676 7.2e-20
UNIPROTKB|E2RFK1 349 WBSCR22 "Uncharacterized prote 0.844 0.186 0.661 9.2e-20
FB|FBgn0037543 CG10903 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 253 (94.1 bits), Expect = 1.1e-21, P = 1.1e-21
 Identities = 44/65 (67%), Positives = 57/65 (87%)

Query:     9 NVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSS 68
             ++A +REV GD++L D+G+G+PF+ G FDGAISISALQWLCNADK+ HNP KRL KFF++
Sbjct:    87 DIAVEREVAGDVILGDMGEGMPFKPGTFDGAISISALQWLCNADKSYHNPHKRLLKFFTT 146

Query:    69 LFACL 73
             LF+CL
Sbjct:   147 LFSCL 151




GO:0008757 "S-adenosylmethionine-dependent methyltransferase activity" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|Q5ZI10 WBSCR22 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-070410-68 wbscr22 "Williams Beuren syndrome chromosome region 22" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0269722 DDB_G0269722 "methyltransferase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|C9K060 WBSCR22 "Uncharacterized methyltransferase WBSCR22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O43709 WBSCR22 "Uncharacterized methyltransferase WBSCR22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1913388 Wbscr22 "Williams Beuren syndrome chromosome region 22" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1589742 Wbscr22 "Williams Beuren syndrome chromosome region 22" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1597085 LOC360830 [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RFK1 WBSCR22 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q55DA6WBS22_DICDI2, ., 1, ., 1, ., -0.70760.84410.2264yesN/A
Q58DP0WBS22_BOVIN2, ., 1, ., 1, ., -0.65070.81810.2241yesN/A
P25627BUD23_YEAST2, ., 1, ., 1, ., -0.63330.77920.2181yesN/A
O43709WBS22_HUMAN2, ., 1, ., 1, ., -0.71420.81810.2241yesN/A
Q10162YAU6_SCHPONo assigned EC number0.63150.74020.2126yesN/A
Q9CY21WBS22_MOUSE2, ., 1, ., 1, ., -0.67690.84410.2313yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 77
KOG1541|consensus 270 99.9
PLN02232160 ubiquinone biosynthesis methyltransferase 99.36
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.33
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 99.28
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.18
PLN02233261 ubiquinone biosynthesis methyltransferase 99.13
PRK05785226 hypothetical protein; Provisional 99.12
PRK10258 251 biotin biosynthesis protein BioC; Provisional 99.09
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 99.01
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.96
PRK14103 255 trans-aconitate 2-methyltransferase; Provisional 98.85
PRK06202232 hypothetical protein; Provisional 98.74
PRK01683 258 trans-aconitate 2-methyltransferase; Provisional 98.74
KOG1540|consensus296 98.69
PLN02244 340 tocopherol O-methyltransferase 98.67
COG4106 257 Tam Trans-aconitate methyltransferase [General fun 98.66
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 98.62
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.6
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 98.58
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.58
TIGR02072 240 BioC biotin biosynthesis protein BioC. This enzyme 98.57
PLN02336 475 phosphoethanolamine N-methyltransferase 98.57
PLN02490 340 MPBQ/MSBQ methyltransferase 98.56
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 98.55
PRK11036 255 putative S-adenosyl-L-methionine-dependent methylt 98.54
PTZ00098 263 phosphoethanolamine N-methyltransferase; Provision 98.51
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 98.5
PRK06922 677 hypothetical protein; Provisional 98.5
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.49
PRK11207197 tellurite resistance protein TehB; Provisional 98.45
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.43
PRK08317 241 hypothetical protein; Provisional 98.41
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.39
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.39
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 98.37
KOG3010|consensus 261 98.25
PRK15068 322 tRNA mo(5)U34 methyltransferase; Provisional 98.25
PLN02336 475 phosphoethanolamine N-methyltransferase 98.2
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.19
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 98.17
PRK12335287 tellurite resistance protein TehB; Provisional 98.07
TIGR00452314 methyltransferase, putative. Known examples to dat 98.07
smart00828 224 PKS_MT Methyltransferase in polyketide synthase (P 98.07
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.07
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.02
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 97.99
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 97.92
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 97.89
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 97.84
KOG2940|consensus 325 97.83
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 97.82
TIGR03438 301 probable methyltransferase. This model represents 97.77
PRK11705 383 cyclopropane fatty acyl phospholipid synthase; Pro 97.76
PLN02585315 magnesium protoporphyrin IX methyltransferase 97.69
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.69
KOG1331|consensus 293 97.49
COG4976287 Predicted methyltransferase (contains TPR repeat) 97.48
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 97.45
PLN03075296 nicotianamine synthase; Provisional 97.44
KOG4300|consensus252 97.44
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 97.43
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 97.38
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 97.37
PRK14967223 putative methyltransferase; Provisional 97.37
