Diaphorina citri psyllid: psy4130


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310----
MSIKPEDIITSVITFLRKELLRDTLNAESKEGIEVAVECLCKAYDIPDNIDPASNVDIESLFQLYYKDEVLQWYSNINFSPTEEVKIEAEKYKNLGNTAMQQDKPEQAVIEYSKAIDCDNSNPVYYCNRAASNNKLKNYKLALRDCQIAIKIDPHYAKAYGRMGLAYTQMNDYKAALEAYTKAAELDPNDPLYANNMQAAMSNLNNSSSASGSGGVFPGLSEMSTKVLSDPSIQQVFGELFANPGQQATATDGSNTGIQALLNASQQIAAQLEQRNPELVEQIFQQFGPALNNFKSNVPRNPPGNGDGSSGSSQ
ccccHHHHHHHHHHHHHHHHHcccccHHHHHcHHHHHHHHHHHccccccccHHHcccHHHHHHcccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHccHHHHHHHHHHHHcccccHHcccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
*****EDIITSVITFLRKELLRDTLNAESKEGIEVAVECLCKAYDIPDNIDPASNVDIESLFQLYYKDEVL**********TEEVKIEAEKYKNLGNTAMQQDKPEQAVIEYSKAIDCDNSNPVYYCNRAASNNKLKNYKLALRDCQIAIKIDPHYAKAYGRMGLAYTQMNDYKAALEAYTKAAELDPNDPLYANNMQA**************************KVLSDPSIQQVFGEL**************************QI*AQLEQRNPELVEQIFQQF***************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIKPEDIITSVITFLRKELLRDTLNAESKEGIEVAVECLCKAYDIPDNIDPASNVDIESLFQLYYKDEVLQWYSNINFSPTEEVKIEAEKYKNLGNTAMQQDKPEQAVIEYSKAIDCDNSNPVYYCNRAASNNKLKNYKLALRDCQIAIKIDPHYAKAYGRMGLAYTQMNDYKAALEAYTKAAELDPNDPLYANNMQAAMSNLNNSSSASGSGGVFPGLSEMSTKVLSDPSIQQVFGELFANPGQQATATDGSNTGIQALxxxxxxxxxxxxxxxxxxxxxIFQQFGPALNNFKSNVPRNPPGNGDGSSGSSQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Small glutamine-rich tetratricopeptide repeat-containing protein beta Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.confidentQ80W98
Small glutamine-rich tetratricopeptide repeat-containing protein alpha Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.confidentO43765
Small glutamine-rich tetratricopeptide repeat-containing protein beta Co-chaperone that binds directly to HSC70 and HSP70 and regulates their ATPase activity.confidentQ8VD33

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006457 [BP]protein foldingprobableGO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0008022 [MF]protein C-terminus bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043231 [CC]intracellular membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0051087 [MF]chaperone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0030544 [MF]Hsp70 protein bindingprobableGO:0031072, GO:0003674, GO:0005488, GO:0005515

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2GW1, chain A
Confidence level:very confident
Coverage over the Query: 23-245
View the alignment between query and template
View the model in PyMOL
Template: 3Q7A, chain A
Confidence level:confident
Coverage over the Query: 84-278
View the alignment between query and template
View the model in PyMOL
Template: 4ASV, chain A
Confidence level:probable
Coverage over the Query: 1-55
View the alignment between query and template
View the model in PyMOL