Psyllid ID: psy4124

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------10
MSSQLNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHDTA
ccccccHHHHHHHHHHHHHHHHccccccccccccccccccccEEEEEccEEEcHHHHHHHHccccccccEEEEEEEEEEcccEEEEEccEEEEEEcccc
ccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHcccccEEEEEccEEEEcHHHHHHHHccccccccccEEEEEEEcccccEEEEccEEEEEEcccc
MSSQLNPAYEAIGKGFVQQYYAlfddpaqrpnlinmyntetsfmtfeGIQLQGAVKIMEkfncdddpphaysqifvlkplgasfycqhdifrlgihdta
MSSQLNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHDTA
MSSQLNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHDTA
********YEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIH***
******PAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHD**
MSSQLNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHDTA
***QLNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHD**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSQLNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFNCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHDTA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query99 2.2.26 [Sep-21-2011]
Q21735133 Probable nuclear transpor yes N/A 0.949 0.706 0.312 6e-11
O42242127 Nuclear transport factor N/A N/A 0.898 0.700 0.32 8e-11
Q5R8G4127 Nuclear transport factor yes N/A 0.898 0.700 0.304 1e-09
P61972127 Nuclear transport factor yes N/A 0.898 0.700 0.296 3e-09
P61971127 Nuclear transport factor yes N/A 0.898 0.700 0.296 3e-09
P61970127 Nuclear transport factor yes N/A 0.898 0.700 0.296 3e-09
Q32KP9127 Nuclear transport factor yes N/A 0.898 0.700 0.296 3e-09
Q9XJ54122 Nuclear transport factor yes N/A 0.818 0.663 0.319 2e-07
Q6CQX4125 Nuclear transport factor yes N/A 0.838 0.664 0.314 3e-06
Q6FRC6125 Nuclear transport factor yes N/A 0.838 0.664 0.314 7e-06
>sp|Q21735|NTF2_CAEEL Probable nuclear transport factor 2 OS=Caenorhabditis elegans GN=ran-4 PE=3 SV=1 Back     alignment and function desciption
 Score = 66.2 bits (160), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 64/131 (48%), Gaps = 37/131 (28%)

Query: 5   LNPAYEAIGKGFVQQYYALFD--DPAQRP-NLINMYNTETSFMTFEGIQLQGAVKIMEKF 61
            NP YE++ K F+Q YY+ FD  D   R   L ++Y+ E S+MTFEG Q +G   I++KF
Sbjct: 3   FNPDYESVAKAFIQHYYSKFDVGDGMSRAQGLSDLYDPENSYMTFEGQQAKGRDGILQKF 62

Query: 62  N---------------------------------CDDDPPHAYSQIFVLKPLG-ASFYCQ 87
                                              D+DP + +SQ+F+L+P    S++  
Sbjct: 63  TTLGFTKIQRAITVIDSQPLYDGSIQVMVLGQLKTDEDPINPFSQVFILRPNNQGSYFIG 122

Query: 88  HDIFRLGIHDT 98
           ++IFRL +H+ 
Sbjct: 123 NEIFRLDLHNN 133
Facilitates protein transport into the nucleus. Could be part of a multicomponent system of cytosolic factors that assemble at the pore complex during nuclear import.
Caenorhabditis elegans (taxid: 6239)
>sp|O42242|NTF2_XENLA Nuclear transport factor 2 OS=Xenopus laevis GN=ntf2 PE=2 SV=1 Back     alignment and function description
>sp|Q5R8G4|NTF2_PONAB Nuclear transport factor 2 OS=Pongo abelii GN=NUTF2 PE=2 SV=1 Back     alignment and function description
>sp|P61972|NTF2_RAT Nuclear transport factor 2 OS=Rattus norvegicus GN=Nutf2 PE=1 SV=1 Back     alignment and function description
>sp|P61971|NTF2_MOUSE Nuclear transport factor 2 OS=Mus musculus GN=Nutf2 PE=2 SV=1 Back     alignment and function description
>sp|P61970|NTF2_HUMAN Nuclear transport factor 2 OS=Homo sapiens GN=NUTF2 PE=1 SV=1 Back     alignment and function description
>sp|Q32KP9|NTF2_BOVIN Nuclear transport factor 2 OS=Bos taurus GN=NUTF2 PE=2 SV=1 Back     alignment and function description
>sp|Q9XJ54|NTF2_ORYSJ Nuclear transport factor 2 OS=Oryza sativa subsp. japonica GN=NTF2 PE=2 SV=1 Back     alignment and function description
>sp|Q6CQX4|NTF2_KLULA Nuclear transport factor 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=NTF2 PE=3 SV=1 Back     alignment and function description
>sp|Q6FRC6|NTF2_CANGA Nuclear transport factor 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=NTF2 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
156553795130 PREDICTED: probable nuclear transport fa 0.949 0.723 0.637 3e-39
383857032130 PREDICTED: probable nuclear transport fa 0.959 0.730 0.625 1e-38
48104167130 PREDICTED: probable nuclear transport fa 0.959 0.730 0.617 2e-38
443429478130 nuclear transport factor 2-like protein 0.959 0.730 0.632 8e-38
340712333130 PREDICTED: probable nuclear transport fa 0.959 0.730 0.609 1e-37
314906996131 nuclear transport factor 2 [Helicoverpa 0.959 0.725 0.617 3e-37
91091394130 PREDICTED: similar to conserved hypothet 0.959 0.730 0.609 1e-36
345492322130 PREDICTED: probable nuclear transport fa 0.959 0.730 0.593 5e-36
242247073130 nuclear transport factor 2-like [Acyrtho 0.949 0.723 0.590 7e-36
383857034130 PREDICTED: probable nuclear transport fa 0.959 0.730 0.585 2e-35
>gi|156553795|ref|XP_001601236.1| PREDICTED: probable nuclear transport factor 2-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  165 bits (417), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 81/127 (63%), Positives = 89/127 (70%), Gaps = 33/127 (25%)

Query: 5   LNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFN-- 62
           LNP+YEAIGKGFVQQYYALFDDPAQRPNLINMYNTE+SFMTFEG+Q+QGA+KIMEK    
Sbjct: 3   LNPSYEAIGKGFVQQYYALFDDPAQRPNLINMYNTESSFMTFEGLQIQGAIKIMEKLTSL 62

Query: 63  -------------------------------CDDDPPHAYSQIFVLKPLGASFYCQHDIF 91
                                           D+DPPHA+SQ FVLKPLG SF+CQHDIF
Sbjct: 63  SFQKINRIITAIDSQPMFDGGVLINVLGRLQADEDPPHAFSQTFVLKPLGQSFFCQHDIF 122