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 97.35
COG2230 283 Cfa Cyclopropane fatty acid synthase and related m 97.35
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 97.33
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 97.27
PF02353 273 CMAS: Mycolic acid cyclopropane synthetase; InterP 97.27
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 97.25
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 97.22
PHA03411 279 putative methyltransferase; Provisional 97.21
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 97.19
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 97.18
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 97.16
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 97.12
PRK14968188 putative methyltransferase; Provisional 97.11
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 97.03
PRK00811283 spermidine synthase; Provisional 97.02
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 96.99
PRK14121 390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 96.97
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 96.96
KOG1270|consensus282 96.94
PHA03412241 putative methyltransferase; Provisional 96.9
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 96.9
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 96.89
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 96.88
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 96.88
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 96.87
PRK01581 374 speE spermidine synthase; Validated 96.83
smart00650169 rADc Ribosomal RNA adenine dimethylases. 96.75
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 96.7
PF03291 331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 96.66
TIGR00536284 hemK_fam HemK family putative methylases. The gene 96.53
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 96.52
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 96.48
PRK03612 521 spermidine synthase; Provisional 96.44
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 96.43
PRK13255218 thiopurine S-methyltransferase; Reviewed 96.42
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 96.36
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 96.29
PRK04457262 spermidine synthase; Provisional 96.17
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 96.11
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 96.1
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 96.07
COG1041347 Predicted DNA modification methylase [DNA replicat 96.02
PRK14904445 16S rRNA methyltransferase B; Provisional 96.0
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 95.91
TIGR00438188 rrmJ cell division protein FtsJ. 95.91
PRK10611287 chemotaxis methyltransferase CheR; Provisional 95.9
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 95.7
KOG2361|consensus264 95.64
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 95.52
PLN02366 308 spermidine synthase 95.4
PRK13256226 thiopurine S-methyltransferase; Reviewed 95.36
PRK10901427 16S rRNA methyltransferase B; Provisional 95.33
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 95.2
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 95.13
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 94.98
PRK04266226 fibrillarin; Provisional 94.73
PRK14901434 16S rRNA methyltransferase B; Provisional 94.72
KOG1975|consensus 389 94.71
PRK14903431 16S rRNA methyltransferase B; Provisional 94.58
PRK04148134 hypothetical protein; Provisional 94.56
PRK13943 322 protein-L-isoaspartate O-methyltransferase; Provis 94.39
PLN02672 1082 methionine S-methyltransferase 94.19
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 94.03
PRK00274 272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 94.0
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 93.86
PRK14896 258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 93.82
PLN02823 336 spermine synthase 93.81
PRK14902444 16S rRNA methyltransferase B; Provisional 93.72
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 93.22
PRK07402196 precorrin-6B methylase; Provisional 93.22
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 93.12
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 93.09
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 92.91
KOG2352|consensus 482 92.84
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 92.75
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 92.7
COG2890280 HemK Methylase of polypeptide chain release factor 92.41
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 92.37
PF11968219 DUF3321: Putative methyltransferase (DUF3321); Int 92.25
COG4123248 Predicted O-methyltransferase [General function pr 92.22
PTZ00146293 fibrillarin; Provisional 92.09
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 92.01
PF06859110 Bin3: Bicoid-interacting protein 3 (Bin3); InterPr 92.0
KOG3420|consensus185 91.78
KOG3045|consensus325 91.22
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 90.98
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 90.45
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 90.39
PF08003 315 Methyltransf_9: Protein of unknown function (DUF16 90.23
KOG2899|consensus288 90.12
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 90.01
COG4122219 Predicted O-methyltransferase [General function pr 89.94
TIGR00755 253 ksgA dimethyladenosine transferase. Alternate name 89.9
COG2521287 Predicted archaeal methyltransferase [General func 89.46
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 89.2
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 89.17
PTZ00338 294 dimethyladenosine transferase-like protein; Provis 88.81
