Diaphorina citri psyllid: psy4124


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MSSQLNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHDTA
ccccccHHHHHHHHHHHHHHHHccccccccccccccccccccEEEECccEEEcHHHHHHHHccccccccCEEEEEEEECcccCEEEEccEEEEEEcccc
******PAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHD**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSQLNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHDTA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable nuclear transport factor 2 Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.confidentQ21735
Nuclear transport factor 2 Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.confidentQ9XJ54
Nuclear transport factor 2 Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.confidentQ6CQX4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0002807 [BP]positive regulation of antimicrobial peptide biosynthetic processprobableGO:0034250, GO:0009893, GO:0019222, GO:0009891, GO:0031326, GO:0031325, GO:0002831, GO:0002920, GO:0031328, GO:0002700, GO:0050789, GO:0002784, GO:0002682, GO:0048518, GO:0065007, GO:0002805, GO:0031323, GO:0009889, GO:0048583, GO:0034248, GO:0043900, GO:0008150, GO:0051171, GO:0051173, GO:0050794, GO:0050776, GO:0002759, GO:0002697, GO:0048522
GO:0005635 [CC]nuclear envelopeprobableGO:0005575, GO:0005623, GO:0005634, GO:0044464, GO:0031967, GO:0031975, GO:0044446, GO:0043229, GO:0044428, GO:0012505, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0043231

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1ZO2, chain A
Confidence level:very confident
Coverage over the Query: 3-94
View the alignment between query and template
View the model in PyMOL