Query: 92  RLGIHDT 98
           RLGIHDT
Sbjct: 123 RLGIHDT 129

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383857032|ref|XP_003704010.1| PREDICTED: probable nuclear transport factor 2-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information
>gi|48104167|ref|XP_392921.1| PREDICTED: probable nuclear transport factor 2-like isoform 3 [Apis mellifera] gi|380014043|ref|XP_003691053.1| PREDICTED: probable nuclear transport factor 2-like [Apis florea] Back     alignment and taxonomy information
>gi|443429478|gb|AGC92656.1| nuclear transport factor 2-like protein [Heliconius erato] Back     alignment and taxonomy information
>gi|340712333|ref|XP_003394716.1| PREDICTED: probable nuclear transport factor 2-like isoform 1 [Bombus terrestris] gi|350417606|ref|XP_003491504.1| PREDICTED: probable nuclear transport factor 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|314906996|gb|ABK29496.2| nuclear transport factor 2 [Helicoverpa armigera] Back     alignment and taxonomy information
>gi|91091394|ref|XP_973550.1| PREDICTED: similar to conserved hypothetical protein [Tribolium castaneum] gi|270014347|gb|EFA10795.1| nuclear transport factor-2 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|345492322|ref|XP_003426815.1| PREDICTED: probable nuclear transport factor 2-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|242247073|ref|NP_001156202.1| nuclear transport factor 2-like [Acyrthosiphon pisum] gi|239799305|dbj|BAH70580.1| ACYPI006036 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383857034|ref|XP_003704011.1| PREDICTED: probable nuclear transport factor 2-like isoform 2 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query99
FB|FBgn0032680130 Ntf-2r "Nuclear transport fact 0.565 0.430 0.714 1.8e-31
FB|FBgn0031145130 Ntf-2 "Nuclear transport facto 0.565 0.430 0.714 7.5e-18
WB|WBGene00004305133 ran-4 [Caenorhabditis elegans 0.565 0.421 0.457 1.6e-16
ZFIN|ZDB-GENE-041010-77127 nutf2 "nuclear transport facto 0.535 0.417 0.446 3e-14
ZFIN|ZDB-GENE-020416-1128 nutf2l "nuclear transport fact 0.535 0.414 0.464 1e-13
UNIPROTKB|Q32KP9127 NUTF2 "Nuclear transport facto 0.535 0.417 0.428 1.6e-13
UNIPROTKB|P61970127 NUTF2 "Nuclear transport facto 0.535 0.417 0.428 1.6e-13
UNIPROTKB|F1S2K3127 LOC100621711 "Uncharacterized 0.535 0.417 0.428 1.6e-13
RGD|1359213127 Nutf2 "nuclear transport facto 0.535 0.417 0.428 1.6e-13
UNIPROTKB|J9P558127 NUTF2 "Uncharacterized protein 0.535 0.417 0.428 2.1e-13
FB|FBgn0032680 Ntf-2r "Nuclear transport factor-2-related" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 205 (77.2 bits), Expect = 1.8e-31, Sum P(2) = 1.8e-31
 Identities = 40/56 (71%), Positives = 44/56 (78%)

Query:     5 LNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEK 60
             LN  YE IGK FVQQYYA+FDDPA R N+IN YN   SFMTFEG Q+QGA KI+EK
Sbjct:     3 LNLQYEDIGKEFVQQYYAIFDDPANRKNVINFYNATDSFMTFEGNQIQGAPKILEK 58
GO:0006606 "protein import into nucleus" evidence=ISS
GO:0005622 "intracellular" evidence=IEA
FB|FBgn0031145 Ntf-2 "Nuclear transport factor-2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00004305 ran-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-77 nutf2 "nuclear transport factor 2" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020416-1 nutf2l "nuclear transport factor 2, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q32KP9 NUTF2 "Nuclear transport factor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P61970 NUTF2 "Nuclear transport factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1S2K3 LOC100621711 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1359213 Nutf2 "nuclear transport factor 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J9P558 NUTF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9XJ54NTF2_ORYSJNo assigned EC number0.31930.81810.6639yesN/A
Q6CQX4NTF2_KLULANo assigned EC number0.31400.83830.664yesN/A
Q75AA5NTF2_ASHGONo assigned EC number0.33050.83830.664yesN/A
Q6BWC0NTF2_DEBHANo assigned EC number0.33880.83830.6693yesN/A
Q6CC82NTF2_YARLINo assigned EC number0.30830.82820.6666yesN/A
Q21735NTF2_CAEELNo assigned EC number0.31290.94940.7067yesN/A
Q6FRC6NTF2_CANGANo assigned EC number0.31400.83830.664yesN/A
P33331NTF2_YEASTNo assigned EC number0.32230.83830.664yesN/A
Q5R8G4NTF2_PONABNo assigned EC number0.3040.89890.7007yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer5.3.3.1LOW CONFIDENCE prediction!
3rd Layer5.3.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
cd00780119 cd00780, NTF2, Nuclear transport factor 2 (NTF2) d 1e-14
pfam02136116 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) 2e-11
>gnl|CDD|238403 cd00780, NTF2, Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information 
 Score = 63.5 bits (155), Expect = 1e-14
 Identities = 34/119 (28%), Positives = 51/119 (42%), Gaps = 37/119 (31%)

Query: 9   YEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQL-QGAVKIMEKFN----- 62
            E + K FVQQYY++FD+   R  L  +Y  +TS ++ EG++   G   I+EK +     
Sbjct: 2   AEDVAKAFVQQYYSIFDN--NREGLHRLY-GDTSMLSREGMKQVTGRDAIVEKLSSLPFQ 58

Query: 63  ----------------------------CDDDPPHAYSQIFVLKPLGASFYCQHDIFRL 93
                                        D+ PP  +SQ FVL P    ++  +DIFR 
Sbjct: 59  KTKHKITTVDSQPTPSGGVIVMVTGSLKLDEQPPRKFSQTFVLAPQNGGYFVLNDIFRF 117

This bi-directional transport of macromolecules across the nuclear envelope requires many soluble factors that includes GDP-binding protein Ran (RanGDP). RanGDP is required for both import and export of proteins and poly(A) RNA. RanGDP also has been implicated in cell cycle control, specifically in mitotic spindle assembly. In interphase cells, RanGDP is predominately nuclear and thought to be GTP bound, but it is also present in the cytoplasm, probably in the GDP-bound state. NTF2 mediates the nuclear import of RanGDP. NTF2 binds to both RanGDP and FxFG repeat-containing nucleoporins. Length = 119
>gnl|CDD|216894 pfam02136, NTF2, Nuclear transport factor 2 (NTF2) domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 99
KOG2104|consensus126 100.0
cd00780119 NTF2 Nuclear transport factor 2 (NTF2) domain play 99.95
KOG0116|consensus 419 99.92
PF02136118 NTF2: Nuclear transport factor 2 (NTF2) domain; In 99.89
KOG4353|consensus139 99.81
cd00531124 NTF2_like Nuclear transport factor 2 (NTF2-like) s 98.15
TIGR02246128 conserved hypothetical protein. This family consis 96.7
PF10429166 Mtr2: Nuclear pore RNA shuttling protein Mtr2; Int 96.58
PF13474121 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE 96.53
KOG3763|consensus 585 95.26
PF12680102 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8 95.14
PF14534107 DUF4440: Domain of unknown function (DUF4440); PDB 93.96
cd00781122 ketosteroid_isomerase ketosteroid isomerase: Many 93.68
PF15008262 DUF4518: Domain of unknown function (DUF4518) 89.76
COG4875156 Uncharacterized protein conserved in bacteria with 86.56
PF13577127 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RF 86.03
PF08332128 CaMKII_AD: Calcium/calmodulin dependent protein ki 82.59
TIGR02096129 conserved hypothetical protein, steroid delta-isom 80.65
COG4319137 Ketosteroid isomerase homolog [Function unknown] 80.41
>KOG2104|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.4e-36  Score=205.21  Aligned_cols=92  Identities=49%  Similarity=0.881  Sum_probs=88.1