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 88.28
KOG1269|consensus 364 87.54
PF03492 334 Methyltransf_7: SAM dependent carboxyl methyltrans 87.47
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 86.78
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 85.48
TIGR02691129 arsC_pI258_fam arsenate reductase (thioredoxin). T 85.45
PF09243 274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 84.43
COG2263198 Predicted RNA methylase [Translation, ribosomal st 83.76
PF01861 243 DUF43: Protein of unknown function DUF43; InterPro 81.94
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 81.9
COG0421282 SpeE Spermidine synthase [Amino acid transport and 81.44
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 81.01
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 80.89
KOG3191|consensus209 80.65
TIGR03439 319 methyl_EasF probable methyltransferase domain, Eas 80.53
PLN02476278 O-methyltransferase 80.49
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 80.47
>KOG1541|consensus Back     alignment and domain information
Probab=99.90  E-value=4.5e-24  Score=149.97  Aligned_cols=75  Identities=55%  Similarity=1.026  Sum_probs=72.1

Q ss_pred             CCCCHHHHHHHHhcCCCCcEEEccCCCCCCCCCCceeeeeeccchhhhcccCCCCCChHHHHHHHHHHHHHHHhh
Q psy4109           1 MKKNAFYTNVARDREVEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLWS   75 (77)
Q Consensus         1 iDiS~~ML~~A~~r~~~~~~~~~D~~~~lPf~~~sFD~v~s~~~l~w~~d~~~~~~~p~~~l~~~~~~l~~~L~~   75 (77)
                      +|||+.||++|.++..+++++.+||++++||++|+||++||++++||++|.+++.|+|.+||.+||..||.+|..
T Consensus        78 vDiSpsML~~a~~~e~egdlil~DMG~GlpfrpGtFDg~ISISAvQWLcnA~~s~~~P~~Rl~~FF~tLy~~l~r  152 (270)
T KOG1541|consen   78 VDISPSMLEQAVERELEGDLILCDMGEGLPFRPGTFDGVISISAVQWLCNADKSLHVPKKRLLRFFGTLYSCLKR  152 (270)
T ss_pred             ecCCHHHHHHHHHhhhhcCeeeeecCCCCCCCCCccceEEEeeeeeeecccCccccChHHHHHHHhhhhhhhhcc
Confidence            699999999999887778999999999999999999999999999999999999999999999999999999863



>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>KOG1540|consensus Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>KOG3010|consensus Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>KOG2940|consensus Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>KOG1331|consensus Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>KOG4300|consensus Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>KOG1270|consensus Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>KOG2361|consensus Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG1975|consensus Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG2352|consensus Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PF11968 DUF3321: Putative methyltransferase (DUF3321); InterPro: IPR021867 This family is conserved in fungi and is annotated as being a nucleolar protein Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF06859 Bin3: Bicoid-interacting protein 3 (Bin3); InterPro: IPR010675 This entry represents a conserved region of approximately 120 residues within eukaryotic Bicoid-interacting protein 3 (Bin3) Back     alignment and domain information
>KOG3420|consensus Back     alignment and domain information
>KOG3045|consensus Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG2899|consensus Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>KOG1269|consensus Back     alignment and domain information
>PF03492 Methyltransf_7: SAM dependent carboxyl methyltransferase; InterPro: IPR005299 This family of plant methyltransferases contains enzymes that act on a variety of substrates including salicylic acid, jasmonic acid and 7-Methylxanthine Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>TIGR02691 arsC_pI258_fam arsenate reductase (thioredoxin) Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>KOG3191|consensus Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 99.07
1vl5_A 260 Unknown conserved protein BH2331; putative methylt 99.05
4hg2_A 257 Methyltransferase type 11; structural genomics, PS 99.0
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.98
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.92
3pfg_A 263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.92
3ccf_A 279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.91
2yqz_A 263 Hypothetical protein TTHA0223; RNA methyltransfera 98.9
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.89
2p35_A 259 Trans-aconitate 2-methyltransferase; SAM dependent 98.88
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 98.88
3ege_A 261 Putative methyltransferase from antibiotic biosyn 98.86
3ujc_A 266 Phosphoethanolamine N-methyltransferase; parasite; 98.86
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 98.85
1xxl_A 239 YCGJ protein; structural genomics, protein structu 98.82
3g5l_A 253 Putative S-adenosylmethionine dependent methyltran 98.81
2o57_A 297 Putative sarcosine dimethylglycine methyltransfera 98.81
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.79
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.79
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.79
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.78
3g5t_A 299 Trans-aconitate 3-methyltransferase; structural ge 98.78
4fsd_A 383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.77
3bxo_A 239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.75
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.75
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.73
2aot_A 292 HMT, histamine N-methyltransferase; classic methyl 98.72
3dh0_A219 SAM dependent methyltransferase; cystal structure, 98.72
2p7i_A 250 Hypothetical protein; putative methyltransferase, 98.72
