Diaphorina citri psyllid: psy4129

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----

MWRMVQRCQPSSIRLMDNAQFKFGQSLRPVPGYFGLLLDGLKRIYITKIKGFSVDEMCVTTLLFEGDPEDVKKNQAKIYSIALKFGGIPAGETNGMRGYMLTFVIAYIRDLALDYHILAESFETSVPWDKAILLCTNVKQRVARECKVMNVEHYLISCRVTQTYDAGCCIYFYFGYNFMGQKDPIGSYDYIEHCARDEIIACVMNVEHYLISCRVTQTYDAGCCIYFYFGYNFMGQKDPIGSYDYIEHCARDEIIACGGSISHHHGVGKLRSHWYPKQVSSVGVELYQSTKRQLDPKNVFANGGSISHHHGVGKLRSHWYPKQVSSVGVELYQSTKRQLDPKNIFANGNLLRSHL

ccHHHHHccccEEEECcHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccccEEEEEEEEccHHHHHHHHHHHHHHHHHcccCCccccccHHHHHHHHHHHHHHHHHHHccccEEcccccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccEEEEEcccccccccccccHHHHHHHHHHHHHHHHHccccEEEEEEEcEECcccccEEEEEEEcccccccccccHHHHHHHHHHHHHHccccEEECccccccccccccccccHHHHHHHHHHHHHccccHHcccccCECccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccc

*W*****CQPSSIRLMDNAQFKFGQSLRPVPGYFGLLLDGLKRIYITKIKGFSVDEMCVTTLLFEGDPEDVKKNQAKIYSIALKFGGIPAGETNGMRGYMLTFVIAYIRDLALDYHILAESFETSVPWDKAILLCTNVKQRVARECKVMNVEHYLISCRVTQTYDAGCCIYFYFGYNFMGQKDPIGSYDYIEHCARDEIIACVMNVEHYLISCRVTQTYDAGCCIYFYFGYNFMGQKDPIGSYDYIEHCARDEIIACGGSISHHHGVGKLRSHWYPKQVSSVGVELYQSTKRQLDPKNVFANGGSISHHHGVGKLRSHWYPKQVSSVGVELYQSTKRQLDPKNIFANGNLLRS**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Alkyldihydroxyacetonephosphate synthase, peroxisomal		confident	Q9EQR2
Alkyldihydroxyacetonephosphate synthase, peroxisomal		confident	P97275
Alkyldihydroxyacetonephosphate synthase, peroxisomal		confident	Q8C0I1

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0005778 [CC]	peroxisomal membrane	probable	GO:0005737, GO:0005575, GO:0031090, GO:0043227, GO:0016020, GO:0005777, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0042579, GO:0044444, GO:0044424, GO:0044464, GO:0044439, GO:0044438, GO:0031903, GO:0043226, GO:0044422, GO:0043231
GO:0005739 [CC]	mitochondrion	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0008609 [MF]	alkylglycerone-phosphate synthase activity	probable	GO:0016765, GO:0016740, GO:0003674, GO:0003824
GO:0071949 [MF]	FAD binding	probable	GO:0043168, GO:0050662, GO:0050660, GO:0097159, GO:0043167, GO:0036094, GO:0048037, GO:0005488, GO:0003674, GO:0000166, GO:1901363, GO:1901265
GO:0008611 [BP]	ether lipid biosynthetic process	probable	GO:1901576, GO:0006629, GO:0044238, GO:0097384, GO:0071704, GO:0018904, GO:0009987, GO:0044710, GO:0044237, GO:1901503, GO:0009058, GO:0008150, GO:0044281, GO:0008152, GO:0046485, GO:0044255, GO:0008610

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4BBY, chain A
Confidence level:very confident
Coverage over the Query: 4-36,51-180,236-306
View the alignment between query and template
View the model in PyMOL

Template: 2UUU, chain A
Confidence level:very confident
Coverage over the Query: 196-307,326-350
View the alignment between query and template
View the model in PyMOL