Q ss_pred             CCCccHHHHHHHHHHHHHHhccCCCChhhhhhhccCCCceeeEcCceeccHHHHHhhh----------------------
Q psy4124           4 QLNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKF----------------------   61 (99)
Q Consensus         4 ~~~p~~~~ig~~FV~~YY~~~d~~~~r~~L~~~Y~~~~S~lt~eg~~~~G~~~I~~kl----------------------   61 (99)
                      +++|.+++||++||+|||++||  .+|..|..+|.++ |+|||||++++|+++|+|||                      
T Consensus         1 ~~d~~~e~v~~~FvqhYY~~FD--~dR~ql~~lY~~~-S~LTfEGqq~qG~~~IveKl~sLpFqkiqh~IttvD~QPt~~   77 (126)
T KOG2104|consen    1 SLDPVYEAVAKAFVQHYYSLFD--NDRSQLGALYIDT-SMLTFEGQQIQGKDAIVEKLTSLPFQKIQHSITTVDSQPTPD   77 (126)
T ss_pred             CCCccHHHHHHHHHHHHHHHhc--CchhHhhhhhccc-ceeeEcchhhcchHHHHHHHhcCChhhhhceeeecccccCCC
Confidence            4678999999999999999999  9999999999999 99999999999999999999                      


Q ss_pred             -----------hcCCCCCeeEEEEEEEEee-CCEEEEEcceEeeecCCC
Q psy4124          62 -----------NCDDDPPHAYSQIFVLKPL-GASFYCQHDIFRLGIHDT   98 (99)
Q Consensus        62 -----------~~d~~~~~~F~QtF~L~~~-~~~y~v~NDifR~~~~n~   98 (99)
                                 ++||+||.+|+|+|+|.|. +|+|||.||||||.+||+
T Consensus        78 g~ilv~V~G~Lk~dEd~~~~FsQvF~L~~n~~~~~~v~ndiFRLn~~n~  126 (126)
T KOG2104|consen   78 GGILVMVVGQLKLDEDPILRFSQVFLLKPNIQGSYYVFNDIFRLNLHNS  126 (126)
T ss_pred             CcEEEEEeeeeeeccCCccceeeEEEEeEcCCCCEEEEeeeEEEecccC
Confidence                       7889999999999999988 499999999999999996

>cd00780 NTF2 Nuclear transport factor 2 (NTF2) domain plays an important role in the trafficking of macromolecules, ions and small molecules between the cytoplasm and nucleus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>PF02136 NTF2: Nuclear transport factor 2 (NTF2) domain; InterPro: IPR002075 Nuclear transport factor 2 (NTF2) is a homodimer which stimulates efficient nuclear import of a cargo protein Back     alignment and domain information
>KOG4353|consensus Back     alignment and domain information
>cd00531 NTF2_like Nuclear transport factor 2 (NTF2-like) superfamily Back     alignment and domain information
>TIGR02246 conserved hypothetical protein Back     alignment and domain information
>PF10429 Mtr2: Nuclear pore RNA shuttling protein Mtr2; InterPro: IPR019488 Mtr2 is a monomeric, dual-action, RNA-shuttle protein found in yeasts Back     alignment and domain information
>PF13474 SnoaL_3: SnoaL-like domain; PDB: 2GXF_A 3KSP_A 3KE7_A 3BB9_E 3CNX_A 3F7S_A 3GWR_B Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>PF12680 SnoaL_2: SnoaL-like domain; PDB: 3F40_A 3RGA_A 3G8Z_A 3DMC_A 3FH1_A 1TUH_A 3F14_A 3ER7_A 1Z1S_A 3F7X_A Back     alignment and domain information
>PF14534 DUF4440: Domain of unknown function (DUF4440); PDB: 3HX8_A 3SOY_A 3ROB_B 3GZR_A 3B7C_A 3CU3_A 3FSD_A 2R4I_C 1TP6_A Back     alignment and domain information
>cd00781 ketosteroid_isomerase ketosteroid isomerase: Many biological reactions proceed by enzymatic cleavage of a C-H bond adjacent to carbonyl or a carboxyl group, leading to an enol or a enolate intermediate that is subsequently re-protonated at the same or an adjacent carbon Back     alignment and domain information
>PF15008 DUF4518: Domain of unknown function (DUF4518) Back     alignment and domain information
>COG4875 Uncharacterized protein conserved in bacteria with a cystatin-like fold [Function unknown] Back     alignment and domain information
>PF13577 SnoaL_4: SnoaL-like domain; PDB: 3S5C_B 3EJV_A 2RFR_A 3B8L_F 2CHC_A 3A76_A 3EF8_B Back     alignment and domain information
>PF08332 CaMKII_AD: Calcium/calmodulin dependent protein kinase II Association; InterPro: IPR013543 Protein phosphorylation, which plays a key role in most cellular activities, is a reversible process mediated by protein kinases and phosphoprotein phosphatases Back     alignment and domain information
>TIGR02096 conserved hypothetical protein, steroid delta-isomerase-related Back     alignment and domain information
>COG4319 Ketosteroid isomerase homolog [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
1ask_A127 Nuclear Transport Factor 2 (Ntf2) H66a Mutant Lengt 2e-10
1oun_A127 Crystal Structure Of Nuclear Transport Factor 2 (Nt 2e-10
1ar0_A127 Nuclear Transport Factor 2 (Ntf2) E42k Mutant Lengt 8e-10
1jb2_A127 Crystal Structure Of Ntf2 M84e Mutant Length = 127 1e-09
1qma_A126 Nuclear Transport Factor 2 (Ntf2) W7a Mutant Length 1e-09
1u5o_A127 Structure Of The D23a Mutant Of The Nuclear Transpo 2e-09
1gy5_A127 D92n,D94n Double Point Mutant Of Human Nuclear Tran 2e-09
1jb5_A127 Crystal Structure Of Ntf2 M118e Mutant Length = 127 3e-09
1jb4_A127 Crystal Structure Of Ntf2 M102e Mutant Length = 127 3e-09
1zo2_A129 Structure Of Nuclear Transport Factor 2 (Ntf2) From 2e-08
1gy7_A125 N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125 1e-06
>pdb|1ASK|A Chain A, Nuclear Transport Factor 2 (Ntf2) H66a Mutant Length = 127 Back     alignment and structure 
Iteration: 1