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.7
1nkv_A 256 Hypothetical protein YJHP; structural genomics, PS 98.7
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.7
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.7
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.7
3bus_A 273 REBM, methyltransferase; rebeccamycin synthesis; H 98.69
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.69
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.69
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 98.66
4htf_A 285 S-adenosylmethionine-dependent methyltransferase; 98.66
3bkw_A 243 MLL3908 protein, S-adenosylmethionine dependent me 98.65
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.65
3kkz_A 267 Uncharacterized protein Q5LES9; putative methyltra 98.65
3mgg_A 276 Methyltransferase; NYSGXRC, PSI-II, protein struct 98.64
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.63
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.63
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.63
3ocj_A305 Putative exported protein; structural genomics, PS 98.62
3dli_A 240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.62
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.61
3f4k_A 257 Putative methyltransferase; structural genomics, P 98.6
3bgv_A 313 MRNA CAP guanine-N7 methyltransferase; alternative 98.6
3thr_A 293 Glycine N-methyltransferase; GNMT, folate, methylt 98.6
1y8c_A 246 S-adenosylmethionine-dependent methyltransferase; 98.59
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.58
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 98.57
1ri5_A 298 MRNA capping enzyme; methyltransferase, M7G, messe 98.54
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.54
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.53
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.52
3lcc_A235 Putative methyl chloride transferase; halide methy 98.51
2vdw_A 302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.51
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.51
3gu3_A 284 Methyltransferase; alpha-beta protein, structural 98.48
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.47
2avn_A 260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.46
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 98.46
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 98.46
3d2l_A 243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.46
3hem_A 302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 98.45
3cc8_A 230 Putative methyltransferase; structural genomics, j 98.44
3g2m_A 299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.43
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.42
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.42
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.42
4e2x_A 416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.38
3giw_A277 Protein of unknown function DUF574; rossmann-fold 98.35
3iv6_A 261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.33
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.31
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 98.3
1kpg_A 287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.28
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.26
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.22
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 98.21
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.16
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.16
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 98.16
2fk8_A 318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.15
1wzn_A 252 SAM-dependent methyltransferase; structural genomi 98.08
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.08
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 98.06
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 98.05
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 98.04
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 98.02
3bkx_A 275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.02
2qm3_A 373 Predicted methyltransferase; putative methyltransf 97.96
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 97.96
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 97.93
3adn_A 294 Spermidine synthase; aminopropyltransferase, polya 97.92
2r3s_A335 Uncharacterized protein; methyltransferase domain, 97.89
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 97.87
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 97.87
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 97.86
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 97.85
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 97.81
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 97.79
3lpm_A259 Putative methyltransferase; structural genomics, p 97.79
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 97.76
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 97.75
3dp7_A363 SAM-dependent methyltransferase; structural genomi 97.74
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 97.74
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 97.74
2fyt_A 340 Protein arginine N-methyltransferase 3; structural 97.73
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 97.73
3q7e_A 349 Protein arginine N-methyltransferase 1; HET: SAH; 97.72
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 97.7
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 97.69
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 97.69
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 97.68
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 97.64
