Diaphorina citri psyllid: psy410


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90---
MTVGRIYAQSRLQKNNIYCISPRTINVSGSINCVCFDKTGTLTEDGLDMWGVVPVHDCKFLAPVKRPSSLPPTEPLLAAMEKRCKVHKNMTLT
cHHHHHHHHHHHHHccCEEEccccEEEcccEEEEEEcccccccccccCEEEEEEccccccccccccccccccccHHHHHHHHccccccccccc
MTVGRIYAQSRLQKNNIYCISPRTINVSGSINCVCFDKTGTLTEDGLDMWGVVPVHDCKFLAPV******PPTEPLLAAMEKRCKVHKNMT**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTVGRIYAQSRLQKNNIYCISPRTINVSGSINCVCFDKTGTLTEDGLDMWGVVPVHDCKFLAPVKRPSSLPPTEPLLAAMEKRCKVHKNMTLT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable cation-transporting ATPase C1672.11c confidentO74431
Probable cation-transporting ATPase 13A5 confidentQ4VNC0
Vacuolar cation-transporting ATPase YPK9 Vacuolar transporter which plays a role in sequestration of divalent heavy metal ions.confidentQ12697

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0000329 [CC]fungal-type vacuole membraneprobableGO:0005737, GO:0005575, GO:0000324, GO:0000323, GO:0000322, GO:0005773, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0005774, GO:0044446, GO:0044444, GO:0044437, GO:0043231, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0044699 [BP]single-organism processprobableGO:0008150
GO:0009987 [BP]cellular processprobableGO:0008150
GO:0005764 [CC]lysosomeprobableGO:0005737, GO:0000323, GO:0043231, GO:0005773, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MHS, chain A
Confidence level:confident
Coverage over the Query: 2-85
View the alignment between query and template
View the model in PyMOL