 Score = 60.5 bits (145), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 57/125 (45%), Gaps = 36/125 (28%)
Query: 6   NPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKFN--- 62
            P +E IG  F+Q YY LFD+   R  L  +Y  + S +T+EG Q QG   I+EK +   
Sbjct: 4   KPIWEQIGSSFIQHYYQLFDN--DRTQLGAIY-IDASCLTWEGQQFQGKAAIVEKLSSLP 60
Query: 63  ------------------------------CDDDPPHAYSQIFVLKPLGASFYCQHDIFR 92
                                          D+DP   + Q+F+LK +  ++ C +D+FR
Sbjct: 61  FQKIQASITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFR 120
Query: 93  LGIHD 97
           L +H+
Sbjct: 121 LALHN 125
>pdb|1OUN|A Chain A, Crystal Structure Of Nuclear Transport Factor 2 (Ntf2) Length = 127 Back     alignment and structure
>pdb|1AR0|A Chain A, Nuclear Transport Factor 2 (Ntf2) E42k Mutant Length = 127 Back     alignment and structure
>pdb|1JB2|A Chain A, Crystal Structure Of Ntf2 M84e Mutant Length = 127 Back     alignment and structure
>pdb|1QMA|A Chain A, Nuclear Transport Factor 2 (Ntf2) W7a Mutant Length = 126 Back     alignment and structure
>pdb|1U5O|A Chain A, Structure Of The D23a Mutant Of The Nuclear Transport Carrier Ntf2 Length = 127 Back     alignment and structure
>pdb|1GY5|A Chain A, D92n,D94n Double Point Mutant Of Human Nuclear Transport Factor 2 (Ntf2) Length = 127 Back     alignment and structure
>pdb|1JB5|A Chain A, Crystal Structure Of Ntf2 M118e Mutant Length = 127 Back     alignment and structure
>pdb|1JB4|A Chain A, Crystal Structure Of Ntf2 M102e Mutant Length = 127 Back     alignment and structure
>pdb|1ZO2|A Chain A, Structure Of Nuclear Transport Factor 2 (Ntf2) From Cryptosporidium Parvum Length = 129 Back     alignment and structure
>pdb|1GY7|A Chain A, N77y Point Mutant Of S.Cerevisiae Ntf2 Length = 125 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query99
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 4e-22
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 2e-19
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 3e-19
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 1e-16
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 2e-16
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 6e-15
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 2e-13
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 1e-12
>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Length = 127 Back     alignment and structure
 Score = 82.6 bits (204), Expect = 4e-22
 Identities = 37/126 (29%), Positives = 56/126 (44%), Gaps = 36/126 (28%)

Query: 5   LNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKF--- 61
             P +E IG  F+Q YY LFD+   R  L  +Y  + S +T+EG Q QG   I+EK    
Sbjct: 3   DKPIWEQIGSSFIQHYYQLFDN--DRTQLGAIYI-DASCLTWEGQQFQGKAAIVEKLSSL 59

Query: 62  ------------------------------NCDDDPPHAYSQIFVLKPLGASFYCQHDIF 91
                                           D+DP   + Q+F+LK +  ++ C +D+F
Sbjct: 60  PFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMF 119

Query: 92  RLGIHD 97
           RL +H+
Sbjct: 120 RLALHN 125
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Length = 125 Back     alignment and structure
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Length = 129 Back     alignment and structure
>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Length = 120 Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Length = 154 Back     alignment and structure
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} Length = 140 Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Length = 140 Back     alignment and structure
>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
1gy6_A127 Nuclear transport factor 2; 1.6A {Rattus norvegicu 100.0
1zo2_A129 NTF2, nuclear transport factor 2; structural genom 100.0
1gy7_A125 Nuclear transport factor 2; protein transport; 1.6 99.97
3q90_A140 RAS GTPase-activating protein-binding protein 1; s 99.97
3ujm_A120 Rasputin; NTF2-like fold, RAS signaling, signaling 99.97
2qiy_A154 UBP3-associated protein BRE5; deubiquitylation, ub 99.97
3nv0_B154 NTF2-related export protein; NTF2-like domain, bet 99.96
1jkg_A140 P15; NTF2-like domain, transport protein; 1.90A {H 99.95
1jkg_B250 TAP; NTF2-like domain, transport protein; 1.90A {H 99.83
1of5_A221 MRNA export factor MEX67; nuclear protein, repeat, 99.77
1q40_B219 MEX67, mRNA export factor MEX67; NTF2-fold, nuclea 99.76
3nv0_A205 Nuclear RNA export factor 2; NTF2-like domain, bet 99.37
1q42_A201 MTR2, mRNA transport regulator MTR2; NTF2-fold, nu 98.99
1of5_B184 MTR2, YKL186C, mRNA transport regulator MTR2; nucl 98.18
3d9r_A135 Ketosteroid isomerase-like protein; YP_049581.1, s 97.3
4i4k_A143 Uncharacterized protein SGCJ; structural genomics, 97.24
3rob_A139 Uncharacterized conserved protein; structural geno 96.74
3gzr_A146 Uncharacterized protein with A NTF2-like fold; str 96.69
3hx8_A129 MLR2180 protein, putative ketosteroid isomerase; s 96.5
3cu3_A172 Domain of unknown function with A cystatin-like F; 96.2
3er7_A131 Uncharacterized NTF2-like protein; YP_001812677.1, 95.67
3f7s_A142 Uncharacterized NTF2-like protein; structural geno 95.53
3gwr_A144 Putative calcium/calmodulin-dependent protein KIN 95.3
3h51_A156 Putative calcium/calmodulin dependent protein KIN 94.99
3h3h_A122 Uncharacterized snoal-like protein; structural gen 94.94
2rcd_A129 Uncharacterized protein; structural genomics, join 94.65
2gxf_A142 Hypothetical protein YYBH; alpha-beta protein., st 94.56
3dmc_A134 NTF2-like protein; structural genomics, joint cent 94.43
3bb9_A148 Putative orphan protein; structural genomics, join 94.34
1oh0_A131 Steroid delta-isomerase; ketosteroid isomerase, KS 94.32
3b7c_A122 Uncharacterized protein; NTF-2 like protein, struc 93.41
1s5a_A150 Hypothetical protein YESE; structural genomics, PS 93.08
1z1s_A163 Hypothetical protein PA3332; beta barrel, conserve 92.66
3mso_A143 Steroid delta-isomerase; structural genomics, join 92.39
1ohp_A125 Steroid delta-isomerase; inhibitor; HET: ESR; 1.53 92.35
1nww_A149 Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {R 91.79
3fh1_A129 Uncharacterized NTF2-like protein; structural geno 91.72
3i0y_A140 Putative polyketide cyclase; cystatin-like fold, s 91.37
2chc_A170 Protein RV3472; hypothetical protein; 1.69A {Mycob 91.13
3dm8_A143 Uncharacterized protein RPA4348; siras, putative i 91.13
3en8_A128 Uncharacterized NTF-2 like protein; YP_553245.1, N 90.61
3ec9_A140 Uncharacterized NTF2-like protein; structural geno 90.29
4h3u_A158 Hypothetical protein; structural genomics, PSI-bio 90.18
3f7x_A151 Putative polyketide cyclase; structural genomics, 90.16
2owp_A129 Hypothetical protein BXE_B1374; cystatin-like fold 90.02
2a15_A139 Hypothetical protein RV0760C; beta-alpha-barrel, s 89.59
3b8l_A163 Uncharacterized protein; putative aromatic ring hy 89.07
3cnx_A170 Uncharacterized protein; putative dehydratase, NTF 88.85
3rga_A283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 88.59
2ux0_A143 Calcium-calmodulin dependent protein kinase (CAM I 88.31
2rfr_A155 Uncharacterized protein; structural genomics, join 86.98
3f40_A114 Uncharacterized NTF2-like protein; YP_677363.1, NT 86.52
3ff2_A117 Uncharacterized cystatin fold protein (YP_497570. 86.2
3duk_A125 NTF2-like protein of unknown function; structural 86.17
3jum_A185 Phenazine biosynthesis protein A/B; chirality, dru 86.06
3dxo_A121 Uncharacterized snoal-like protein; putative isome 85.62
3ehc_A128 Snoal-like polyketide cyclase; structural genomics 85.56
2k54_A123 Protein ATU0742; protein of unknown function, stru 85.06
3rga_A 283 Epoxide hydrolase; NTF2-like, epoxide-opening cycl 84.35
3mg1_A323 OCP, orange carotenoid protein; carotenoid binding 83.78
2bng_A149 MB2760; epoxide hydrolase, limonene, hydrolase, st 83.5
3fgy_A135 Uncharacterized NTF2-like protein; structural geno 83.07
2gey_A158 ACLR protein; alpha+beta barrel, oxidoreductase; H 82.3
3ebt_A132 Uncharacterized NTF2-like protein; structural geno 82.14
1tuh_A156 BAL32A, hypothetical protein EGC068; unknown funct 81.93
3k0z_A159 Putative polyketide cyclase; structural genomics, 81.6
3f14_A112 Uncharacterized NTF2-like protein; YP_680363.1, NT 81.21
2gex_A152 SNOL; alpha+beta barrel, oxidoreductase; 2.50A {St 81.01
3g8z_A148 Protein of unknown function with cystatin-like FO; 80.62
3f8x_A148 Putative delta-5-3-ketosteroid isomerase; structur 80.15
>1gy6_A Nuclear transport factor 2; 1.6A {Rattus norvegicus} SCOP: d.17.4.2 PDB: 1a2k_A 1oun_A 1ar0_A 1u5o_A 1ask_A 1gy5_A 1jb5_A 1jb4_A 1jb2_A 1qma_A Back     alignment and structure
Probab=100.00  E-value=1.5e-34  Score=197.10  Aligned_cols=92  Identities=40%  Similarity=0.801  Sum_probs=87.8

Q ss_pred             CCccHHHHHHHHHHHHHHhccCCCChhhhhhhccCCCceeeEcCceeccHHHHHhhh-----------------------
Q psy4124           5 LNPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKF-----------------------   61 (99)
Q Consensus         5 ~~p~~~~ig~~FV~~YY~~~d~~~~r~~L~~~Y~~~~S~lt~eg~~~~G~~~I~~kl-----------------------   61 (99)
                      ++|++++||++||++||++||  ++|+.|++||.++ |+++|+|+.++|+++|.++|                       
T Consensus         3 ~~p~~~~v~~~Fv~~YY~~~d--~~r~~L~~~Y~~~-S~ls~~g~~~~G~~~I~~~l~~Lp~~~~~h~i~t~d~qp~~~~   79 (127)
T 1gy6_A            3 DKPIWEQIGSSFIQHYYQLFD--NDRTQLGAIYIDA-SCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDS   79 (127)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHH--HHGGGGGGGEEEE-EEEEETTEEEESHHHHHHHHHHCSCSCEEEEEEEEEEEECTTS
T ss_pred             CCCCHHHHHHHHHHHHHHHHh--CCHHHHHHhhCCC-cEEEECCccccCHHHHHHHHHhCCCcceEEEEEEEEEEEeCCC
Confidence            589999999999999999999  8999999999998 99999999999999999999                       


Q ss_pred             ----------hcCCCCCeeEEEEEEEEeeCCEEEEEcceEeeecCCCC
Q psy4124          62 ----------NCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHDTA   99 (99)
Q Consensus        62 ----------~~d~~~~~~F~QtF~L~~~~~~y~v~NDifR~~~~n~~   99 (99)
                                +.+++++++|+|||+|+|++++|+|.||||||++||+|
T Consensus        80 ~ili~V~G~~~~~~~~~~~F~qtF~L~p~~~~~~I~nD~fr~~~~~~~  127 (127)
T 1gy6_A           80 CIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG  127 (127)
T ss_dssp             CEEEEEEEEEEETTSCCEEEEEEEEEEEETTEEEEEEEEEEECCCCCC
T ss_pred             cEEEEEEEEEEECCCCcceEeEEEEEEEeCCEEEEEEEEEEEEccccc
Confidence                      34567899999999999999999999999999999997
>1zo2_A NTF2, nuclear transport factor 2; structural genomics, structural genomics consortium, SGC, transport protein; 1.60A {Cryptosporidium parvum} SCOP: d.17.4.2 Back     alignment and structure
>1gy7_A Nuclear transport factor 2; protein transport; 1.6A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1gyb_A Back     alignment and structure
>3q90_A RAS GTPase-activating protein-binding protein 1; structural genomics, structural genomics consortium, SGC, NT (A+B proteins); 1.70A {Homo sapiens} SCOP: d.17.4.0 Back     alignment and structure
>3ujm_A Rasputin; NTF2-like fold, RAS signaling, signaling protein; HET: EPE; 2.74A {Drosophila melanogaster} Back     alignment and structure
>2qiy_A UBP3-associated protein BRE5; deubiquitylation, ubiquitin-specific processing proteases(UB NTF2, protein-protein recognition; 1.69A {Saccharomyces cerevisiae} SCOP: d.17.4.2 PDB: 1zx2_A Back     alignment and structure
>3nv0_B NTF2-related export protein; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1jkg_A P15; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_A Back     alignment and structure
>1jkg_B TAP; NTF2-like domain, transport protein; 1.90A {Homo sapiens} SCOP: d.17.4.2 PDB: 1jn5_B 1go5_A Back     alignment and structure
>1of5_A MRNA export factor MEX67; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>1q40_B MEX67, mRNA export factor MEX67; NTF2-fold, nuclear export, translation; 1.95A {Candida albicans} SCOP: d.17.4.2 Back     alignment and structure
>3nv0_A Nuclear RNA export factor 2; NTF2-like domain, beta sheet heterodimer interface, nucleopo binding pocket, water mediated interface; 1.84A {Caenorhabditis elegans} Back     alignment and structure
>1q42_A MTR2, mRNA transport regulator MTR2; NTF2-fold, nuclear export, translation; 1.75A {Candida albicans} SCOP: d.17.4.2 PDB: 1q40_A Back     alignment and structure
>1of5_B MTR2, YKL186C, mRNA transport regulator MTR2; nuclear protein, repeat, leucine- rich repeat, nuclear transport; 2.8A {Saccharomyces cerevisiae} SCOP: d.17.4.2 Back     alignment and structure
>3d9r_A Ketosteroid isomerase-like protein; YP_049581.1, structural joint center for structural genomics, JCSG, protein structu initiative; HET: MSE; 2.40A {Pectobacterium atrosepticum} SCOP: d.17.4.27 Back     alignment and structure
>4i4k_A Uncharacterized protein SGCJ; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: CIT PG4 1PE; 1.70A {Streptomyces globisporus} Back     alignment and structure
>3rob_A Uncharacterized conserved protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics; 1.48A {Planctomyces limnophilus} Back     alignment and structure
>3gzr_A Uncharacterized protein with A NTF2-like fold; structural genomics, joint center for struct genomics, JCSG, protein structure initiative; HET: MSE GOL; 1.40A {Caulobacter vibrioides} Back     alignment and structure
>3hx8_A MLR2180 protein, putative ketosteroid isomerase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE UNL PG4; 1.45A {Mesorhizobium loti} Back     alignment and structure
>3cu3_A Domain of unknown function with A cystatin-like F; structural genomics, joint center for structural genomics, J protein structure initiative; 2.00A {Nostoc punctiforme} SCOP: d.17.4.28 Back     alignment and structure
>3er7_A Uncharacterized NTF2-like protein; YP_001812677.1, NTF2-like protein of unknown function, struc genomics; HET: MSE; 1.50A {Exiguobacterium sibiricum 255-15} SCOP: d.17.4.24 Back     alignment and structure
>3f7s_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; 2.11A {Pseudomonas putida KT2440} Back     alignment and structure
>3gwr_A Putative calcium/calmodulin-dependent protein KIN II association domain; YP_315894.1; HET: MSE PG4; 2.01A {Thiobacillus denitrificans atcc 25259} Back     alignment and structure
>3h51_A Putative calcium/calmodulin dependent protein KIN association domain; NP_636218.1; HET: MSE PG4; 1.70A {Xanthomonas campestris PV} Back     alignment and structure
>3h3h_A Uncharacterized snoal-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE UNL MES; 1.60A {Burkholderia thailandensis E264} Back     alignment and structure
>2rcd_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.32A {Pectobacterium atrosepticum SCRI1043} SCOP: d.17.4.18 Back     alignment and structure
>2gxf_A Hypothetical protein YYBH; alpha-beta protein., structural genomics, PSI, protein structure initiative; HET: MES; 3.10A {Bacillus subtilis} SCOP: d.17.4.22 Back     alignment and structure
>3dmc_A NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2, unknow function; 1.65A {Anabaena variabilis atcc 29413} SCOP: d.17.4.10 Back     alignment and structure
>3bb9_A Putative orphan protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.80A {Shewanella frigidimarina} SCOP: d.17.4.16 Back     alignment and structure
>1oh0_A Steroid delta-isomerase; ketosteroid isomerase, KSI, equilenin, PI, LBHB; HET: EQU; 1.1A {Pseudomonas putida} SCOP: d.17.4.3 PDB: 1e3v_A* 1opy_A 1dmq_A 1dmm_A 1ea2_A 3cpo_A 1e3r_A* 1ogx_A 2inx_A 2pzv_A 1c7h_A 1dmn_A 1k41_A 1oho_A* 3fzw_A* 1cqs_A* 1w00_A 1e97_A 1w6y_A* 3ipt_A* ... Back     alignment and structure
>3b7c_A Uncharacterized protein; NTF-2 like protein, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.70A {Shewanella oneidensis} SCOP: d.17.4.16 Back     alignment and structure
>1s5a_A Hypothetical protein YESE; structural genomics, PSI, protein STRU initiative, midwest center for structural genomics, MCSG, U function; 1.70A {Bacillus subtilis} SCOP: d.17.4.10 Back     alignment and structure
>1z1s_A Hypothetical protein PA3332; beta barrel, conserved hypothetical protein, structural genomics, PSI, protein structure initiative; HET: PGE; 1.49A {Pseudomonas aeruginosa PAO1} SCOP: d.17.4.10 Back     alignment and structure
>3mso_A Steroid delta-isomerase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.57A {Pseudomonas aeruginosa} Back     alignment and structure
>1ohp_A Steroid delta-isomerase; inhibitor; HET: ESR; 1.53A {Pseudomonas testosteroni} SCOP: d.17.4.3 PDB: 1qjg_A* 8cho_A* 1ohs_A* 1ocv_A 1isk_A 3nuv_A* 1ogz_A* 3nhx_A* 3m8c_A* 3nxj_A* 3myt_A* 3mki_A 3mhe_A 1buq_A* 3nbr_A* 3t8u_A 3ov4_A* 3nm2_A Back     alignment and structure
>1nww_A Limonene-1,2-epoxide hydrolase; HET: MES; 1.20A {Rhodococcus erythropolis} SCOP: d.17.4.8 PDB: 1nu3_A* Back     alignment and structure
>3fh1_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>3i0y_A Putative polyketide cyclase; cystatin-like fold, structural genomics, joint center for ST genomics, JCSG, protein structure initiative; HET: MSE UNL; 1.50A {Xanthomonas campestris PV} Back     alignment and structure
>2chc_A Protein RV3472; hypothetical protein; 1.69A {Mycobacterium tuberculosis} SCOP: d.17.4.25 Back     alignment and structure
>3dm8_A Uncharacterized protein RPA4348; siras, putative isomerase, structural genomics, PSI-2, prote structure initiative; HET: CE9; 1.80A {Rhodopseudomonas palustris} SCOP: d.17.4.20 Back     alignment and structure
>3en8_A Uncharacterized NTF-2 like protein; YP_553245.1, NTF-2 like protein of unknown function, structu genomics; HET: MSE PG4; 1.85A {Burkholderia xenovorans LB400} SCOP: d.17.4.20 Back     alignment and structure
>3ec9_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.60A {Burkholderia thailandensis E264} SCOP: d.17.4.10 Back     alignment and structure
>4h3u_A Hypothetical protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.15A {Catenulispora acidiphila} Back     alignment and structure
>3f7x_A Putative polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL; 1.24A {Pseudomonas putida KT2440} Back     alignment and structure
>2owp_A Hypothetical protein BXE_B1374; cystatin-like fold, DUF3225 family protein, structural genom joint center for structural genomics, JCSG; 2.00A {Burkholderia xenovorans} SCOP: d.17.4.18 Back     alignment and structure
>2a15_A Hypothetical protein RV0760C; beta-alpha-barrel, structural genomics, PSI, protein structure initiative; 1.68A {Mycobacterium tuberculosis} SCOP: d.17.4.3 PDB: 2z76_A* 2z77_A* 2z7a_A Back     alignment and structure
>3b8l_A Uncharacterized protein; putative aromatic ring hydroxylase, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 1.75A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3cnx_A Uncharacterized protein; putative dehydratase, NTF2-like protein, structural genomics center for structural genomics, JCSG; HET: MSE PGE PG6; 2.10A {Streptomyces avermitilis} SCOP: d.17.4.17 Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>2ux0_A Calcium-calmodulin dependent protein kinase (CAM II gamma; transferase, oligomerisation DOM serine- threonine kinase, ATP-binding; 2.46A {Homo sapiens} SCOP: d.17.4.7 PDB: 2w2c_A 1hkx_A* Back     alignment and structure
>2rfr_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.16A {Novosphingobium aromaticivorans} SCOP: d.17.4.28 Back     alignment and structure
>3f40_A Uncharacterized NTF2-like protein; YP_677363.1, NTF2-like protein of unknown function, structural genomics; HET: MSE; 1.27A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ff2_A Uncharacterized cystatin fold protein (YP_497570. NTF2 superfamily; structural genomics; 1.90A {Novosphingobium aromaticivorans dsm 12ORGANISM_TAXID} Back     alignment and structure
>3duk_A NTF2-like protein of unknown function; structural genomics, joint center for STR genomics, JCSG, protein structure initiative; HET: MSE; 2.20A {Methylobacillus flagellatus KT} SCOP: d.17.4.0 Back     alignment and structure
>3jum_A Phenazine biosynthesis protein A/B; chirality, drug design, medicinal CH inhibitor, biosynthetic protein; HET: AOD; 1.45A {Burkholderia SP} PDB: 3b4o_A* 3b4p_A* 3dzl_A* 3ex9_A 3cnm_A* 3jun_A* 3juo_A* 3jup_A* 3juq_A* Back     alignment and structure
>3dxo_A Uncharacterized snoal-like protein; putative isomerase of the snoal-like family; HET: MSE PGE; 2.70A {Agrobacterium tumefaciens str} SCOP: d.17.4.19 Back     alignment and structure
>3ehc_A Snoal-like polyketide cyclase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.12A {Agrobacterium tumefaciens str} Back     alignment and structure
>2k54_A Protein ATU0742; protein of unknown function, structural genomics, PSI-2, Pro structure initiative; NMR {Agrobacterium tumefaciens str} SCOP: d.17.4.29 Back     alignment and structure
>3rga_A Epoxide hydrolase; NTF2-like, epoxide-opening cyclic ether formation, isomerase; HET: LSB ILD; 1.59A {Streptomyces lasaliensis} Back     alignment and structure
>3mg1_A OCP, orange carotenoid protein; carotenoid binding protein, echinone, phycobilisome; HET: ECH; 1.65A {Synechocystis SP} PDB: 3mg2_A* 3mg3_A* 1m98_A* Back     alignment and structure
>2bng_A MB2760; epoxide hydrolase, limonene, hydrolase, structural proteomics in europe, spine, structural genomics; 2.5A {Mycobacterium tuberculosis} SCOP: d.17.4.8 Back     alignment and structure
>3fgy_A Uncharacterized NTF2-like protein; structural genomics, joint center for STR genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.59A {Burkholderia xenovorans LB400} SCOP: d.17.4.0 Back     alignment and structure
>2gey_A ACLR protein; alpha+beta barrel, oxidoreductase; HET: PG4; 1.80A {Streptomyces galilaeus} SCOP: d.17.4.9 Back     alignment and structure
>3ebt_A Uncharacterized NTF2-like protein; structural genomics, joint center for structural genomics, J protein structure initiative; 1.30A {Burkholderia pseudomallei K96243} SCOP: d.17.4.9 Back     alignment and structure
>1tuh_A BAL32A, hypothetical protein EGC068; unknown function; 1.85A {Uncultured bacterium} SCOP: d.17.4.11 Back     alignment and structure
>3k0z_A Putative polyketide cyclase; structural genomics, joint CENT structural genomics, JCSG, protein structure initiative, PS lipoprotein; HET: NHE; 1.91A {Bacillus cereus} Back     alignment and structure
>3f14_A Uncharacterized NTF2-like protein; YP_680363.1, NTF2-like protein of unknown function, structur genomics; HET: MSE TRS PGE; 1.45A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2gex_A SNOL; alpha+beta barrel, oxidoreductase; 2.50A {Streptomyces nogalater} SCOP: d.17.4.9 Back     alignment and structure
>3g8z_A Protein of unknown function with cystatin-like FO; NP_639274.1, snoal-like polyketide cyclase; HET: MSE; 1.90A {Xanthomonas campestris PV} Back     alignment and structure
>3f8x_A Putative delta-5-3-ketosteroid isomerase; structural genomics, joint center for structural genomics; HET: MSE; 1.55A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 99
d1gy6a_125 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {R 8e-23
d1zo2a1117 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NT 5e-19
d1gy7a_121 d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {B 2e-18
d1jkga_139 d.17.4.2 (A:) NTF2-related export protein 1 (p15) 4e-12
d1of5b_165 d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker 2e-10
d2qiya1139 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {B 1e-08
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Rat (Rattus norvegicus) [TaxId: 10116]

 Score = 83.0 bits (205), Expect = 8e-23
 Identities = 37/124 (29%), Positives = 56/124 (45%), Gaps = 36/124 (29%)

Query: 7   PAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKF----- 61
           P +E IG  F+Q YY LFD+   R  L  +Y  + S +T+EG Q QG   I+EK      
Sbjct: 3   PIWEQIGSSFIQHYYQLFDN--DRTQLGAIYI-DASCLTWEGQQFQGKAAIVEKLSSLPF 59

Query: 62  ----------------------------NCDDDPPHAYSQIFVLKPLGASFYCQHDIFRL 93
                                         D+DP   + Q+F+LK +  ++ C +D+FRL
Sbjct: 60  QKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRL 119

Query: 94  GIHD 97
            +H+
Sbjct: 120 ALHN 123
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Length = 117 Back     information, alignment and structure
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 121 Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Length = 139 Back     information, alignment and structure
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 165 Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 139 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query99
d1gy6a_125 Nuclear transport factor-2 (NTF2) {Rat (Rattus nor 100.0
d1gy7a_121 Nuclear transport factor-2 (NTF2) {Baker's yeast ( 99.97
d1zo2a1117 Nuclear transport factor-2 (NTF2) {Cryptosporidium 99.97
d1jkga_139 NTF2-related export protein 1 (p15) {Human (Homo s 99.96
d2qiya1139 UBP3-associated protein BRE5 {Baker's yeast (Sacch 99.94
d1jkgb_186 NTF2-like domain of Tip associating protein, TAP { 99.03
d1of5b_165 mRNA transport regulator MTR2 {Baker's yeast (Sacc 98.97
d1q40b_ 205 NTF2-like domain of mRNA export factor MEX67 {Yeas 98.92
d1of5a_ 221 NTF2-like domain of mRNA export factor MEX67 {Bake 98.81
d2gxfa1128 Hypothetical protein YybH {Bacillus subtilis [TaxI 96.45
d3d9ra1132 Uncharacterized protein ECA1476 {Pectobacterium at 96.17
d3cu3a1162 Uncharacterized protein NpunR1993 {Nostoc punctifo 96.17
d3b7ca1121 Uncharacterized protein SO0125 {Shewanella oneiden 96.09
d3bb9a1121 Uncharacterized protein Sfri1973 {Shewanella frigi 95.68
d3en8a1127 Uncharacterized protein BxeB2092 {Burkholderia xen 95.66
d2rcda1127 Uncharacterized protein ECA3500 {Pectobacterium at 95.46
d3cnxa1153 Uncharacterized protein SAV4671 {Streptomyces aver 94.63
d1oh0a_125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 94.41
d1z1sa1129 Uncharacterized protein PA3332 {Pseudomonas aerugi 94.23
d2owpa1128 Hypothetical protein BxeB1374 {Burkholderia xenovo 94.23
d3dmca1133 Uncharacterized protein Ava2261 {Anabaena variabil 94.03
d2a15a1132 Hypothetical protein Rv0760c {Mycobacterium tuberc 93.94
d1ohpa1125 Delta-5-3-ketosteroid isomerase, steroid delta-iso 93.72
d2ux0a1135 Association domain of calcium/calmodulin-dependent 92.59
d2f86b1129 Association domain of calcium/calmodulin-dependent 92.53
d1m98a2142 Orange carotenoid protein, C-terminal domain {Cyan 91.94
d1s5aa_139 Hypothetical protein YesE {Bacillus subtilis [TaxI 91.75
d2rgqa1133 Uncharacterized protein NpunR3134 {Nostoc punctifo 90.82
d1nwwa_145 Limonene-1,2-epoxide hydrolase {Rhodococcus erythr 90.71
d2r4ia1122 Uncharacterized protein CHU142 {Cytophaga hutchins 89.19
d3dm8a1135 Uncharacterized protein Rpa4348 {Rhodopseudomonas 88.22
d3dxoa1117 Uncharacterized protein Atu0744 {Agrobacterium tum 86.85
d3b8la1144 Uncharacterized protein Saro3538 {Novosphingobium 86.4
d2gexa1138 Nogalamycin biosynthesis protein SnoL {Streptomyce 85.94
d2geya1144 Putative hydroxylase AclR {Streptomyces galilaeus 85.79
d2bnga1132 Uncharacterized protein Mb2760 {Mycobacterium tube 83.1
d2imja1155 Hypothetical protein PFL3262 {Pseudomonas fluoresc 80.22
>d1gy6a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cystatin-like
superfamily: NTF2-like
family: NTF2-like
domain: Nuclear transport factor-2 (NTF2)
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=4.2e-36  Score=202.71  Aligned_cols=91  Identities=41%  Similarity=0.824  Sum_probs=87.8

Q ss_pred             CccHHHHHHHHHHHHHHhccCCCChhhhhhhccCCCceeeEcCceeccHHHHHhhh------------------------
Q psy4124           6 NPAYEAIGKGFVQQYYALFDDPAQRPNLINMYNTETSFMTFEGIQLQGAVKIMEKF------------------------   61 (99)
Q Consensus         6 ~p~~~~ig~~FV~~YY~~~d~~~~r~~L~~~Y~~~~S~lt~eg~~~~G~~~I~~kl------------------------   61 (99)
                      +|++++||++||++||++|+  ++|+.|++||.++ |+|+|+|..++|+++|.++|                        
T Consensus         2 ~p~~e~ig~~Fv~~YY~~l~--~~r~~L~~~Y~~~-S~l~~~g~~~~G~~~I~~~l~~lp~~~~~~~i~~~D~Q~~~~~~   78 (125)
T d1gy6a_           2 KPIWEQIGSSFIQHYYQLFD--NDRTQLGAIYIDA-SCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSC   78 (125)
T ss_dssp             CCHHHHHHHHHHHHHHHHHH--HHGGGGGGGEEEE-EEEEETTEEEESHHHHHHHHHHCSCSCEEEEEEEEEEEECTTSC
T ss_pred             CCCHHHHHHHHHHHHHHHHh--CCHHHHHHHcCCC-cEEEECCccccCHHHHHHHHHcCCCcccEEEEeEEEEEEcCCCC
Confidence            79999999999999999999  9999999999999 99999999999999999999                        


Q ss_pred             ---------hcCCCCCeeEEEEEEEEeeCCEEEEEcceEeeecCCCC
Q psy4124          62 ---------NCDDDPPHAYSQIFVLKPLGASFYCQHDIFRLGIHDTA   99 (99)
Q Consensus        62 ---------~~d~~~~~~F~QtF~L~~~~~~y~v~NDifR~~~~n~~   99 (99)
                               +.+++++++|+|+|+|++++++|+|.||||||++||+|
T Consensus        79 ili~V~G~~~~~~~~~~~F~qtF~L~~~~~~y~I~NDiFR~v~~~~~  125 (125)
T d1gy6a_          79 IISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG  125 (125)
T ss_dssp             EEEEEEEEEEETTSCCEEEEEEEEEEEETTEEEEEEEEEEECCCCCC
T ss_pred             EEEEEEEEEEECCCCCcceEEEEEEeccCCEEEEEeeEEEEEeccCC
Confidence                     56778999999999999999999999999999999997
>d1gy7a_ d.17.4.2 (A:) Nuclear transport factor-2 (NTF2) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zo2a1 d.17.4.2 (A:10-126) Nuclear transport factor-2 (NTF2) {Cryptosporidium parvum [TaxId: 5807]} Back     information, alignment and structure
>d1jkga_ d.17.4.2 (A:) NTF2-related export protein 1 (p15) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2qiya1 d.17.4.2 (A:3-141) UBP3-associated protein BRE5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jkgb_ d.17.4.2 (B:) NTF2-like domain of Tip associating protein, TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1of5b_ d.17.4.2 (B:) mRNA transport regulator MTR2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q40b_ d.17.4.2 (B:) NTF2-like domain of mRNA export factor MEX67 {Yeast (Candida albicans) [TaxId: 5476]} Back     information, alignment and structure
>d1of5a_ d.17.4.2 (A:) NTF2-like domain of mRNA export factor MEX67 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gxfa1 d.17.4.22 (A:1-128) Hypothetical protein YybH {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3d9ra1 d.17.4.27 (A:3-134) Uncharacterized protein ECA1476 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3cu3a1 d.17.4.28 (A:9-170) Uncharacterized protein NpunR1993 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d3b7ca1 d.17.4.16 (A:1-121) Uncharacterized protein SO0125 {Shewanella oneidensis [TaxId: 70863]} Back     information, alignment and structure
>d3bb9a1 d.17.4.16 (A:27-147) Uncharacterized protein Sfri1973 {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d3en8a1 d.17.4.20 (A:1-127) Uncharacterized protein BxeB2092 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d2rcda1 d.17.4.18 (A:1-127) Uncharacterized protein ECA3500 {Pectobacterium atrosepticum [TaxId: 29471]} Back     information, alignment and structure
>d3cnxa1 d.17.4.17 (A:5-157) Uncharacterized protein SAV4671 {Streptomyces avermitilis [TaxId: 33903]} Back     information, alignment and structure
>d1oh0a_ d.17.4.3 (A:) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1z1sa1 d.17.4.10 (A:1-129) Uncharacterized protein PA3332 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2owpa1 d.17.4.18 (A:1-128) Hypothetical protein BxeB1374 {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d3dmca1 d.17.4.10 (A:1-133) Uncharacterized protein Ava2261 {Anabaena variabilis [TaxId: 1172]} Back     information, alignment and structure
>d2a15a1 d.17.4.3 (A:5-136) Hypothetical protein Rv0760c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ohpa1 d.17.4.3 (A:1-125) Delta-5-3-ketosteroid isomerase, steroid delta-isomerase, KSI {Comamonas testosteroni, also known as Pseudomonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2ux0a1 d.17.4.7 (A:387-521) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f86b1 d.17.4.7 (B:343-471) Association domain of calcium/calmodulin-dependent protein kinase type II alpha subunit, CAMK2A {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1m98a2 d.17.4.6 (A:176-317) Orange carotenoid protein, C-terminal domain {Cyanobacteria (Arthrospira maxima) [TaxId: 129910]} Back     information, alignment and structure
>d1s5aa_ d.17.4.10 (A:) Hypothetical protein YesE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rgqa1 d.17.4.25 (A:1-133) Uncharacterized protein NpunR3134 {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1nwwa_ d.17.4.8 (A:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d2r4ia1 d.17.4.15 (A:1-122) Uncharacterized protein CHU142 {Cytophaga hutchinsonii [TaxId: 985]} Back     information, alignment and structure
>d3dm8a1 d.17.4.20 (A:1-135) Uncharacterized protein Rpa4348 {Rhodopseudomonas palustris [TaxId: 1076]} Back     information, alignment and structure
>d3dxoa1 d.17.4.19 (A:1-117) Uncharacterized protein Atu0744 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d3b8la1 d.17.4.28 (A:1-144) Uncharacterized protein Saro3538 {Novosphingobium aromaticivorans [TaxId: 48935]} Back     information, alignment and structure
>d2gexa1 d.17.4.9 (A:2-139) Nogalamycin biosynthesis protein SnoL {Streptomyces nogalater [TaxId: 38314]} Back     information, alignment and structure
>d2geya1 d.17.4.9 (A:2-145) Putative hydroxylase AclR {Streptomyces galilaeus [TaxId: 33899]} Back     information, alignment and structure
>d2bnga1 d.17.4.8 (A:13-144) Uncharacterized protein Mb2760 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2imja1 d.17.4.23 (A:5-159) Hypothetical protein PFL3262 {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure