Diaphorina citri psyllid: psy4132

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---

MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFWQKDITLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTVQNKSAQQTKLREIKTRTGIVGIERNIVEKQKETSSNINNAFKDLNQLMSMAKEMVEISKNISNKIINRQGEITEDDSNKDRDGKINFQEFCSIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVSQFSVKGDRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIEGLRFYENKFLLEEN

ccccccccccccccccEEEECccEEEccccccccccccEEEEEEcEEEEEcccccccccccHHHHHHHHHccccccccccEEEEcccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHccccccccccHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcccccccHHHHHHHHHHHcccccccEEEcccccccHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHccccccccccccCEEEccccccccc

MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFWQKDITLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTV***********EIKTRTGIVGIERNIV*************FKDLNQLMSMAKEMVEISK************ITEDDSNKDRDGKINFQEFCSIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVSQFSVKGDRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIEGLRFYENKFLLE**

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Calcineurin subunit B type 1	Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.	confident	Q63810
Calcineurin subunit B	Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.	confident	Q6FLU4
Calcineurin subunit B	Regulatory subunit of calcineurin, a calcium-dependent, calmodulin stimulated protein phosphatase. Confers calcium sensitivity.	confident	Q874T7

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0030431 [BP]	sleep	confident	GO:0032501, GO:0008150, GO:0044699, GO:0044707
GO:0051533 [BP]	positive regulation of NFAT protein import into nucleus	probable	GO:0033157, GO:0032388, GO:0060341, GO:0051049, GO:0032386, GO:0051222, GO:0051223, GO:0050789, GO:0032880, GO:0065007, GO:0048518, GO:0070201, GO:0051050, GO:0090316, GO:0050794, GO:0008150, GO:0042307, GO:0042306, GO:0032879, GO:0042993, GO:0042990, GO:1900180, GO:0051532, GO:0046824, GO:0046822
GO:0007126 [BP]	meiosis	probable	GO:0048610, GO:0051321, GO:0000003, GO:0009987, GO:0008150, GO:0022402, GO:0044699, GO:0044763, GO:0007049
GO:0045214 [BP]	sarcomere organization	probable	GO:0022607, GO:0031032, GO:0030154, GO:0048468, GO:0030036, GO:0010927, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0030029, GO:0030239, GO:0009987, GO:0044767, GO:0044763, GO:0070925, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0008150, GO:0042692
GO:0005829 [CC]	cytosol	probable	GO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0055120 [CC]	striated muscle dense body	probable	GO:0005737, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0030241 [BP]	skeletal muscle myosin thick filament assembly	probable	GO:0031034, GO:0031033, GO:0031032, GO:0070271, GO:0043933, GO:0034622, GO:0048468, GO:0030036, GO:0010927, GO:0022607, GO:0051146, GO:0061061, GO:0009653, GO:0044699, GO:0071822, GO:0048869, GO:0071688, GO:0016043, GO:0032989, GO:0065003, GO:0071840, GO:0048646, GO:0032502, GO:0055001, GO:0055002, GO:0014866, GO:0030029, GO:0030239, GO:0006461, GO:0044767, GO:0008150, GO:0070925, GO:0043623, GO:0006996, GO:0007010, GO:0048856, GO:0044085, GO:0030154, GO:0044763, GO:0009987, GO:0042692
GO:0005783 [CC]	endoplasmic reticulum	probable	GO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0019904 [MF]	protein domain specific binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0030017 [CC]	sarcomere	probable	GO:0005737, GO:0005575, GO:0043232, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0030016, GO:0044424, GO:0044444, GO:0043228, GO:0043292, GO:0043226, GO:0044422, GO:0044449
GO:0005955 [CC]	calcineurin complex	probable	GO:0043234, GO:0008287, GO:0032991, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044424
GO:0051531 [BP]	NFAT protein import into nucleus	probable	GO:0034504, GO:0051169, GO:0008104, GO:0051641, GO:0044699, GO:0070727, GO:0006886, GO:0006810, GO:0071702, GO:0042991, GO:0017038, GO:0034613, GO:0006606, GO:0006913, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0051170, GO:0051649, GO:0044744, GO:0051234, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0044763, GO:0033365, GO:0008150, GO:0009987
GO:0008021 [CC]	synaptic vesicle	probable	GO:0043227, GO:0005737, GO:0043231, GO:0016023, GO:0031410, GO:0044444, GO:0044464, GO:0031982, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044456, GO:0045202, GO:0044424, GO:0005622, GO:0030135, GO:0043226, GO:0030136
GO:0005509 [MF]	calcium ion binding	probable	GO:0043169, GO:0046872, GO:0003674, GO:0005488, GO:0043167
GO:0060487 [BP]	lung epithelial cell differentiation	probable	GO:0032502, GO:0030323, GO:0030324, GO:0030154, GO:0032501, GO:0007275, GO:0044699, GO:0048869, GO:0048513, GO:0030855, GO:0060541, GO:0009987, GO:0060428, GO:0060429, GO:0009888, GO:0044767, GO:0044763, GO:0048731, GO:0035295, GO:0044707, GO:0048856, GO:0060479, GO:0008150
GO:0001837 [BP]	epithelial to mesenchymal transition	probable	GO:0030154, GO:0048468, GO:0009653, GO:0007275, GO:0044699, GO:0014031, GO:0048864, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0008150, GO:0048513, GO:0071840, GO:0032502, GO:0048762, GO:0032501, GO:0009987, GO:0009888, GO:0044767, GO:0048863, GO:0044763, GO:0060485, GO:0000904, GO:0044707, GO:0048856, GO:0048731
GO:0001569 [BP]	patterning of blood vessels	probable	GO:0048754, GO:0072359, GO:0001763, GO:0009653, GO:0007275, GO:0044699, GO:0007389, GO:0001525, GO:0001568, GO:0001944, GO:0048514, GO:0048729, GO:0060562, GO:0048646, GO:0032502, GO:0032501, GO:0035239, GO:0061138, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0035295, GO:0044707, GO:0048856, GO:0072358, GO:0048731, GO:0002009
GO:0006915 [BP]	apoptotic process	probable	GO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0007321 [BP]	sperm displacement	probable	GO:0044703, GO:0032501, GO:0048609, GO:0032504, GO:0044706, GO:0007618, GO:0007620, GO:0022414, GO:0008150, GO:0051704, GO:0000003, GO:0007320, GO:0046692
GO:0005516 [MF]	calmodulin binding	probable	GO:0003674, GO:0005488, GO:0005515
GO:0008597 [MF]	calcium-dependent protein serine/threonine phosphatase regulator activity	probable	GO:0019888, GO:0019208, GO:0003674, GO:0030234
GO:0007269 [BP]	neurotransmitter secretion	probable	GO:0019226, GO:0035637, GO:0007268, GO:0032940, GO:0032501, GO:0023052, GO:0001505, GO:0044699, GO:0065007, GO:0065008, GO:0009987, GO:0050877, GO:0003008, GO:0006810, GO:0023061, GO:0044765, GO:0044763, GO:0003001, GO:0051649, GO:0007267, GO:0007154, GO:0051234, GO:0051179, GO:0051641, GO:0044700, GO:0046903, GO:0044707, GO:0008150, GO:0006836
GO:0007507 [BP]	heart development	probable	GO:0032502, GO:0048513, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0072359, GO:0072358, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0005977 [BP]	glycogen metabolic process	probable	GO:0044042, GO:0044238, GO:0044264, GO:0044262, GO:0015980, GO:0044260, GO:0005976, GO:0009987, GO:0044710, GO:0044237, GO:0043170, GO:0008152, GO:0071704, GO:0006112, GO:0008150, GO:0006073, GO:0005975, GO:0006091, GO:0055114
GO:0006470 [BP]	protein dephosphorylation	probable	GO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0016311, GO:0009987, GO:0043412, GO:0006464, GO:0043170, GO:0019538, GO:0006796, GO:0036211, GO:0008150, GO:0044237, GO:0008152, GO:0006793
GO:0016192 [BP]	vesicle-mediated transport	probable	GO:0006810, GO:0008150, GO:0051179, GO:0051234
GO:0006952 [BP]	defense response	probable	GO:0006950, GO:0008150, GO:0050896
GO:0004723 [MF]	calcium-dependent protein serine/threonine phosphatase activity	probable	GO:0016787, GO:0016791, GO:0004722, GO:0004721, GO:0042578, GO:0003824, GO:0003674, GO:0016788

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3LL8, chain B
Confidence level:very confident
Coverage over the Query: 236-339,360-400
View the alignment between query and template
View the model in PyMOL

Template: 1W7P, chain D
Confidence level:very confident
Coverage over the Query: 281-286,321-470
View the alignment between query and template
View the model in PyMOL