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 97.64
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 97.62
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 97.59
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 97.59
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 97.58
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 97.57
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 97.56
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 97.53
2fpo_A202 Methylase YHHF; structural genomics, putative meth 97.53
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 97.53
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 97.51
1uir_A 314 Polyamine aminopropyltransferase; spermidien synth 97.49
2b3t_A276 Protein methyltransferase HEMK; translation termin 97.48
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 97.48
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 97.48
2pt6_A321 Spermidine synthase; transferase, structural genom 97.46
2i7c_A283 Spermidine synthase; transferase, structural genom 97.45
1dl5_A 317 Protein-L-isoaspartate O-methyltransferase; isoasp 97.45
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 97.43
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 97.42
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 97.42
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.41
2o07_A 304 Spermidine synthase; structural genomics, structur 97.4
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 97.39
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 97.36
3sso_A 419 Methyltransferase; macrolide, natural product, ros 97.35
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 97.35
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 97.35
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 97.35
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 97.34
3r0q_C 376 Probable protein arginine N-methyltransferase 4.2; 97.34
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 97.33
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 97.32
1g6q_1 328 HnRNP arginine N-methyltransferase; SAM-binding do 97.3
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 97.28
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 97.28
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 97.27
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 97.25
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.24
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.24
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 97.22
3gru_A 295 Dimethyladenosine transferase; rossman fold, ribos 97.19
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 97.19
3uwp_A 438 Histone-lysine N-methyltransferase, H3 lysine-79; 97.19
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 97.19
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 97.18
2b25_A 336 Hypothetical protein; structural genomics, methyl 97.18
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 97.18
3gjy_A 317 Spermidine synthase; APC62791, structural genomics 97.18
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 97.18
2esr_A177 Methyltransferase; structural genomics, hypothetic 97.17
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 97.17
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 97.17
1xj5_A 334 Spermidine synthase 1; structural genomics, protei 97.13
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 97.13
1zq9_A 285 Probable dimethyladenosine transferase; SGC, struc 97.12
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 97.09
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 97.09
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 97.07
2frn_A278 Hypothetical protein PH0793; structural genomics, 97.06
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 97.04
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 97.03
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 97.01
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 96.98
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 96.95
2h00_A254 Methyltransferase 10 domain containing protein; st 96.94
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 96.92
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 96.91
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 96.87
2h1r_A 299 Dimethyladenosine transferase, putative; SGC toron 96.86
1jsx_A207 Glucose-inhibited division protein B; methyltransf 96.85
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 96.84
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 96.81
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 96.79
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 96.77
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 96.76
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 96.76
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 96.75
2y1w_A 348 Histone-arginine methyltransferase CARM1; histone 96.75
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 96.74
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 96.69
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 96.68
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 96.66
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 96.63
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 96.6
1ws6_A171 Methyltransferase; structural genomics, riken stru 96.59
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 96.58
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 96.58
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 96.57
3b3j_A 480 Histone-arginine methyltransferase CARM1; protein 96.57
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 96.45
1yb2_A275 Hypothetical protein TA0852; structural genomics, 96.44
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 96.42
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 96.41
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 96.36
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 96.31
3duw_A223 OMT, O-methyltransferase, putative; alternating of 96.31
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 96.29
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 96.25
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 96.24
2cmg_A262 Spermidine synthase; transferase, putrescine amino 96.16
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 96.14
2xyq_A 290 Putative 2'-O-methyl transferase; transferase-vira 96.08
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 96.06
3hp7_A 291 Hemolysin, putative; structural genomics, APC64019 95.98
3opn_A 232 Putative hemolysin; structural genomics, PSI-2, pr 95.97
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 95.96
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 95.95
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 95.9
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 95.9
2f8l_A 344 Hypothetical protein LMO1582; structural genomics, 95.75
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 95.73
3tqs_A 255 Ribosomal RNA small subunit methyltransferase A; p 95.72
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 95.71
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 95.68
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 95.67
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 95.65
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 95.55
1qam_A 244 ERMC' methyltransferase; rRNA methyltransferase ER 95.52
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 95.49
2avd_A229 Catechol-O-methyltransferase; structural genomics, 95.41
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 95.39
1qyr_A 252 KSGA, high level kasugamycin resistance protein, S 95.25
2b78_A385 Hypothetical protein SMU.776; structure genomics, 95.07
3fut_A 271 Dimethyladenosine transferase; methyltransferase, 94.63
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 94.43
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 94.39
1m6y_A 301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 94.35
3gnl_A 244 Uncharacterized protein, DUF633, LMOF2365_1472; st 94.24
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 94.19
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 94.12
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 94.12
3ll7_A 410 Putative methyltransferase; methytransferase, stru 93.96
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 93.92
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 93.63
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 93.48
3o4f_A 294 Spermidine synthase; aminopropyltransferase, polya 93.46
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 93.41
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 93.34
3uzu_A 279 Ribosomal RNA small subunit methyltransferase A; s 93.29
1yub_A 245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 93.27
2okc_A 445 Type I restriction enzyme stysji M protein; NP_813 92.94
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 92.93
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 92.83
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 90.75
3ftd_A 249 Dimethyladenosine transferase; KSGA, rossmann-like 90.13
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 89.52
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 89.0
3khk_A 544 Type I restriction-modification system methylation 88.77
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 88.58
2p41_A 305 Type II methyltransferase; vizier, viral enzymes i 88.31
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 87.57
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 86.09
4hc4_A 376 Protein arginine N-methyltransferase 6; HRMT1L6, S 85.2
3k6r_A278 Putative transferase PH0793; structural genomics, 84.2
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 83.16
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
Probab=99.07  E-value=4.4e-11  Score=76.36  Aligned_cols=62  Identities=10%  Similarity=0.058  Sum_probs=52.3

Q ss_pred             CCCCHHHHHHHHhcCC-CCcEEEccCCCCCCC---CCCceeeeeeccchhhh-cccCCCCCChHHHHHHHHHHHHHHHh
Q psy4109           1 MKKNAFYTNVARDREV-EGDLVLSDLGQGVPF---RAGAFDGAISISALQWL-CNADKTSHNPAKRLYKFFSSLFACLW   74 (77)
Q Consensus         1 iDiS~~ML~~A~~r~~-~~~~~~~D~~~~lPf---~~~sFD~v~s~~~l~w~-~d~~~~~~~p~~~l~~~~~~l~~~L~   74 (77)
                      +|+|++|++.|+++.. +.+++++|+ +.+|+   .+++||+|+|+.++||+ .++           ..+|+++++.|+
T Consensus        26 vD~s~~ml~~a~~~~~~~~~~~~~d~-~~~~~~~~~~~~fD~V~~~~~l~~~~~~~-----------~~~l~~~~r~Lk   92 (176)
T 2ld4_A           26 VEALKGLVDKLQALTGNEGRVSVENI-KQLLQSAHKESSFDIILSGLVPGSTTLHS-----------AEILAEIARILR   92 (176)
T ss_dssp             HHHHHHHHHHHHHHTTTTSEEEEEEG-GGGGGGCCCSSCEEEEEECCSTTCCCCCC-----------HHHHHHHHHHEE
T ss_pred             eeCCHHHHHHHHHhcccCcEEEEech-hcCccccCCCCCEeEEEECChhhhcccCH-----------HHHHHHHHHHCC
Confidence            5899999999998863 478999998 57887   89999999999999998 543           568888888875



>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query77
d1xxla_ 234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.27
d1vl5a_ 231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.25
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 99.19
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.17
d2avna1 246 Hypothetical methyltransferase TM1389 {Thermotoga 99.11
d2o57a1 282 Putative sarcosine dimethylglycine methyltransfera 99.04
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 98.99
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.93
d1ri5a_ 252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 98.89
d1y8ca_ 246 Putative methyltransferase CAC2371 {Clostridium ac 98.86
d1wzna1 251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.82
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.79
d2gh1a1 281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.76
d1nkva_ 245 Hypothetical Protein YjhP {Escherichia coli [TaxId 98.75
d2p7ia1 225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.72
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 98.64
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.64
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.52
d1jqea_ 280 Histamine methyltransferase {Human (Homo sapiens) 98.22
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.18
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.16
d1kpia_ 291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 98.06
d1xvaa_ 292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.04
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 97.93
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 97.92
d2fk8a1 280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 97.79
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 97.59
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 97.58
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 97.55
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 97.43
d1kpga_ 285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 97.36
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 97.35
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 97.33
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 97.14
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 96.98
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 96.94
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 96.93
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 96.89
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 96.82
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 96.77
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 96.68
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 96.65
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 96.43
d1g6q1_ 328 Arginine methyltransferase, HMT1 {Baker's yeast (S 96.21
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 96.16
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 95.85
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 95.4
d1oria_ 316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 95.37
d2fyta1 311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 95.29
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 94.33
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 94.14
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 94.01
d2h00a1250 Methyltransferase 10 domain containing protein MET 94.0
d1uira_ 312 Spermidine synthase {Thermus thermophilus [TaxId: 93.91
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 93.89
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 93.73
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 93.58
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 93.08
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 92.36
d2b25a1 324 Hypothetical protein FLJ20628 {Human (Homo sapiens 92.08
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 92.0
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 90.35
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 89.8
d1xj5a_ 290 Spermidine synthase {Thale cress (Arabidopsis thal 89.75
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 89.66
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 89.38
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 87.13
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 85.51
d1m6ex_ 359 Salicylic acid carboxyl methyltransferase (SAMT) { 83.51
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 81.82
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 80.91
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 80.1
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 80.08
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: UbiE/COQ5-like
domain: Hypothetical protein YcgJ
species: Bacillus subtilis [TaxId: 1423]
Probab=99.27  E-value=2e-12  Score=84.98  Aligned_cols=62  Identities=15%  Similarity=0.108  Sum_probs=51.8

Q ss_pred             CCCCHHHHHHHHhcC-----CCCcEEEccCCCCCCCCCCceeeeeeccchhhhcccCCCCCChHHHHHHHHHHHHHHHh
Q psy4109           1 MKKNAFYTNVARDRE-----VEGDLVLSDLGQGVPFRAGAFDGAISISALQWLCNADKTSHNPAKRLYKFFSSLFACLW   74 (77)
Q Consensus         1 iDiS~~ML~~A~~r~-----~~~~~~~~D~~~~lPf~~~sFD~v~s~~~l~w~~d~~~~~~~p~~~l~~~~~~l~~~L~   74 (77)
                      +|+|++|++.|+++.     .+..++++|+ +.+||.+++||+|+|..+++|+.|+           ..+|++++++|+
T Consensus        44 vD~S~~~l~~A~~~~~~~~~~~~~~~~~d~-~~~~~~~~~fD~v~~~~~l~~~~d~-----------~~~l~~~~r~Lk  110 (234)
T d1xxla_          44 VDATKEMVEVASSFAQEKGVENVRFQQGTA-ESLPFPDDSFDIITCRYAAHHFSDV-----------RKAVREVARVLK  110 (234)
T ss_dssp             EESCHHHHHHHHHHHHHHTCCSEEEEECBT-TBCCSCTTCEEEEEEESCGGGCSCH-----------HHHHHHHHHHEE
T ss_pred             EeCChhhhhhhhhhhccccccccccccccc-ccccccccccceeeeeceeecccCH-----------HHHHHHHHHeeC
Confidence            599999999998773     2468899997 6799999999999999999999664           357777777765



>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1m6ex_ c.66.1.35 (X:) Salicylic acid carboxyl methyltransferase (SAMT) {Clarkia breweri [TaxId: 36903]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure