Psyllid ID: psy4132


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFWQKDITLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTVQNKSAQQTKLREIKTRTGIVGIERNIVEKQKETSSNINNAFKDLNQLMSMAKEMVEISKNISNKIINRQGEITEDDSNKDRDGKINFQEFCSIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVSQFSVKGDRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIEGLRFYENKFLLEEN
ccccccccccccccccEEEEEccEEEccccccccccccEEEEEEcEEEEEcccccccccccHHHHHHHHHccccccccccEEEEcccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHHccccccccccHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHccccccccHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHcccccccHHHHHHHHHHHcccccccEEEcccccccHHHccccccHHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHccccccccccccEEEEccccccccc
cccEEEEccccccccEEEEEcccEEEEcccccccccccEEEEEcEEEEEccccEEEEEcEEEEEEEcccccccccccccEEEEEEccccccccccccccccccEEEEEEcccccHHHHHHHHHHHHHcHHHccccccccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccccccEEHHHHHHHHHHHcHHHHcccHHHHHHHHHHHHccccccEEcHHHHcccHHHHccccHHHHHHHHcccccccEEHHHHHHHHHHHcccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccEEEcccccccEcHHHHHHHccHHHHHHHHHHHHHHccccEEEEEccccEEEEEEccccHHHHHHHHHHHHHHcccccHHHHHHHHccHHHHHHHHHHHHHHcccccccccccccEEcccHHccccc
mdrfeycsfelspdespvlkhsnvrlydgenksqfqrGELILTSHRLFWQKDITLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSkavpgknlgpsatsaYDYVKLSFREGIQNEFLDALKSTVDAKIWTVQNKSAQQTKLREIKTRTGIVGIERNIVEKQKETSSNINNAFKDLNQLMSMAKEMVEISKNISNKIINrqgeiteddsnkdrdgkinfQEFCSIVGNTDIHKKMVVDIRRLGKRfrkldldnsgalsidefmslpelqqnplvQRVIDIfdedrngevdfKEFIQGVSqfsvkgdresKLKFAFRIydidndddYYQALGNELIAALIEPltsaggtmllTDAYCRINRArglellspedLLNSClaldklpdspiylktyssgvkvlqlkscedasFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKlcrdqsieglRFYENKFLLEEN
mdrfeycsfelspdespvlkhSNVRLYDGENKSQFQRGELILTSHRLFWQKDITLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSkavpgknlgpSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTvqnksaqqtklreiktrtgivgiernivekqketssninNAFKDLNQLMSMAKEMVEISKNISnkiinrqgeiteddsnkdrdgKINFQEfcsivgntdihkkMVVDIRRLGKRFRKLDLDNSGALSIDEFmslpelqqnpLVQRVIDIFDEDRNGEVDFKEFIqgvsqfsvkgdreskLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAEThgklcrdqsieglRFYENKFLLEEN
MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFWQKDITLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTVQNKSAQQTKLREIKTRTGIVGIERNIVEKQKETSSNINNAFKDLNQLMSMAKEMVEisknisnkiinRQGEITEDDSNKDRDGKINFQEFCSIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVSQFSVKGDRESKLKFAFRiydidndddyyQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIEGLRFYENKFLLEEN
*************************LY******QFQRGELILTSHRLFWQKDITLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTVQNKSAQQTKLREIKTRTGIVGIERNIV********************************************************KINFQEFCSIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVSQFSVKGDRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIEGLRFYENKFLL***
MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFWQKDITLCLALSYIQNA*************************************DYVKLSFREGIQNEFLDALKSTVDAKIWT*****************************************FKDLNQLMSMAKEMVEISK************ITEDDSNKDRDGKINFQEFCSIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVSQFSV**DRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVS*NVF*TVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIEGLRFYENKFLLE**
MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFWQKDITLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTVQ********LREIKTRTGIVGIERNIVEKQKETSSNINNAFKDLNQLMSMAKEMVEISKNISNKIINRQGEITEDDSNKDRDGKINFQEFCSIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVSQFSVKGDRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIEGLRFYENKFLLEEN
*DRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFWQKDITLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTV***********EIKTRTGIVGIERNIVEKQKETSSNINNAFKDLNQLMSMAKEMVEISKNISNKIINRQGEITEDDSNKDRDGKINFQEFCSIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVSQFSVKGDRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIEGLRFYENKFLLE**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFWQKDITLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTVQNKSAQQTKLREIKTRTGIVGIERNIVEKQKETSSNINNAFKDLNQLMSMAKEMVEISKNISNKIINRQGEITEDDSNKDRDGKINFQEFCSIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVSQFSVKGDRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIEGLRFYENKFLLEEN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query473 2.2.26 [Sep-21-2011]
Q6DDF4388 Vacuolar protein-sorting- N/A N/A 0.431 0.525 0.429 2e-40
Q9VU87399 Vacuolar protein-sorting- yes N/A 0.441 0.523 0.391 5e-40
Q24214170 Calcineurin subunit B typ no N/A 0.181 0.505 0.906 4e-39
P48451170 Calcineurin subunit B typ no N/A 0.181 0.505 0.906 7e-39
P0C0A2386 Vacuolar protein-sorting- yes N/A 0.437 0.536 0.435 2e-37
Q86VN1386 Vacuolar protein-sorting- yes N/A 0.429 0.525 0.422 3e-37
A5PK00386 Vacuolar protein-sorting- yes N/A 0.429 0.525 0.418 9e-37
P63100170 Calcineurin subunit B typ no N/A 0.181 0.505 0.837 1e-36
Q63810170 Calcineurin subunit B typ yes N/A 0.181 0.505 0.837 1e-36
P63098170 Calcineurin subunit B typ no N/A 0.181 0.505 0.837 1e-36
>sp|Q6DDF4|VPS36_XENLA Vacuolar protein-sorting-associated protein 36 OS=Xenopus laevis GN=vps36 PE=2 SV=1 Back     alignment and function desciption
 Score =  167 bits (422), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 95/221 (42%), Positives = 135/221 (61%), Gaps = 17/221 (7%)

Query: 1   MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFW--QKDITLCLA 58
           MDRF +C+  L  DE+ V++   VRL DGE K++F  G L+LT+HRL W  QK+   C+A
Sbjct: 1   MDRFSWCTGLLDIDETLVIQQRGVRLSDGEEKTKFDSGTLLLTTHRLIWRDQKNHDFCIA 60

Query: 59  LSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFL 118
               Q    E ++   +    KI+++L  A P K  GP  TS Y YVKLSFRE  Q EF 
Sbjct: 61  FPLSQIVFTEEQA-GGIGKSAKIVVHLHPATPNKEPGPYQTSRYSYVKLSFREHGQIEFQ 119

Query: 119 DALKSTVDAKIW---------TVQ-NKSAQQTKLREIKTRTGIVGIERNIVEKQKETSSN 168
             L   +  + W         ++Q NK  Q  +++ +    GIVGIER + EK+KET  N
Sbjct: 120 RRLAEELTQRRWERLSASASPSMQMNKGPQTGRIKAV----GIVGIERKLEEKRKETDKN 175

Query: 169 INNAFKDLNQLMSMAKEMVEISKNISNKIINRQGEITEDDS 209
           I+ AF+DL++LM  AKEMVE+SK+I+ KI ++QG+I+ED++
Sbjct: 176 ISEAFEDLSKLMEKAKEMVELSKSIATKIKDKQGDISEDET 216




Component of the ESCRT-II complex (endosomal sorting complex required for transport II), which is required for multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex.
Xenopus laevis (taxid: 8355)
>sp|Q9VU87|VPS36_DROME Vacuolar protein-sorting-associated protein 36 OS=Drosophila melanogaster GN=Vps36 PE=2 SV=2 Back     alignment and function description
>sp|Q24214|CANB2_DROME Calcineurin subunit B type 2 OS=Drosophila melanogaster GN=CanB2 PE=1 SV=2 Back     alignment and function description
>sp|P48451|CANB1_DROME Calcineurin subunit B type 1 OS=Drosophila melanogaster GN=CanB PE=2 SV=1 Back     alignment and function description
>sp|P0C0A2|VPS36_RAT Vacuolar protein-sorting-associated protein 36 OS=Rattus norvegicus GN=Vps36 PE=1 SV=1 Back     alignment and function description
>sp|Q86VN1|VPS36_HUMAN Vacuolar protein-sorting-associated protein 36 OS=Homo sapiens GN=VPS36 PE=1 SV=1 Back     alignment and function description
>sp|A5PK00|VPS36_BOVIN Vacuolar protein-sorting-associated protein 36 OS=Bos taurus GN=VPS36 PE=2 SV=1 Back     alignment and function description
>sp|P63100|CANB1_RAT Calcineurin subunit B type 1 OS=Rattus norvegicus GN=Ppp3r1 PE=1 SV=2 Back     alignment and function description
>sp|Q63810|CANB1_MOUSE Calcineurin subunit B type 1 OS=Mus musculus GN=Ppp3r1 PE=1 SV=3 Back     alignment and function description
>sp|P63098|CANB1_HUMAN Calcineurin subunit B type 1 OS=Homo sapiens GN=PPP3R1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
357622824400 hypothetical protein KGM_19930 [Danaus p 0.824 0.975 0.315 8e-58
125977740399 GA10514 [Drosophila pseudoobscura pseudo 0.822 0.974 0.319 2e-53
66559873402 PREDICTED: vacuolar protein-sorting-asso 0.835 0.982 0.314 1e-51
380014718402 PREDICTED: vacuolar protein-sorting-asso 0.835 0.982 0.312 2e-50
332026315402 Vacuolar protein-sorting-associated prot 0.826 0.972 0.311 7e-50
340710112402 PREDICTED: vacuolar protein-sorting-asso 0.832 0.980 0.302 4e-48
350413529402 PREDICTED: vacuolar protein-sorting-asso 0.826 0.972 0.300 1e-47
170033357391 conserved hypothetical protein [Culex qu 0.439 0.531 0.453 1e-43
307180441402 Vacuolar protein-sorting-associated prot 0.441 0.519 0.436 2e-43
383853409402 PREDICTED: vacuolar protein-sorting-asso 0.441 0.519 0.449 2e-42
>gi|357622824|gb|EHJ74203.1| hypothetical protein KGM_19930 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  231 bits (588), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 150/476 (31%), Positives = 234/476 (49%), Gaps = 86/476 (18%)

Query: 1   MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFWQKD-------I 53
           MDRFEY    L   E+ + +  NV++YDGE+K+QF  GE+ILT+HR+ W K        +
Sbjct: 1   MDRFEYIEARLFEGETYLKRDKNVKIYDGEDKTQFVDGEIILTTHRILWGKPGDIPKGLV 60

Query: 54  TLCLALSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGI 113
            L L L YI    EE+  +F L   ++IIL+L  A+PGK  GP+  S + ++K SF++GI
Sbjct: 61  CLSLHLYYIFCVEEESGGVFGLGGPKRIILHLGPALPGKRPGPAVVSPFHFIKFSFKDGI 120

Query: 114 QNEFLDALKSTVDAKIWTVQNKSAQQTKLREIKTRTGIVGIERNIVEKQKETSSNINNAF 173
            + F  AL   V AK W ++  +        + + T +           K ++S IN+  
Sbjct: 121 DSVFYKALNDAVAAKAWQIETPNNSN-----LTSPTSVT---------PKTSTSPINS-- 164

Query: 174 KDLNQLMSMAKEMVEISKNISNKIINRQGEITEDDSNKDRDGKINFQEFCSIVGNTDIHK 233
                              I + I+  +  I E     D+   I FQ+   ++      K
Sbjct: 165 ------------------KIRSGIVGIERSIEEQHKATDQSISIAFQDLTKLMEKA---K 203

Query: 234 KMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKE 293
           +MV   + +  + R                           ++  DI ++D    V FK 
Sbjct: 204 EMVTISKTISSKIR---------------------------EKQGDISEDD---TVRFKS 233

Query: 294 FIQGVSQFSVKGDRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTD 353
           ++  +      G  +   + AFR     +D +YY  L +++   ++  L   GG M L D
Sbjct: 234 YLMSL------GIDDPVTRDAFR-----SDSEYYMGLSHQIADMIVAALVDCGGIMSLAD 282

Query: 354 AYCRINRARGLELLSPEDLLNSCLALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKT 413
            +CR+NRARGLEL+SPEDLLN+C  L  + D+P+ L+ + SG  VLQL S  D    + T
Sbjct: 283 VWCRVNRARGLELISPEDLLNACKLLQTI-DAPMSLRKFPSGACVLQLNSHRDEEVAKTT 341

Query: 414 YEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIEGLRFYENKFL 469
            E++  +  +T E+ S++A+VS+++A+ +L   E  G  CRD+SIEGL FY N FL
Sbjct: 342 SELLEASGLLTPEKLSQIANVSVLLAREQLFTTERMGLACRDESIEGLAFYPNLFL 397




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|125977740|ref|XP_001352903.1| GA10514 [Drosophila pseudoobscura pseudoobscura] gi|195171580|ref|XP_002026583.1| GL21669 [Drosophila persimilis] gi|54641654|gb|EAL30404.1| GA10514 [Drosophila pseudoobscura pseudoobscura] gi|194111499|gb|EDW33542.1| GL21669 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|66559873|ref|XP_395542.2| PREDICTED: vacuolar protein-sorting-associated protein 36 [Apis mellifera] Back     alignment and taxonomy information
>gi|380014718|ref|XP_003691367.1| PREDICTED: vacuolar protein-sorting-associated protein 36-like [Apis florea] Back     alignment and taxonomy information
>gi|332026315|gb|EGI66449.1| Vacuolar protein-sorting-associated protein 36 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|340710112|ref|XP_003393640.1| PREDICTED: vacuolar protein-sorting-associated protein 36-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350413529|ref|XP_003490018.1| PREDICTED: vacuolar protein-sorting-associated protein 36-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|170033357|ref|XP_001844544.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167874282|gb|EDS37665.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|307180441|gb|EFN68467.1| Vacuolar protein-sorting-associated protein 36 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383853409|ref|XP_003702215.1| PREDICTED: vacuolar protein-sorting-associated protein 36-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query473
UNIPROTKB|Q6DDF4388 vps36 "Vacuolar protein-sortin 0.437 0.533 0.422 1.8e-68
RGD|1309754386 Vps36 "vacuolar protein sortin 0.437 0.536 0.407 1.1e-66
UNIPROTKB|P0C0A2386 Vps36 "Vacuolar protein-sortin 0.437 0.536 0.407 1.1e-66
UNIPROTKB|Q86VN1386 VPS36 "Vacuolar protein-sortin 0.429 0.525 0.395 6.1e-66
UNIPROTKB|F1P5B8380 VPS36 "Uncharacterized protein 0.399 0.497 0.407 2e-65
UNIPROTKB|F1MT69386 VPS36 "Vacuolar protein-sortin 0.429 0.525 0.390 2e-65
UNIPROTKB|A5PK00386 VPS36 "Vacuolar protein-sortin 0.429 0.525 0.390 2.6e-65
UNIPROTKB|F1RMD6386 VPS36 "Uncharacterized protein 0.429 0.525 0.390 2.6e-65
MGI|MGI:1917410386 Vps36 "vacuolar protein sortin 0.437 0.536 0.393 4.2e-65
UNIPROTKB|E2QV84386 VPS36 "Uncharacterized protein 0.298 0.365 0.478 1.4e-64
UNIPROTKB|Q6DDF4 vps36 "Vacuolar protein-sorting-associated protein 36" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 378 (138.1 bits), Expect = 1.8e-68, Sum P(2) = 1.8e-68
 Identities = 92/218 (42%), Positives = 123/218 (56%)

Query:     1 MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFW--QKDITLCLA 58
             MDRF +C+  L  DE+ V++   VRL DGE K++F  G L+LT+HRL W  QK+   C+A
Sbjct:     1 MDRFSWCTGLLDIDETLVIQQRGVRLSDGEEKTKFDSGTLLLTTHRLIWRDQKNHDFCIA 60

Query:    59 LSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFL 118
                 Q    E ++   +    KI+++L  A P K  GP  TS Y YVKLSFRE  Q EF 
Sbjct:    61 FPLSQIVFTEEQAG-GIGKSAKIVVHLHPATPNKEPGPYQTSRYSYVKLSFREHGQIEFQ 119

Query:   119 DALKSTVDAKIWTVQNKSA----QQTK---LREIKTRTGIVGIERNIVEKQKETSSNINN 171
               L   +  + W   + SA    Q  K      IK   GIVGIER + EK+KET  NI+ 
Sbjct:   120 RRLAEELTQRRWERLSASASPSMQMNKGPQTGRIKA-VGIVGIERKLEEKRKETDKNISE 178

Query:   172 AFKDLNQLMSMAKEMVEXXXXXXXXXXXRQGEITEDDS 209
             AF+DL++LM  AKEMVE           +QG+I+ED++
Sbjct:   179 AFEDLSKLMEKAKEMVELSKSIATKIKDKQGDISEDET 216


GO:0005768 "endosome" evidence=ISS
RGD|1309754 Vps36 "vacuolar protein sorting 36 homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P0C0A2 Vps36 "Vacuolar protein-sorting-associated protein 36" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q86VN1 VPS36 "Vacuolar protein-sorting-associated protein 36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P5B8 VPS36 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MT69 VPS36 "Vacuolar protein-sorting-associated protein 36" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|A5PK00 VPS36 "Vacuolar protein-sorting-associated protein 36" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1RMD6 VPS36 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1917410 Vps36 "vacuolar protein sorting 36 (yeast)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2QV84 VPS36 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q63810CANB1_MOUSENo assigned EC number0.83720.18180.5058yesN/A
P25296CANB_YEASTNo assigned EC number0.54650.18180.4914yesN/A
Q24214CANB2_DROMENo assigned EC number0.90690.18180.5058noN/A
Q757B7CANB_ASHGONo assigned EC number0.55810.18180.4914yesN/A
Q6CGE6CANB_YARLINo assigned EC number0.56970.18180.4971yesN/A
Q6BWS8CANB_DEBHANo assigned EC number0.55810.18180.4942yesN/A
Q6FLU4CANB_CANGANo assigned EC number0.55810.18180.4914yesN/A
P48451CANB1_DROMENo assigned EC number0.90690.18180.5058noN/A
Q874T7CANB_KLULANo assigned EC number0.56320.18390.4971yesN/A
P0CM54CANB_CRYNJNo assigned EC number0.54650.18180.4914yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
cd13226128 cd13226, PH-like_Eap45_GLUE, Eap45 GLUE (GRAM-like 6e-39
pfam04157219 pfam04157, EAP30, EAP30/Vps36 family 2e-28
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 5e-14
pfam1160593 pfam11605, Vps36_ESCRT-II, Vacuolar protein sortin 3e-11
pfam04157219 pfam04157, EAP30, EAP30/Vps36 family 1e-10
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 2e-09
COG5126160 COG5126, FRQ1, Ca2+-binding protein (EF-Hand super 2e-06
PTZ00184149 PTZ00184, PTZ00184, calmodulin; Provisional 1e-05
cd13227126 cd13227, PH-like_Vps36_GLUE, Vps36 GLUE (GRAM-like 4e-05
pfam1349960 pfam13499, EF_hand_5, EF-hand domain pair 6e-05
cd0005163 cd00051, EFh, EF-hand, calcium binding motif; A di 0.004
>gnl|CDD|241380 cd13226, PH-like_Eap45_GLUE, Eap45 GLUE (GRAM-like ubiquitin-binding in Eap45) Pleckstrin homology-like domain Back     alignment and domain information
 Score =  137 bits (346), Expect = 6e-39
 Identities = 58/128 (45%), Positives = 80/128 (62%), Gaps = 5/128 (3%)

Query: 1   MDRFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFW--QKDITLCLA 58
           MDRF + +  L P+E+ V++   VR+YDG+ K+ F  GEL+LTSHRL W  QK+I  CL+
Sbjct: 1   MDRFMWTNGLLEPNETLVIQQRGVRIYDGDEKTNFDSGELVLTSHRLIWRDQKNIERCLS 60

Query: 59  LSYIQNA-VEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEF 117
           L   Q   +EE  + F  +A  KI+L+L  A P K  GP  +S Y Y+KLSF+EG Q+EF
Sbjct: 61  LPLSQIVFIEEEAAGFGKSA--KIVLHLHPAPPNKEPGPVQSSPYSYIKLSFKEGGQSEF 118

Query: 118 LDALKSTV 125
              L   +
Sbjct: 119 YRRLSEEL 126


ESCRT complexes form the main machinery driving protein sorting from endosomes to lysosomes. Human/yeast ESCRT-I consists of Tsg101/Vps23, Vps28/Vps28, and a Vps37 homolog/Vps37. Human/yeast ESCRT-II is composed of EAP20/Vps25, EAP30/Vps22, and EAP45/Vps36. Yeast ESCRT-III consists Vps2, Vps20, Vps24, and Snf7 subunits. In contrast, there are three Human paralogs of Snf7 (hSnf7-1/CHMP4A, hSnf7-2/CHMP4B, and hSnf7-3/CHMP4C) and two paralogs of Vps2 (CHMP2A and CHMP2B). Yeast ESCRT-I links directly to ESCRT-II, through a tight interaction of Vps28 (ESCRT-I) with the yeast-specific zinc-finger insertion within the GLUE domain of Vps36. The Vps36 subunit (ESCRT-II) binds ubiquitin using one of its two NZF zinc fingers in its N-terminal region. Human Vps36, EAP45, also binds ubiquitin despite having no NZF domain. Instead, mammalian ESCRT-II interacts with Ub through the Eap45 GLUE domain directly. While yeast Vps36 GLUE shows a preference for the singly phosphorylated PI(3)P, while Eap45 GLUE preferentially binds the triply phosphorylated phosphatidylinositol PI(3,4,5)P3. Structurally, Eap45 GLUE only has a PH-like fold since it lacks the secondary structure element corresponding to the 4 strand, unlike that of yeast Vps36 GLUE. ESCRT-II also interacts with ESCRT-III via a EAP20(Vps25)/CHMP6(Vps20) interaction. The interactions of ESCRT-II GLUE domain with membranes, ESCRT-I, and ubiquitin are critical for ubiquitinated cargo progression from early to late endosomes. PH domains have diverse functions, but in general are involved in targeting proteins to the appropriate cellular location or in the interaction with a binding partner. They share little sequence conservation, but all have a common fold, which is electrostatically polarized. Less than 10% of PH domains bind phosphoinositide phosphates (PIPs) with high affinity and specificity. PH domains are distinguished from other PIP-binding domains by their specific high-affinity binding to PIPs with two vicinal phosphate groups: PtdIns(3,4)P2, PtdIns(4,5)P2 or PtdIns(3,4,5)P3 which results in targeting some PH domain proteins to the plasma membrane. A few display strong specificity in lipid binding. Any specificity is usually determined by loop regions or insertions in the N-terminus of the domain, which are not conserved across all PH domains. PH domains are found in cellular signaling proteins such as serine/threonine kinase, tyrosine kinases, regulators of G-proteins, endocytotic GTPases, adaptors, as well as cytoskeletal associated molecules and in lipid associated enzymes. Length = 128

>gnl|CDD|217934 pfam04157, EAP30, EAP30/Vps36 family Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|221148 pfam11605, Vps36_ESCRT-II, Vacuolar protein sorting protein 36 Vps36 Back     alignment and domain information
>gnl|CDD|217934 pfam04157, EAP30, EAP30/Vps36 family Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>gnl|CDD|227455 COG5126, FRQ1, Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>gnl|CDD|185504 PTZ00184, PTZ00184, calmodulin; Provisional Back     alignment and domain information
>gnl|CDD|241381 cd13227, PH-like_Vps36_GLUE, Vps36 GLUE (GRAM-like ubiquitin-binding in Eap45) Pleckstrin homology-like domain Back     alignment and domain information
>gnl|CDD|222177 pfam13499, EF_hand_5, EF-hand domain pair Back     alignment and domain information
>gnl|CDD|238008 cd00051, EFh, EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 473
KOG2760|consensus432 100.0
PF1160589 Vps36_ESCRT-II: Vacuolar protein sorting protein 3 99.93
PF04157223 EAP30: EAP30/Vps36 family; InterPro: IPR007286 EAP 99.83
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.75
KOG0027|consensus151 99.65
KOG0027|consensus151 99.64
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 99.61
KOG3294|consensus261 99.58
KOG0034|consensus187 99.57
KOG0028|consensus172 99.56
PTZ00183158 centrin; Provisional 99.52
PTZ00184149 calmodulin; Provisional 99.49
KOG0028|consensus172 99.47
KOG0044|consensus193 99.46
KOG0031|consensus171 99.41
KOG0037|consensus221 99.33
KOG4223|consensus325 99.26
KOG0031|consensus171 99.24
KOG0036|consensus 463 99.19
KOG2643|consensus489 99.19
KOG0030|consensus152 99.18
KOG0037|consensus221 99.18
KOG0038|consensus189 99.15
PTZ00183158 centrin; Provisional 99.15
PTZ00184149 calmodulin; Provisional 99.1
KOG0377|consensus631 99.06
KOG0030|consensus152 98.96
KOG0751|consensus 694 98.91
KOG0044|consensus193 98.87
KOG4223|consensus325 98.79
KOG0036|consensus 463 98.75
KOG0034|consensus187 98.73
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.65
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.65
PLN02964 644 phosphatidylserine decarboxylase 98.47
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.47
KOG0038|consensus189 98.43
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.43
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 98.39
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 98.34
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 98.33
PLN02964 644 phosphatidylserine decarboxylase 98.33
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 98.29
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 98.29
cd0021388 S-100 S-100: S-100 domain, which represents the la 98.28
cd0502289 S-100A13 S-100A13: S-100A13 domain found in protei 98.24
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 98.23
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 98.22
cd0005267 EH Eps15 homology domain; found in proteins implic 98.21
KOG2562|consensus493 98.14
KOG4251|consensus362 98.14
cd0502693 S-100Z S-100Z: S-100Z domain found in proteins sim 98.02
cd0502788 S-100B S-100B: S-100B domain found in proteins sim 98.0
KOG2643|consensus489 97.99
KOG4251|consensus362 97.89
KOG4666|consensus412 97.88
cd0502592 S-100A1 S-100A1: S-100A1 domain found in proteins 97.85
KOG0041|consensus244 97.83
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.81
cd0503088 calgranulins Calgranulins: S-100 domain found in p 97.76
cd0005267 EH Eps15 homology domain; found in proteins implic 97.75
cd0502988 S-100A6 S-100A6: S-100A6 domain found in proteins 97.69
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.67
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 97.66
cd0502389 S-100A11 S-100A11: S-100A11 domain found in protei 97.63
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 97.59
cd0503194 S-100A10_like S-100A10_like: S-100A10 domain found 97.58
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 97.57
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 97.56
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.55
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 97.53
PF1465866 EF-hand_9: EF-hand domain 97.45
cd0021388 S-100 S-100: S-100 domain, which represents the la 97.43
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 97.31
KOG2760|consensus432 97.21
KOG0040|consensus2399 97.21
KOG2562|consensus493 97.21
PF1447096 bPH_3: Bacterial PH domain 97.18
PRK12309391 transaldolase/EF-hand domain-containing protein; P 97.06
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 97.03
KOG0040|consensus2399 97.02
cd0503088 calgranulins Calgranulins: S-100 domain found in p 96.97
KOG0377|consensus631 96.9
KOG0751|consensus 694 96.82
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.78
PF1465866 EF-hand_9: EF-hand domain 96.71
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.71
cd0502491 S-100A10 S-100A10: A subgroup of the S-100A10 doma 96.63
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 96.55
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 96.4
PF0289369 GRAM: GRAM domain; InterPro: IPR004182 The GRAM do 96.37
smart0056861 GRAM domain in glucosyltransferases, myotubularins 96.36
smart0055068 Zalpha Z-DNA-binding domain in adenosine deaminase 96.08
PF08000124 bPH_1: Bacterial PH domain; InterPro: IPR012544 Th 95.79
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 95.76
KOG0041|consensus244 95.61
PRK12309391 transaldolase/EF-hand domain-containing protein; P 95.26
KOG4666|consensus412 95.09
KOG3341|consensus249 94.75
PF0901269 FeoC: FeoC like transcriptional regulator; InterPr 94.73
PF0132560 Fe_dep_repress: Iron dependent repressor, N-termin 94.73
KOG0046|consensus 627 94.56
PF10349116 WWbp: WW-domain ligand protein; InterPro: IPR01882 94.51
PF0822057 HTH_DeoR: DeoR-like helix-turn-helix domain; Inter 94.5
PF0856779 TFIIH_BTF_p62_N: TFIIH p62 subunit, N-terminal dom 94.45
smart0068355 DM16 Repeats in sea squirt COS41.4, worm R01H10.6, 94.43
PF1341248 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 94.28
PF07289339 DUF1448: Protein of unknown function (DUF1448); In 94.1
PF0470362 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A. 94.01
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 93.65
PF12763104 EF-hand_4: Cytoskeletal-regulatory complex EF hand 93.6
PRK1543178 ferrous iron transport protein FeoC; Provisional 93.11
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 92.88
PF0172665 LexA_DNA_bind: LexA DNA binding domain; InterPro: 92.68
PF1478851 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QA 92.03
PF10591113 SPARC_Ca_bdg: Secreted protein acidic and rich in 91.97
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 91.72
KOG4065|consensus144 91.35
smart0042053 HTH_DEOR helix_turn_helix, Deoxyribose operon repr 91.31
KOG0169|consensus 746 90.92
PRK0933486 30S ribosomal protein S25e; Provisional 90.86
PF0933952 HTH_IclR: IclR helix-turn-helix domain; InterPro: 90.74
PF07289339 DUF1448: Protein of unknown function (DUF1448); In 90.36
KOG1029|consensus 1118 90.3
TIGR02787251 codY_Gpos GTP-sensing transcriptional pleiotropic 89.94
PF1280262 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP 89.88
PF06163127 DUF977: Bacterial protein of unknown function (DUF 89.45
smart0041866 HTH_ARSR helix_turn_helix, Arsenical Resistance Op 88.58
COG3355126 Predicted transcriptional regulator [Transcription 88.44
KOG3555|consensus434 88.38
COG4901107 Ribosomal protein S25 [Translation, ribosomal stru 88.22
PF0104759 MarR: MarR family; InterPro: IPR000835 The MarR-ty 87.65
PHA02943165 hypothetical protein; Provisional 87.49
PF0197868 TrmB: Sugar-specific transcriptional regulator Trm 86.96
PF1284061 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_ 86.93
smart0034691 HTH_ICLR helix_turn_helix isocitrate lyase regulat 86.66
PF03297105 Ribosomal_S25: S25 ribosomal protein; InterPro: IP 86.57
KOG4578|consensus421 86.46
PRK03902142 manganese transport transcriptional regulator; Pro 86.26
KOG0035|consensus890 85.71
PRK11169164 leucine-responsive transcriptional regulator; Prov 85.69
KOG0169|consensus 746 85.23
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 84.66
PRK10434 256 srlR DNA-bindng transcriptional repressor SrlR; Pr 84.09
COG2345 218 Predicted transcriptional regulator [Transcription 84.08
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an auto 84.01
KOG4065|consensus144 83.57
KOG0046|consensus 627 83.45
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 83.42
COG1349 253 GlpR Transcriptional regulators of sugar metabolis 83.25
PRK13509 251 transcriptional repressor UlaR; Provisional 82.89
PF0827955 HTH_11: HTH domain; InterPro: IPR013196 Winged hel 82.75
KOG1955|consensus 737 82.5
PRK10906 252 DNA-binding transcriptional repressor GlpR; Provis 82.31
PRK00082 339 hrcA heat-inducible transcription repressor; Provi 82.28
COG1522154 Lrp Transcriptional regulators [Transcription] 81.28
PRK11050152 manganese transport regulator MntR; Provisional 80.91
PF0910750 SelB-wing_3: Elongation factor SelB, winged helix 80.88
PRK06266178 transcription initiation factor E subunit alpha; V 80.65
PRK09802 269 DNA-binding transcriptional regulator AgaR; Provis 80.57
PF0927983 EF-hand_like: Phosphoinositide-specific phospholip 80.51
TIGR01884203 cas_HTH CRISPR locus-related DNA-binding protein. 80.11
>KOG2760|consensus Back     alignment and domain information
Probab=100.00  E-value=5e-63  Score=472.66  Aligned_cols=381  Identities=40%  Similarity=0.638  Sum_probs=329.9

Q ss_pred             CCcccccCCCCCCCCceEEeecceeeecCCCC-CcccCcEEEeeeeeeeee-------cCccccccchhhhhHHHhhhhc
Q psy4132           1 MDRFEYCSFELSPDESPVLKHSNVRLYDGENK-SQFQRGELILTSHRLFWQ-------KDITLCLALSYIQNAVEEAKSM   72 (473)
Q Consensus         1 ~~~~~~~~~~l~~~E~~~~~~~~v~ly~g~~~-~~~~~G~l~LTshRii~~-------~~~~~~l~l~~v~~~~~~~~~~   72 (473)
                      |+||-|..+.++++|..++...+|.+|||+.+ +.+.+|++.|||||+||.       ...+.++||+.|.+++.+..+=
T Consensus        29 ~~~fg~~~~~~~~ne~l~lt~~~I~~~D~~~k~~~~~dg~~vltt~Rliw~~p~~~~~~~~~~~~pls~vI~v~~~~~~~  108 (432)
T KOG2760|consen   29 MLRFGWSKILRSQNETLLLTSQRIIIYDGDKKTTKFDDGTLVLTTHRLIWRSPTSSADVEVTWVCPLSMVINVGEPAKSE  108 (432)
T ss_pred             chhcccchhhhccCceEEEeecceEEecCCCccccccchhhhhhhceeeecCcccccccceeeeeceeEEEEecCccchh
Confidence            88999999999999999999999999999998 999999999999999999       4567899999999999988871


Q ss_pred             ccccCcccEEEEeecCCCCCCCCCCCCCCCCeEEEeccCCCchHHHHHHHHHHhhhhhhhccccccccc----c------
Q psy4132          73 FNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTVQNKSAQQTK----L------  142 (473)
Q Consensus        73 ~~~~~s~ki~~~l~~~~~~~~~~p~~~~~~~~iklsFr~gg~~~F~~~l~~~l~~~~w~~~~~~~~~~~----~------  142 (473)
                      ....+++||+++++++++++.|||-.++...+|+||||++|..+||.++++...++.|++...|.+.+.    .      
T Consensus       109 ~~~g~~~~i~~~~~~~~~~~~~gp~~a~~~~~iqLsFR~~g~~~F~~~l~ee~~~r~we~~~~s~s~~~~r~s~~~~e~~  188 (432)
T KOG2760|consen  109 LTFGKINRIVVILHKPNPRFSPGPCPASTFAFIQLSFRGSGSVDFLEALLEEKNKRIWERNSVSESGVDMRKSSPSHEYE  188 (432)
T ss_pred             hcccccceEEEEeCCCCCcCCCCCcccceeeEEEEEecCCCcHHHHHHHHHHHHHHHHHhccccccccccccCccccccc
Confidence            113999999999999889999999999999999999999999999999999999999998765322110    0      


Q ss_pred             -c--cccccchHHHHHHHHHHHhHHHHHHHHHHHHhhhhhhhHHHHHHHHhhhhhhhhhhhhcccccccccCCCCCceeH
Q psy4132         143 -R--EIKTRTGIVGIERNIVEKQKETSSNINNAFKDLNQLMSMAKEMVEISKNISNKIINRQGEITEDDSNKDRDGKINF  219 (473)
Q Consensus       143 -~--~~~~~~gi~gi~r~~~~~~~~~~~~l~eaF~~lD~~~e~~~~l~~lg~~~~~~~~~~~~~~~~~~~D~d~dG~I~f  219 (473)
                       +  ...+++||+||+|+++++.+.+++.|.+||+|++++|.+|++|++|++++.+++...+..++.       |..+.|
T Consensus       189 ~~~~~t~r~vGI~giEr~~e~q~~~td~~i~~AFqDLskLMs~Akemv~Lsk~~~~Km~~~~g~i~d-------Detv~~  261 (432)
T KOG2760|consen  189 VPFIGTLRMVGISGIERSLEEQLKKTDKTINNAFQDLSKLMSLAKEMVSLSKSIAEKMKSKTGEIQD-------DETVRF  261 (432)
T ss_pred             ccccceeeeechhHHHHHHHHHHHhcchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcCCcCc-------hhhhhh
Confidence             1  235689999999999999999999999999999999999999999999999998877666654       234666


Q ss_pred             HHHHHHHccccccccchHHHHHHHHHHHhhCCCCCCCccHHHHhcchhccCCHHHHHHHHHhcCCCCCcccHHHHHHHHh
Q psy4132         220 QEFCSIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVS  299 (473)
Q Consensus       220 ~EF~~~~~~~~~~~~~~~~~~~l~~~F~~~D~d~~G~Is~~el~~l~~~~~~~~~~~l~~~~D~d~dG~I~~~EF~~~l~  299 (473)
                      .+++.-++-                    .                     ++                ++++.|--   
T Consensus       262 ks~llsLGI--------------------~---------------------dp----------------vt~~n~~~---  281 (432)
T KOG2760|consen  262 KSYLLSLGI--------------------L---------------------DP----------------VTKDNFGL---  281 (432)
T ss_pred             HHhhhhhcc--------------------C---------------------Cc----------------chhccccc---
Confidence            666655540                    0                     11                11111100   


Q ss_pred             hcccCCCcHHHHHHHhHHhcCCCCchhhHhhHHHHHHHHhchhhcCCCccchhHHHHHHHhhhCCCCCCHHHHHHHHHHh
Q psy4132         300 QFSVKGDRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLAL  379 (473)
Q Consensus       300 ~~~~~~~~~e~l~~~F~~~D~d~dg~~~~~e~~el~~~L~~~~~~~~g~i~l~d~~~~~~~~~g~~~ls~~ei~~~~~~~  379 (473)
                                            ....|..++.++|.+++...+...+|+|++.|+||.+||++|++++||+|+.++|+.+
T Consensus       282 ----------------------s~~~Y~~~Lakqlse~l~~~lee~ggmisLtdvY~~~NRaRG~eLiSPedl~~ACe~l  339 (432)
T KOG2760|consen  282 ----------------------SLSLYHQELAKQLSEFLRLPLEENGGMISLTDVYCRYNRARGTELISPEDLVNACELL  339 (432)
T ss_pred             ----------------------hHHHHHHHHHHHHHHHHhcchhhcCCEEEHHHHHHHHHHhccCCCCCHHHHHHHHHHH
Confidence                                  0013555566899999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCeeHHhhhccceeeeecccCcHHHHHHHHHHHhhCCCCCHHHHHHhhCCcHHHHHHHHHHHHHcCCccccCCcc
Q psy4132         380 DKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKHRLLLAETHGKLCRDQSIE  459 (473)
Q Consensus       380 D~~~dg~Is~~EF~~~~~vl~~~~~~~~~~~~~~~~~~~~~~~ls~~e~a~~~~~s~~~~~~~l~~~~~~g~l~~d~~~~  459 (473)
                      +.-+ -+|.+..|-+|++|+|.++++++..+-.+...+.+...+++.++|..++||+++|+|+|..||..|.||||+++|
T Consensus       340 e~l~-~pl~L~kf~SGvlvvqlKs~~~~e~l~~~l~~V~~~etl~a~e~A~~l~is~~lakErLl~AE~~G~lcRD~s~e  418 (432)
T KOG2760|consen  340 EHLG-VPLRLRKFNSGVLVVQLKSHSDEEKLVDALEDVSKSETLTASELAKKLGISLGLAKERLLNAEDEGLLCRDDSVE  418 (432)
T ss_pred             HhcC-CceEEEEcCCceEEEEeeccchHHHHHHHHHhccCcchhhHHHHHHHhCchHHHHHHHHHHHHhcCCeeeccCcc
Confidence            9874 499999999999999999999999888888888888899999999999999999999999999999999999999


Q ss_pred             cccccccccCcc
Q psy4132         460 GLRFYENKFLLE  471 (473)
Q Consensus       460 g~~~~~n~~~~~  471 (473)
                      |+|||||.|++.
T Consensus       419 GL~fY~N~f~e~  430 (432)
T KOG2760|consen  419 GLRFYPNLFMES  430 (432)
T ss_pred             ceeecccccccC
Confidence            999999999975



>PF11605 Vps36_ESCRT-II: Vacuolar protein sorting protein 36 Vps36; InterPro: IPR021648 Vps36 is a subunit of ESCRT-II, a protein involved in driving protein sorting from endosomes to lysosomes Back     alignment and domain information
>PF04157 EAP30: EAP30/Vps36 family; InterPro: IPR007286 EAP30 is a subunit of the ELL complex Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>KOG0027|consensus Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>KOG3294|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0028|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0031|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0037|consensus Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>PTZ00183 centrin; Provisional Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG0030|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>KOG0044|consensus Back     alignment and domain information
>KOG4223|consensus Back     alignment and domain information
>KOG0036|consensus Back     alignment and domain information
>KOG0034|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>KOG0038|consensus Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PLN02964 phosphatidylserine decarboxylase Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd05022 S-100A13 S-100A13: S-100A13 domain found in proteins similar to S100A13 Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>cd05026 S-100Z S-100Z: S-100Z domain found in proteins similar to S100Z Back     alignment and domain information
>cd05027 S-100B S-100B: S-100B domain found in proteins similar to S100B Back     alignment and domain information
>KOG2643|consensus Back     alignment and domain information
>KOG4251|consensus Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>cd05025 S-100A1 S-100A1: S-100A1 domain found in proteins similar to S100A1 Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>cd05029 S-100A6 S-100A6: S-100A6 domain found in proteins similar to S100A6 Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>cd05023 S-100A11 S-100A11: S-100A11 domain found in proteins similar to S100A11 Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>cd05031 S-100A10_like S-100A10_like: S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>cd00213 S-100 S-100: S-100 domain, which represents the largest family within the superfamily of proteins carrying the Ca-binding EF-hand motif Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>KOG2760|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG2562|consensus Back     alignment and domain information
>PF14470 bPH_3: Bacterial PH domain Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>cd05030 calgranulins Calgranulins: S-100 domain found in proteins belonging to the Calgranulin subgroup of the S100 family of EF-hand calcium-modulated proteins, including S100A8, S100A9, and S100A12 Back     alignment and domain information
>KOG0377|consensus Back     alignment and domain information
>KOG0751|consensus Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF14658 EF-hand_9: EF-hand domain Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd05024 S-100A10 S-100A10: A subgroup of the S-100A10 domain found in proteins similar to S100A10 Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>PF02893 GRAM: GRAM domain; InterPro: IPR004182 The GRAM domain is found in glucosyltransferases, myotubularins and other putative membrane-associated proteins Back     alignment and domain information
>smart00568 GRAM domain in glucosyltransferases, myotubularins and other putative membrane-associated proteins Back     alignment and domain information
>smart00550 Zalpha Z-DNA-binding domain in adenosine deaminases Back     alignment and domain information
>PF08000 bPH_1: Bacterial PH domain; InterPro: IPR012544 This family contains many bacterial hypothetical proteins Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>KOG0041|consensus Back     alignment and domain information
>PRK12309 transaldolase/EF-hand domain-containing protein; Provisional Back     alignment and domain information
>KOG4666|consensus Back     alignment and domain information
>KOG3341|consensus Back     alignment and domain information
>PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif Back     alignment and domain information
>PF01325 Fe_dep_repress: Iron dependent repressor, N-terminal DNA binding domain; InterPro: IPR022687 The DtxR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 65 residues present in metalloregulators of the DtxR/MntR family Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PF10349 WWbp: WW-domain ligand protein; InterPro: IPR018826 This entry represents a sequence domain found in WW domain-binding protein that is characterised by several short PY and PT-like motifs of the PPPPY form Back     alignment and domain information
>PF08220 HTH_DeoR: DeoR-like helix-turn-helix domain; InterPro: IPR001034 The deoR-type HTH domain is a DNA-binding, helix-turn-helix (HTH) domain of about 50-60 amino acids present in transcription regulators of the deoR family, involved in sugar catabolism Back     alignment and domain information
>PF08567 TFIIH_BTF_p62_N: TFIIH p62 subunit, N-terminal domain; InterPro: IPR013876 The N-terminal region of the TFIIH basal transcription factor complex p62 subunit (BTF2-p62) forms an interaction with the 3' endonuclease XPG, which is essential for activity Back     alignment and domain information
>smart00683 DM16 Repeats in sea squirt COS41 Back     alignment and domain information
>PF13412 HTH_24: Winged helix-turn-helix DNA-binding; PDB: 1I1G_B 2IA0_B 3I4P_A 2GQQ_A 2L4A_A 2CFX_B 2DBB_B 2EFO_A 2EFQ_A 2PN6_A Back     alignment and domain information
>PF07289 DUF1448: Protein of unknown function (DUF1448); InterPro: IPR006606 This entry represents the Bardet-Biedl syndrome 5 protein (BBL5) Back     alignment and domain information
>PF04703 FaeA: FaeA-like protein; PDB: 2JT1_A 2HTJ_A Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF12763 EF-hand_4: Cytoskeletal-regulatory complex EF hand; PDB: 2QPT_A 2KSP_A 2KFG_A 2JQ6_A 2KFH_A 2KFF_A 1IQ3_A 3FIA_A 2KHN_A 2KGR_A Back     alignment and domain information
>PRK15431 ferrous iron transport protein FeoC; Provisional Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>PF01726 LexA_DNA_bind: LexA DNA binding domain; InterPro: IPR006199 This is the DNA binding domain of the LexA SOS regulon repressor which prevents expression of DNA repair proteins in bacteria Back     alignment and domain information
>PF14788 EF-hand_10: EF hand; PDB: 1DJW_B 1DJI_B 1DJG_B 1QAS_B 2ISD_B 1DJZ_B 1DJY_B 1DJX_B 1QAT_A 1DJH_A Back     alignment and domain information
>PF10591 SPARC_Ca_bdg: Secreted protein acidic and rich in cysteine Ca binding region; InterPro: IPR019577 This entry represents the calcium-binding domain found in SPARC (Secreted Protein Acidic and Rich in Cysteine) and Testican (also known as SPOCK; or SParc/Osteonectin, Cwcv and Kazal-like domains) proteins Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>smart00420 HTH_DEOR helix_turn_helix, Deoxyribose operon repressor Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PRK09334 30S ribosomal protein S25e; Provisional Back     alignment and domain information
>PF09339 HTH_IclR: IclR helix-turn-helix domain; InterPro: IPR005471 The many bacterial transcription regulation proteins which bind DNA through a 'helix-turn-helix' motif can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>PF07289 DUF1448: Protein of unknown function (DUF1448); InterPro: IPR006606 This entry represents the Bardet-Biedl syndrome 5 protein (BBL5) Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>TIGR02787 codY_Gpos GTP-sensing transcriptional pleiotropic repressor CodY Back     alignment and domain information
>PF12802 MarR_2: MarR family; PDB: 3ECO_B 2QWW_B 3KP6_B 3KP4_B 3KP2_A 3KP5_A 3KP3_B 3KP7_A 3NQO_B 3K0L_B Back     alignment and domain information
>PF06163 DUF977: Bacterial protein of unknown function (DUF977); InterPro: IPR010382 This entry consists of several hypothetical bacterial proteins of unknown function Back     alignment and domain information
>smart00418 HTH_ARSR helix_turn_helix, Arsenical Resistance Operon Repressor Back     alignment and domain information
>COG3355 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>COG4901 Ribosomal protein S25 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01047 MarR: MarR family; InterPro: IPR000835 The MarR-type HTH domain is a DNA-binding, winged helix-turn-helix (wHTH) domain of about 135 amino acids present in transcription regulators of the MarR/SlyA family, involved in the development of antibiotic resistance Back     alignment and domain information
>PHA02943 hypothetical protein; Provisional Back     alignment and domain information
>PF01978 TrmB: Sugar-specific transcriptional regulator TrmB; InterPro: IPR002831 TrmB, is a protein of 38,800 apparent molecular weight, that is involved in the maltose-specific regulation of the trehalose/maltose ABC transport operon in Thermococcus litoralis Back     alignment and domain information
>PF12840 HTH_20: Helix-turn-helix domain; PDB: 1ULY_A 2CWE_A 1Y0U_B 2QUF_B 2QLZ_C 2OQG_B 2ZKZ_C 3PQK_A 3PQJ_D 3F6O_B Back     alignment and domain information
>smart00346 HTH_ICLR helix_turn_helix isocitrate lyase regulation Back     alignment and domain information
>PF03297 Ribosomal_S25: S25 ribosomal protein; InterPro: IPR004977 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>PRK03902 manganese transport transcriptional regulator; Provisional Back     alignment and domain information
>KOG0035|consensus Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>PRK10434 srlR DNA-bindng transcriptional repressor SrlR; Provisional Back     alignment and domain information
>COG2345 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>smart00344 HTH_ASNC helix_turn_helix ASNC type Back     alignment and domain information
>KOG4065|consensus Back     alignment and domain information
>KOG0046|consensus Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>COG1349 GlpR Transcriptional regulators of sugar metabolism [Transcription / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK13509 transcriptional repressor UlaR; Provisional Back     alignment and domain information
>PF08279 HTH_11: HTH domain; InterPro: IPR013196 Winged helix DNA-binding proteins share a related winged helix-turn-helix DNA-binding motif, where the "wings", or loops, are small beta-sheets Back     alignment and domain information
>KOG1955|consensus Back     alignment and domain information
>PRK10906 DNA-binding transcriptional repressor GlpR; Provisional Back     alignment and domain information
>PRK00082 hrcA heat-inducible transcription repressor; Provisional Back     alignment and domain information
>COG1522 Lrp Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK11050 manganese transport regulator MntR; Provisional Back     alignment and domain information
>PF09107 SelB-wing_3: Elongation factor SelB, winged helix ; InterPro: IPR015191 This entry represents a domain with a winged helix-type fold, which consists of a closed 3-helical bundle with a right-handed twist, and a small beta-sheet wing [] Back     alignment and domain information
>PRK06266 transcription initiation factor E subunit alpha; Validated Back     alignment and domain information
>PRK09802 DNA-binding transcriptional regulator AgaR; Provisional Back     alignment and domain information
>PF09279 EF-hand_like: Phosphoinositide-specific phospholipase C, efhand-like; InterPro: IPR015359 This domain is predominantly found in the enzyme phosphoinositol-specific phospholipase C Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
1mf8_B170 Crystal Structure Of Human Calcineurin Complexed Wi 2e-34
1tco_B169 Ternary Complex Of A Calcineurin A Fragment, Calcin 2e-34
2p6b_B156 Crystal Structure Of Human Calcineurin In Complex W 2e-34
3ll8_B155 Crystal Structure Of Calcineurin In Complex With Ak 2e-34
2zme_B238 Integrated Structural And Functional Model Of The H 1e-32
3cuq_B218 Integrated Structural And Functional Model Of The H 2e-32
2hth_B140 Structural Basis For Ubiquitin Recognition By The H 2e-17
2dx5_A139 The Complex Structure Between The Mouse Eap45-Glue 5e-16
2ct9_A208 The Crystal Structure Of Calcineurin B Homologous P 2e-06
2e30_A195 Solution Structure Of The Cytoplasmic Region Of Na+ 2e-06
3l19_A214 Crystal Structure Of Calcium Binding Domain Of Cpcd 4e-05
3lij_A494 Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) 5e-05
3i7c_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 1e-04
3ku2_A507 Crystal Structure Of Inactivated Form Of Cdpk1 From 2e-04
3hx4_A508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 2e-04
3i79_A484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 2e-04
3igo_A486 Crystal Structure Of Cryptosporidium Parvum Cdpk1, 5e-04
3hzt_A467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 6e-04
3khe_A191 Crystal Structure Of The Calcium-Loaded Calmodulin- 7e-04
>pdb|1MF8|B Chain B, Crystal Structure Of Human Calcineurin Complexed With Cyclosporin A And Human Cyclophilin Length = 170 Back     alignment and structure

Iteration: 1

Score = 143 bits (361), Expect = 2e-34, Method: Compositional matrix adjust. Identities = 67/79 (84%), Positives = 76/79 (96%) Query: 238 DIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQG 297 +I+RLGKRF+KLDLDNSG+LS++EFMSLPELQQNPLVQRVIDIFD D NGEVDFKEFI+G Sbjct: 19 EIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEVDFKEFIEG 78 Query: 298 VSQFSVKGDRESKLKFAFR 316 VSQFSVKGD+E KL+FAFR Sbjct: 79 VSQFSVKGDKEQKLRFAFR 97
>pdb|1TCO|B Chain B, Ternary Complex Of A Calcineurin A Fragment, Calcineurin B, Fkbp12 And The Immunosuppressant Drug Fk506 (tacrolimus) Length = 169 Back     alignment and structure
>pdb|2P6B|B Chain B, Crystal Structure Of Human Calcineurin In Complex With Pvivit Peptide Length = 156 Back     alignment and structure
>pdb|3LL8|B Chain B, Crystal Structure Of Calcineurin In Complex With Akap79 Peptide Length = 155 Back     alignment and structure
>pdb|2ZME|B Chain B, Integrated Structural And Functional Model Of The Human Escrt-Ii Complex Length = 238 Back     alignment and structure
>pdb|3CUQ|B Chain B, Integrated Structural And Functional Model Of The Human Escrt-Ii Complex Length = 218 Back     alignment and structure
>pdb|2HTH|B Chain B, Structural Basis For Ubiquitin Recognition By The Human Eap45ESCRT-Ii Glue Domain Length = 140 Back     alignment and structure
>pdb|2DX5|A Chain A, The Complex Structure Between The Mouse Eap45-Glue Domain And Ubiquitin Length = 139 Back     alignment and structure
>pdb|2CT9|A Chain A, The Crystal Structure Of Calcineurin B Homologous Proein 1 (Chp1) Length = 208 Back     alignment and structure
>pdb|2E30|A Chain A, Solution Structure Of The Cytoplasmic Region Of Na+H+ Exchanger 1 Complexed With Essential Cofactor Calcineurin B Homologous Protein 1 Length = 195 Back     alignment and structure
>pdb|3L19|A Chain A, Crystal Structure Of Calcium Binding Domain Of Cpcdpk3, Cgd5_820 Length = 214 Back     alignment and structure
>pdb|3LIJ|A Chain A, Crystal Structure Of Full Length Cpcdpk3 (Cgd5_820) In Complex With Ca2+ And Amppnp Length = 494 Back     alignment and structure
>pdb|3I7C|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) In Complex With Bumped Kinase Inhibitor Na-Pp2 Length = 484 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|3IGO|A Chain A, Crystal Structure Of Cryptosporidium Parvum Cdpk1, Cgd3_920 Length = 486 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|3KHE|A Chain A, Crystal Structure Of The Calcium-Loaded Calmodulin-Like Domain Of The Cdpk, 541.M00134 From Toxoplasma Gondii Length = 191 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query473
3cuq_B218 Vacuolar protein-sorting-associated protein 36; ES 2e-41
3cuq_B218 Vacuolar protein-sorting-associated protein 36; ES 3e-10
2hth_B140 Vacuolar protein sorting protein 36; GLUE domain, 2e-35
1w7p_D566 VPS36P, YLR417W; ESCRT-II complex, endosomal prote 4e-34
1w7p_D566 VPS36P, YLR417W; ESCRT-II complex, endosomal prote 9e-16
1w7p_D566 VPS36P, YLR417W; ESCRT-II complex, endosomal prote 5e-12
1u5t_B169 Defective in vacuolar protein sorting; VPS36P; ESC 4e-34
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 2e-32
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 4e-07
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 7e-07
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 2e-28
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 1e-07
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 2e-05
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 4e-28
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 1e-08
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 6e-05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 4e-27
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 4e-09
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 8e-26
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 8e-08
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 1e-25
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 2e-07
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 3e-25
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 2e-06
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 1e-22
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 8e-07
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 1e-21
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 1e-08
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 8e-21
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 1e-07
2cay_A145 VPS36 PH domain, vacuolar protein sorting protein 1e-20
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 7e-20
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 3e-07
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 5e-19
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 5e-07
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 6e-19
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 5e-07
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 5e-18
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 2e-06
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 7e-18
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 4e-06
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 2e-17
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 4e-06
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 3e-17
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 5e-07
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 1e-16
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 3e-05
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 2e-15
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 6e-07
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 2e-14
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-13
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 2e-07
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 3e-07
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 3e-13
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 2e-10
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 9e-07
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 5e-13
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 2e-08
1y1x_A191 Leishmania major homolog of programmed cell death 1e-12
1y1x_A191 Leishmania major homolog of programmed cell death 2e-08
1y1x_A191 Leishmania major homolog of programmed cell death 3e-06
1y1x_A191 Leishmania major homolog of programmed cell death 2e-04
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 1e-12
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 3e-07
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 2e-06
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-12
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 1e-05
2hps_A186 Coelenterazine-binding protein with bound coelent; 1e-12
2hps_A186 Coelenterazine-binding protein with bound coelent; 1e-11
2hps_A186 Coelenterazine-binding protein with bound coelent; 2e-06
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 3e-12
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 2e-09
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 4e-05
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 4e-12
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 2e-08
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 8e-12
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 1e-08
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 2e-11
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 3e-09
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 4e-11
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 5e-10
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 4e-11
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 3e-07
3lij_A494 Calcium/calmodulin dependent protein kinase with A 6e-11
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-09
3lij_A494 Calcium/calmodulin dependent protein kinase with A 1e-05
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 7e-11
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 2e-09
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 1e-06
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 8e-11
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 8e-07
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 8e-11
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 1e-07
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 9e-11
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 2e-09
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 1e-10
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 6e-10
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 5e-08
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 2e-10
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 6e-09
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-10
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-09
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 2e-05
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 2e-10
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 5e-09
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 4e-10
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 5e-09
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 5e-10
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 2e-08
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 6e-10
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 9e-07
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 6e-10
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 3e-09
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 2e-06
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 6e-10
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 4e-05
3fwb_A161 Cell division control protein 31; gene gating, com 9e-10
3fwb_A161 Cell division control protein 31; gene gating, com 9e-07
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 9e-10
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 1e-06
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 1e-09
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 7e-09
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 1e-09
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 8e-07
3akb_A166 Putative calcium binding protein; EF-hand, metal b 1e-09
3akb_A166 Putative calcium binding protein; EF-hand, metal b 4e-09
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 2e-09
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 1e-05
1exr_A148 Calmodulin; high resolution, disorder, metal trans 5e-09
1exr_A148 Calmodulin; high resolution, disorder, metal trans 5e-07
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 6e-09
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 1e-08
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 8e-09
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 2e-04
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 6e-04
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 9e-09
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 1e-08
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 6e-08
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 1e-08
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 6e-04
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 1e-08
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 1e-05
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 2e-08
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-08
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 2e-07
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 3e-08
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 8e-04
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 3e-08
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 4e-08
2jnf_A158 Troponin C; stretch activated muscle contraction, 4e-08
2jnf_A158 Troponin C; stretch activated muscle contraction, 2e-07
3li6_A66 Calcium-binding protein; calcium signaling protein 4e-08
3li6_A66 Calcium-binding protein; calcium signaling protein 6e-07
3li6_A66 Calcium-binding protein; calcium signaling protein 3e-04
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 6e-08
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 4e-05
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 6e-08
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 5e-04
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 6e-08
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 9e-05
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 7e-08
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 1e-07
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 8e-08
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 1e-07
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 2e-06
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 1e-07
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 1e-07
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 8e-04
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 1e-07
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 5e-06
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 1e-07
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 2e-05
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 1e-07
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-07
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 4e-07
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 2e-06
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 6e-05
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 2e-06
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 2e-06
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 3e-04
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 4e-06
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 5e-06
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 6e-06
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 8e-06
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 7e-06
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 4e-04
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 1e-05
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 1e-04
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 2e-05
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 2e-05
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 9e-05
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 3e-05
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 3e-05
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 3e-05
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 2e-04
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 5e-05
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 5e-04
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 6e-05
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 9e-05
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 4e-04
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 1e-04
1avs_A90 Troponin C; muscle contraction, calcium-activated, 1e-04
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 1e-04
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 2e-04
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 2e-04
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 2e-04
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 7e-04
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 3e-04
1c07_A95 Protein (epidermal growth factor receptor pathway 3e-04
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 6e-04
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 6e-04
3a4u_B143 Multiple coagulation factor deficiency protein 2; 6e-04
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 7e-04
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 7e-04
>3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B Length = 218 Back     alignment and structure
 Score =  146 bits (369), Expect = 2e-41
 Identities = 69/148 (46%), Positives = 97/148 (65%), Gaps = 1/148 (0%)

Query: 322 NDDDYYQALGNELIAALIEPLTSAGGTMLLTDAYCRINRARGLELLSPEDLLNSCLALDK 381
           +   Y+  L  +L   L  PL   GG M LT+ YC +NRARG+ELLSPEDL+N+C  L+ 
Sbjct: 69  SGTQYHMQLAKQLAGILQVPLEERGGIMSLTEVYCLVNRARGMELLSPEDLVNACKMLEA 128

Query: 382 LPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLASVSLVIAKH 441
           L   P+ L+ + SGV V++L+S ++   V    E VS+   +T E+F++L  +S+++AK 
Sbjct: 129 L-KLPLRLRVFDSGVMVIELQSHKEEEMVASALETVSEKGSLTSEEFAKLVGMSVLLAKE 187

Query: 442 RLLLAETHGKLCRDQSIEGLRFYENKFL 469
           RLLLAE  G LCRD S+EGLRFY N F+
Sbjct: 188 RLLLAEKMGHLCRDDSVEGLRFYPNLFM 215


>3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B Length = 218 Back     alignment and structure
>2hth_B Vacuolar protein sorting protein 36; GLUE domain, PH domain, viral budding, ubiquitin complex, protein transport; 2.70A {Homo sapiens} SCOP: b.55.1.12 PDB: 2dx5_A Length = 140 Back     alignment and structure
>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Length = 566 Back     alignment and structure
>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Length = 566 Back     alignment and structure
>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Length = 566 Back     alignment and structure
>1u5t_B Defective in vacuolar protein sorting; VPS36P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Length = 169 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Length = 155 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Length = 202 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Length = 208 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Length = 207 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Length = 226 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Length = 183 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Length = 214 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Length = 204 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Length = 211 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Length = 198 Back     alignment and structure
>2cay_A VPS36 PH domain, vacuolar protein sorting protein 36; transport, ESCRT-II, lipid-binding, multivesicular bodies, membrane; 1.9A {Saccharomyces cerevisiae} SCOP: b.55.1.12 Length = 145 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Length = 193 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Length = 190 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Length = 229 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Length = 183 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Length = 190 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Length = 207 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Length = 224 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Length = 190 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Length = 256 Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Length = 91 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Length = 263 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Length = 323 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Length = 204 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Length = 191 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Length = 272 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Length = 180 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Length = 186 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Length = 172 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Length = 134 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Length = 208 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Length = 197 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Length = 179 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Length = 191 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Length = 219 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Length = 450 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Length = 166 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Length = 174 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 188 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Length = 176 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Length = 191 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Length = 143 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Length = 220 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 1f54_A 1f55_A Length = 147 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} PDB: 2gv5_A 2doq_A 3fwc_A Length = 161 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Length = 169 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Length = 185 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Length = 166 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 142 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Length = 148 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Length = 191 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Length = 198 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Length = 105 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Length = 162 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Length = 135 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Length = 108 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Length = 109 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Length = 153 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Length = 108 Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Length = 173 Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Length = 108 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Length = 158 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Length = 66 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Length = 148 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Length = 110 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Length = 165 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Length = 195 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} PDB: 2kqy_A Length = 109 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Length = 161 Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Length = 87 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Length = 167 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Length = 109 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Length = 143 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Length = 166 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Length = 67 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Length = 151 Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Length = 81 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Length = 156 Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Length = 150 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Length = 196 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Length = 156 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Length = 146 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Length = 78 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Length = 140 Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Length = 147 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Length = 86 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Length = 149 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Length = 107 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Length = 145 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Length = 92 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Length = 90 Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Length = 863 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Length = 83 Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Length = 94 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Length = 900 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Length = 77 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Length = 95 Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Length = 92 Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Length = 714 Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Length = 143 Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Length = 71 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
1w7p_D566 VPS36P, YLR417W; ESCRT-II complex, endosomal prote 100.0
2hth_B140 Vacuolar protein sorting protein 36; GLUE domain, 100.0
2cay_A145 VPS36 PH domain, vacuolar protein sorting protein 99.96
3cuq_B218 Vacuolar protein-sorting-associated protein 36; ES 99.95
1u5t_B169 Defective in vacuolar protein sorting; VPS36P; ESC 99.87
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.82
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.79
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.77
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.75
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.74
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.73
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.72
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.72
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.7
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.69
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.68
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.68
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.68
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.67
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.67
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.67
3fwb_A161 Cell division control protein 31; gene gating, com 99.66
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.66
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.65
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 99.65
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.65
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.65
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.65
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.64
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.64
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.64
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.64
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 99.64
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 99.63
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.63
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.63
1y1x_A191 Leishmania major homolog of programmed cell death 99.63
3cuq_A234 Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nu 99.62
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 99.62
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.62
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 99.62
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.62
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.61
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.61
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.61
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.61
1qxp_A900 MU-like calpain; M-calpain, MU-calpain, catalytic 99.61
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 99.61
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.61
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 99.61
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.6
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.6
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.6
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.6
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.6
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.6
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.59
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.59
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.59
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.59
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 99.59
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.58
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.58
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.58
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 99.58
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.57
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.57
1y1x_A191 Leishmania major homolog of programmed cell death 99.57
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.57
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.57
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.57
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 99.57
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.56
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.56
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.56
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.56
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.56
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.56
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.55
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.55
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.54
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.54
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.54
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 99.54
1exr_A148 Calmodulin; high resolution, disorder, metal trans 99.53
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.53
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 99.52
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 99.52
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 99.51
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.51
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.5
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.5
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 99.5
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.5
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.5
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.49
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 99.49
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.48
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.48
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.48
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 99.48
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.48
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 99.47
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.46
1u5t_A233 Appears to BE functionally related to SNF7; SNF8P; 99.46
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.46
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 99.46
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.46
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.46
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 99.45
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.45
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 99.45
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.45
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 99.44
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 99.44
3fwb_A161 Cell division control protein 31; gene gating, com 99.43
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.43
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 99.42
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 99.42
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 99.41
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 99.41
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 99.41
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 99.4
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 99.4
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 99.4
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 99.4
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 99.4
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 99.39
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 99.39
2jnf_A158 Troponin C; stretch activated muscle contraction, 99.38
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.38
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.37
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 99.37
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 99.37
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 99.37
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 99.36
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 99.36
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 99.35
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 99.35
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 99.35
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 99.35
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 99.34
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 99.33
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 99.33
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 99.33
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 99.33
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.32
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 99.32
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 99.32
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 99.31
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.31
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 99.31
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 99.31
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 99.31
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.31
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.31
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 99.31
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 99.3
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 99.3
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 99.3
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 99.29
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 99.29
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 99.29
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.29
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 99.29
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.29
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.28
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 99.28
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.27
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 99.27
3akb_A166 Putative calcium binding protein; EF-hand, metal b 99.26
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.26
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 99.25
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 99.25
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 99.24
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 99.24
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.24
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 99.23
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.23
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.23
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 99.21
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 99.2
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 99.18
3a8r_A179 Putative uncharacterized protein; EF-hand, membran 99.17
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 99.17
2hps_A186 Coelenterazine-binding protein with bound coelent; 99.17
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 99.15
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 99.14
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 99.11
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 99.11
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 99.1
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 99.1
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 99.1
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 99.09
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 99.09
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 99.06
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.05
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 99.05
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 99.02
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 98.98
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.98
3a4u_B143 Multiple coagulation factor deficiency protein 2; 98.97
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.95
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 98.95
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.9
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 98.88
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.84
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 98.83
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.82
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.79
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 98.79
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.78
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.73
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.72
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.71
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.7
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.69
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.69
1eg3_A261 Dystrophin; EF-hand like domain, WW domain, struct 98.67
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 98.66
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.66
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.64
2zkm_X 799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.64
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 98.63
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.63
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.61
1c07_A95 Protein (epidermal growth factor receptor pathway 98.6
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.59
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.58
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.57
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.57
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.56
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.56
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 98.55
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.54
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.53
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.53
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 98.52
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.5
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.5
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.49
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 98.47
2lv7_A100 Calcium-binding protein 7; metal binding protein; 98.47
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.46
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.45
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 98.44
3li6_A66 Calcium-binding protein; calcium signaling protein 98.44
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 98.43
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.43
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.43
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.43
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 98.42
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 98.42
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 98.41
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.41
2jq6_A139 EH domain-containing protein 1; metal binding prot 98.41
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 98.4
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 98.39
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 98.38
3nso_A101 Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, meta 98.38
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 98.38
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.38
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 98.37
2kld_A123 Polycystin-2; PC2, PKD2, calcium binding domain, E 98.35
3n22_A98 Protein S100-A2; EF-hand, calcium-binding, zinc-bi 98.35
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 98.35
4eto_A93 Protein S100-A4; calcium-binding protein, EF-hand, 98.29
4drw_A121 Protein S100-A10/annexin A2 chimeric protein; atyp 98.28
3zwh_A104 Protein S100-A4; Ca-binding protein-motor protein 98.27
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 98.27
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 98.26
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 98.24
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 98.21
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 98.2
1c07_A95 Protein (epidermal growth factor receptor pathway 98.19
3li6_A66 Calcium-binding protein; calcium signaling protein 98.19
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 98.19
1qjt_A99 EH1, epidermal growth factor receptor substrate su 98.18
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 98.17
3ohm_B 885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 98.17
2lnk_A113 Protein S100-A4; EF-hand, calcium binding, all alp 98.17
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 98.16
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 98.16
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 98.15
1avs_A90 Troponin C; muscle contraction, calcium-activated, 98.14
2h2k_A106 Protein S100-A13; calcium binding protein, metal b 98.13
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 98.12
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 98.12
3nxa_A100 Protein S100-A16; S100 family, calcium binding pro 98.12
2y5i_A99 S100Z, S100 calcium binding protein Z; metal-bindi 98.11
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 98.09
2wcb_A95 Protein S100-A12; calcium signalling, HOST-parasit 98.09
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 98.09
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 98.08
1j55_A95 S-100P protein; metal binding protein; 2.00A {Homo 98.07
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 98.06
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 98.04
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 98.02
2kax_A92 Protein S100-A5; EF-hand, calcium binding protien, 98.01
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 97.99
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 97.99
2jq6_A139 EH domain-containing protein 1; metal binding prot 97.98
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 97.96
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 97.95
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.95
1eh2_A106 EPS15; calcium binding, signaling domain, NPF bind 97.94
1xk4_C113 Calgranulin B; S100 family, heterotetramer, metal 97.92
3qr0_A 816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.9
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 97.9
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 97.89
1psr_A100 Psoriasin, S100A7; EF-hand protein, MAD phasing, p 97.87
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 97.85
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 97.83
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 97.78
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 97.69
1h8b_A75 ACT-EF34, alpha-actinin 2, skeletal muscle isoform 97.64
1a4p_A96 S100A10; S100 family, EF-hand protein, ligand of a 97.62
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 97.39
1nub_A229 Basement membrane protein BM-40; extracellular mod 97.28
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 97.11
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 97.03
1zsq_A528 Myotubularin-related protein 2; protein-phospholip 96.97
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate 96.86
1tuz_A118 Diacylglycerol kinase alpha; transferase, HR532, n 96.77
3hsa_A126 Pleckstrin homology domain; YP_926556.1, structura 96.48
2jt1_A77 PEFI protein; solution structure, winged helix-tur 96.3
1xn7_A78 Hypothetical protein YHGG; alpha+beta, GFT structu 95.95
1pfj_A108 TFIIH basal transcription factor complex P62 subun 95.91
2k02_A87 Ferrous iron transport protein C; FEOC, iron-sulfu 95.63
1nub_A229 Basement membrane protein BM-40; extracellular mod 95.55
1zyi_A171 Methylosome subunit picln; PH domain, cell volume 95.54
2htj_A81 P fimbrial regulatory protein KS71A; winged helix- 94.69
1qbj_A81 Protein (double-stranded RNA specific adenosine D 94.66
1oyi_A82 Double-stranded RNA-binding protein; (alpha+beta) 94.23
1xmk_A79 Double-stranded RNA-specific adenosine deaminase; 94.17
1y5o_A115 TFB1, RNA polymerase II transcription factor B 73 94.13
1qgp_A77 Protein (double stranded RNA adenosine deaminase); 94.13
2yf0_A512 Myotubularin-related protein 6; hydrolase; 2.65A { 93.19
2fu4_A83 Ferric uptake regulation protein; DNA binding doma 92.33
3b73_A111 PHIH1 repressor-like protein; winged-helix-turn-he 91.36
3cuo_A99 Uncharacterized HTH-type transcriptional regulato; 89.54
3jth_A98 Transcription activator HLYU; transcription factor 89.04
1y0u_A96 Arsenical resistance operon repressor, putative; s 89.0
1p6r_A82 Penicillinase repressor; transcription regulation, 88.89
2qpt_A550 EH domain-containing protein-2; protein-nucleotide 88.73
3i4p_A162 Transcriptional regulator, ASNC family; PSI, struc 88.72
2heo_A67 Z-DNA binding protein 1; protein DLM1-Z-DNA comple 88.52
1wi9_A72 Protein C20ORF116 homolog; helix-turn-helix motif, 88.2
1u2w_A122 CADC repressor, cadmium efflux system accessory pr 88.01
1sfu_A75 34L protein; protein/Z-DNA complex, DNA binding pr 87.94
1on2_A142 Transcriptional regulator MNTR; helix-turn-helix, 87.39
3hrs_A 214 Metalloregulator SCAR; DTXR/MNTR family member, tr 87.33
2cfx_A144 HTH-type transcriptional regulator LRPC; transcrip 87.27
2p5v_A162 Transcriptional regulator, LRP/ASNC family; NMB057 87.26
3b77_A193 Uncharacterized protein; pleckstrin-homology domai 87.05
2dbb_A151 Putative HTH-type transcriptional regulator PH006; 86.58
2k4b_A99 Transcriptional regulator; DNA binding protein, wi 86.5
1i1g_A141 Transcriptional regulator LRPA; helix-turn-helix, 86.46
2w25_A150 Probable transcriptional regulatory protein; trans 86.43
2cg4_A152 Regulatory protein ASNC; DNA binding, FFRP, LRP fa 86.42
2pn6_A150 ST1022, 150AA long hypothetical transcriptional re 86.39
3i71_A68 Ethanolamine utilization protein EUTK; helix-turn- 86.35
2e1c_A171 Putative HTH-type transcriptional regulator PH151; 85.99
2cyy_A151 Putative HTH-type transcriptional regulator PH151; 85.85
2h09_A155 Transcriptional regulator MNTR; transcription regu 85.06
1r1u_A106 CZRA, repressor protein; zinc, DNA binding, transc 85.05
1sfx_A109 Conserved hypothetical protein AF2008; structural 85.02
2ia0_A171 Putative HTH-type transcriptional regulator PF086; 84.8
2x4h_A139 Hypothetical protein SSO2273; transcription; 2.30A 84.79
2kko_A108 Possible transcriptional regulatory protein (possi 84.74
2oqg_A114 Possible transcriptional regulator, ARSR family P; 84.53
3pqk_A102 Biofilm growth-associated repressor; helix-turn-he 83.96
3k2z_A 196 LEXA repressor; winged helix-turn-helix, SOS syste 83.89
3ech_A142 MEXR, multidrug resistance operon repressor; winge 83.17
3bpv_A138 Transcriptional regulator; MARR, DNA binding, tran 82.55
3g3z_A145 NMB1585, transcriptional regulator, MARR family; t 82.42
3bro_A141 Transcriptional regulator; helix_TURN_helix, multi 82.29
1r7j_A95 Conserved hypothetical protein SSO10A; winged heli 82.2
2fbh_A146 Transcriptional regulator PA3341; MARR, transcript 82.01
3tgn_A146 ADC operon repressor ADCR; helix-turn-helix, trans 81.59
2jsc_A118 Transcriptional regulator RV1994C/MT2050; cadmium, 81.14
3bj6_A152 Transcriptional regulator, MARR family; helix-turn 81.1
2pex_A153 Transcriptional regulator OHRR; transcription regu 81.03
2fa5_A162 Transcriptional regulator MARR/EMRR family; multip 80.98
3bdd_A142 Regulatory protein MARR; putative multiple antibio 80.88
3nrv_A148 Putative transcriptional regulator (MARR/EMRR FAM; 80.79
2rdp_A150 Putative transcriptional regulator MARR; PFAM PF01 80.7
1ku9_A152 Hypothetical protein MJ223; putative transcription 80.69
1r1t_A122 Transcriptional repressor SMTB; zinc, transcriptio 80.65
2d1h_A109 ST1889, 109AA long hypothetical transcriptional re 80.63
2hr3_A147 Probable transcriptional regulator; MCSG, structur 80.56
2a61_A145 Transcriptional regulator TM0710; APC4350, MCSG, m 80.49
2gxg_A146 146AA long hypothetical transcriptional regulator; 80.44
3cdh_A155 Transcriptional regulator, MARR family; helix-turn 80.22
2qww_A154 Transcriptional regulator, MARR family; YP_013417. 80.17
3f6o_A118 Probable transcriptional regulator, ARSR family pr 80.05
>1w7p_D VPS36P, YLR417W; ESCRT-II complex, endosomal protein sorting, protein transpo; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Back     alignment and structure
Probab=100.00  E-value=1.7e-60  Score=491.17  Aligned_cols=372  Identities=21%  Similarity=0.323  Sum_probs=130.8

Q ss_pred             CCccccc------CCCCCCCCceEEeecceeeecCCCC-CcccCcEEEeeeeeeeee-----cCccccccchhhhhHHHh
Q psy4132           1 MDRFEYC------SFELSPDESPVLKHSNVRLYDGENK-SQFQRGELILTSHRLFWQ-----KDITLCLALSYIQNAVEE   68 (473)
Q Consensus         1 ~~~~~~~------~~~l~~~E~~~~~~~~v~ly~g~~~-~~~~~G~l~LTshRii~~-----~~~~~~l~l~~v~~~~~~   68 (473)
                      |++|+|+      .|.|.++|++++++++||||+|+.| ++||+|+||||||||||+     ..+|++|||++|.++++.
T Consensus         1 m~~~~~~~~t~s~rp~L~~~E~~l~vqd~VgLY~Gk~Ki~~~q~G~~yLTShRiiyvD~~~p~~~s~~l~L~~I~~~e~~   80 (566)
T 1w7p_D            1 MEYWHYVETTSSGQPLLREGEKDIFIDQSVGLYHGKSKILQRQRGRIFLTSQRIIYIDDAKPTQNSLGLELDDLAYVNYS   80 (566)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCccccccccccCCcccCCCceEEEeecccccccCCcCCccccCceEEEEeeeEEEecCCCCcceEEEEEhHHcceeeee
Confidence            8999998      6889999999999999999999999 999999999999999999     348999999999999998


Q ss_pred             hhhcccccCcccEEEEeecCCCCC---------------------------CC---------------------------
Q psy4132          69 AKSMFNLTAGRKIILYLSKAVPGK---------------------------NL---------------------------   94 (473)
Q Consensus        69 ~~~~~~~~~s~ki~~~l~~~~~~~---------------------------~~---------------------------   94 (473)
                      + +|  ++|||||+|++++...++                           .|                           
T Consensus        81 a-gf--lksSpKI~L~l~~~~~~~~~~~~~~~~~~~~~~tWvC~ICsfsN~~~~~f~~~~~~~p~C~~CGi~p~~~~~k~  157 (566)
T 1w7p_D           81 S-GF--LTRSPRLILFFKDPSSKDELGKSAETASADVVSTWVCPICMVSNETQGEFTKDTLPTPICINCGVPADYELTKS  157 (566)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             e-cc--ccCCCceEEeecCcccccccCCCCCCcccccccceeccccccCCCCCCCCCcccCCCCcccccCCCCchhhhhh
Confidence            8 56  399999999998643111                           00                           


Q ss_pred             --------------------------------------------------------------------------------
Q psy4132          95 --------------------------------------------------------------------------------   94 (473)
Q Consensus        95 --------------------------------------------------------------------------------   94 (473)
                                                                                                      
T Consensus       158 ~i~~~~~~~~~~~~~~~~~~~~~~~CP~CTF~NHPsl~~CEiCg~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  237 (566)
T 1w7p_D          158 SINCSNAIDPNANPQNQFGVNSENICPACTFANHPQIGNCEICGHRLPNASKVRSKLNRLNFHDSRVHIELEKNSLARNK  237 (566)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             hhhccccCCCcccCccccccccCCCCCcccccCChhhhcccccCCcCCCccccccccccccccccccccccccccccccc
Confidence                                                                                            


Q ss_pred             --CCCC------CCCCCeEEEeccCCCchHHHHHHHHHHhhhhhhhccc-----cc--cc----c---c---------cc
Q psy4132          95 --GPSA------TSAYDYVKLSFREGIQNEFLDALKSTVDAKIWTVQNK-----SA--QQ----T---K---------LR  143 (473)
Q Consensus        95 --~p~~------~~~~~~iklsFr~gg~~~F~~~l~~~l~~~~w~~~~~-----~~--~~----~---~---------~~  143 (473)
                        +|..      .+...|||||||+||++.||++|+++|.+++|+..+.     +.  ++    +   .         ..
T Consensus       238 sp~p~~~s~~~~~~~~~~iKLSFR~gg~~~F~~~L~~aL~~~~W~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~  317 (566)
T 1w7p_D          238 SSHSALSSSSSTGSSTEFVQLSFRKSDGVLFSQATERALENILTEKNKHIFNQNVVSVNGVDMRKGASSHEYNNEVPFIE  317 (566)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             CCCcccccccCCCccCceEEEEEcCCCchHHHHHHHHHHHHHHhhhCCCccCCCcccccccccccccccccccccccccc
Confidence              1100      0124699999999999999999999999999985332     00  00    0   0         11


Q ss_pred             cccccchHHHHHHHHHHHhHHHHHHHHHHHHhhhhhhhHHHHHHHHhhhhhhhhhhhhcccccccccCCCCCceeHHHHH
Q psy4132         144 EIKTRTGIVGIERNIVEKQKETSSNINNAFKDLNQLMSMAKEMVEISKNISNKIINRQGEITEDDSNKDRDGKINFQEFC  223 (473)
Q Consensus       144 ~~~~~~gi~gi~r~~~~~~~~~~~~l~eaF~~lD~~~e~~~~l~~lg~~~~~~~~~~~~~~~~~~~D~d~dG~I~f~EF~  223 (473)
                      ...+++||+||+|+.++++++++..+.+||+||+++|..+++|++|++.+..++++....++....   .+-..   ++.
T Consensus       318 ~~~~~~GI~gler~~e~~~~~~~~~i~~Af~DL~~LM~~AkemV~La~~~~~~~~~~~~~~s~~~~---~~e~~---~~~  391 (566)
T 1w7p_D          318 TKLSRIGISSLEKSRENQLLNNDILFNNALTDLNKLMSLATSIERLYKNSNITMKTKTLNLQDEST---VNEPK---TRR  391 (566)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             ccCcccCcHHHHHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhhcccCCCCCcc---chhhH---hhH
Confidence            234789999999999999999999999999999999999999999999998885444333221100   00000   110


Q ss_pred             HHHccccccccchHHHHHHHHHHHhhCCCCCCCccHHHHhcchhccCCHHHHHHHHHhcCCCCCcccHHHHHHHHhhccc
Q psy4132         224 SIVGNTDIHKKMVVDIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVIDIFDEDRNGEVDFKEFIQGVSQFSV  303 (473)
Q Consensus       224 ~~~~~~~~~~~~~~~~~~l~~~F~~~D~d~~G~Is~~el~~l~~~~~~~~~~~l~~~~D~d~dG~I~~~EF~~~l~~~~~  303 (473)
                      ..                                                   |  ..+.+.-                 
T Consensus       392 s~---------------------------------------------------L--~Vtrd~~-----------------  401 (566)
T 1w7p_D          392 PL---------------------------------------------------L--ILDREKF-----------------  401 (566)
T ss_dssp             ---------------------------------------------------------CCSSCC-----------------
T ss_pred             hh---------------------------------------------------c--ccchhhc-----------------
Confidence            00                                                   0  0111100                 


Q ss_pred             CCCcHHHHHHHhHHhcCCCCchhhHhhHHHHHHHHhchh----hc-CCCccchhHHHHHHHhh-h-CCCCCCHHHHHHHH
Q psy4132         304 KGDRESKLKFAFRIYDIDNDDDYYQALGNELIAALIEPL----TS-AGGTMLLTDAYCRINRA-R-GLELLSPEDLLNSC  376 (473)
Q Consensus       304 ~~~~~e~l~~~F~~~D~d~dg~~~~~e~~el~~~L~~~~----~~-~~g~i~l~d~~~~~~~~-~-g~~~ls~~ei~~~~  376 (473)
                                       ...+.|..++.+++.+++....    .. .+|+|++.|+|+.+||+ + |.+++||+|+.++|
T Consensus       402 -----------------~s~~~f~~ELA~qI~E~c~~~~~~~l~~~nGGmItL~DL~~~~NRa~R~g~elISp~Dll~A~  464 (566)
T 1w7p_D          402 -----------------LNKELFLDEIAREIYEFTLSEFKDLNSDTNYMIITLVDLYAMYNKSMRIGTGLISPMEMREAC  464 (566)
T ss_dssp             -----------------CCHHHHHHHHHHHHHHHHHHTTCCSSCSCCCCEEEHHHHHHHHHHHTTTTTCCCCHHHHHHHH
T ss_pred             -----------------CChhHHHHHHHHHHHHHHHhhhcccchhcCcCeEEHHHHHHHHHHhccCCCCccCHHHHHHHH
Confidence                             1234577777789999988865    55 88999999999999999 8 88999999999999


Q ss_pred             HHhccCCCCCeeHHhhhccceeeeecccCcHHHHHHHHHHHhhCCCCCHHHHHHhhC-------CcHHHHHHHHHHHHHc
Q psy4132         377 LALDKLPDSPIYLKTYSSGVKVLQLKSCEDASFVEKTYEIVSQNVFVTVEQFSRLAS-------VSLVIAKHRLLLAETH  449 (473)
Q Consensus       377 ~~~D~~~dg~Is~~EF~~~~~vl~~~~~~~~~~~~~~~~~~~~~~~ls~~e~a~~~~-------~s~~~~~~~l~~~~~~  449 (473)
                      +.+...+.|...+..|-+++.|+ ..... +.....++++++..+++|+.++++.++       |++.+|+|.|++||.+
T Consensus       465 ~~le~Lg~~~~~L~~~~sgvlVv-s~~~~-~~~~~~il~l~~~~g~vT~~~la~~lg~~~~~~~Ws~~~A~e~L~~~e~e  542 (566)
T 1w7p_D          465 ERFEHLGLNELKLVKVNKRILCV-TSEKF-DVVKEKLVDLIGDNPGSDLLRLTQILSSNNSKSNWTLGILMEVLQNCVDE  542 (566)
T ss_dssp             TTGGGGTCTTCEEEECSSSCEEE-ESSCH-HHHHHHHHHHHTTSTTCCHHHHHHHHSCSSSCCCBCHHHHHHHHHHHHHT
T ss_pred             HHHHHcCCCeEEEEEECCEEEEE-cCCCc-hHHHHHHHHHHHhcCCcCHHHHHHHhCCccccCcccHHHHHHHHHHHHHc
Confidence            99999877655488888888887 55544 788899999999899999999999999       9999999999999999


Q ss_pred             CCccccCCcccccccccccCc
Q psy4132         450 GKLCRDQSIEGLRFYENKFLL  470 (473)
Q Consensus       450 g~l~~d~~~~g~~~~~n~~~~  470 (473)
                      |.||||++++|++||+|.|+.
T Consensus       543 G~l~rDd~~~G~~yypNlf~~  563 (566)
T 1w7p_D          543 GDLLIDKQLSGIYYYKNSYWP  563 (566)
T ss_dssp             TSEEEEEETTEEEEEECCSSC
T ss_pred             CCEEEECCCCceEEehhhccc
Confidence            999999999999999999984



>2hth_B Vacuolar protein sorting protein 36; GLUE domain, PH domain, viral budding, ubiquitin complex, protein transport; 2.70A {Homo sapiens} SCOP: b.55.1.12 PDB: 2dx5_A Back     alignment and structure
>2cay_A VPS36 PH domain, vacuolar protein sorting protein 36; transport, ESCRT-II, lipid-binding, multivesicular bodies, membrane; 1.9A {Saccharomyces cerevisiae} SCOP: b.55.1.12 Back     alignment and structure
>3cuq_B Vacuolar protein-sorting-associated protein 36; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_B Back     alignment and structure
>1u5t_B Defective in vacuolar protein sorting; VPS36P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>3cuq_A Vacuolar-sorting protein SNF8; ESCRT, MBV, VPS, nucleus, protein transport, transc transcription regulation, transport, endosome; 2.61A {Homo sapiens} PDB: 2zme_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>1u5t_A Appears to BE functionally related to SNF7; SNF8P; ESCRT, endosomal, trafficking, protein complex, transport protein; 3.60A {Saccharomyces cerevisiae} SCOP: a.4.5.54 a.4.5.54 PDB: 1w7p_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>3a8r_A Putative uncharacterized protein; EF-hand, membrane, oxidoreductase, transmembrane, calcium BI protein; 2.40A {Oryza sativa japonica group} Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>1eg3_A Dystrophin; EF-hand like domain, WW domain, structural protein; 2.00A {Homo sapiens} SCOP: a.39.1.7 a.39.1.7 b.72.1.1 PDB: 1eg4_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3nso_A Protein S100-A3; EF-hand, Ca2+, Zn2+ binding, metal binding protein; 1.45A {Homo sapiens} SCOP: a.39.1.2 PDB: 3nsi_A 1kso_A 3nsk_A 3nsl_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2kld_A Polycystin-2; PC2, PKD2, calcium binding domain, EF hand, cytosolic, calcium, coiled coil, disease mutation, glycoprotein, ION transport; NMR {Homo sapiens} PDB: 2kle_A 2kq6_A 2y4q_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>4eto_A Protein S100-A4; calcium-binding protein, EF-hand, structural genomics, PSI-B protein structure initiative, NEW YORK structural genomics consortium; 1.54A {Homo sapiens} PDB: 1m31_A 2q91_A 3cga_A 3ko0_A* 3m0w_A* Back     alignment and structure
>4drw_A Protein S100-A10/annexin A2 chimeric protein; atypical EF-hand, heteropentameric complex, membrane repair; 3.50A {Homo sapiens} Back     alignment and structure
>3zwh_A Protein S100-A4; Ca-binding protein-motor protein complex, S100 proteins, EF-; 1.94A {Homo sapiens} Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>2lnk_A Protein S100-A4; EF-hand, calcium binding, all alpha, metal binding protein, binding protein; NMR {Homo sapiens} PDB: 3c1v_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2h2k_A Protein S100-A13; calcium binding protein, metal binding protein; 2.00A {Homo sapiens} PDB: 1yur_A 1yus_A 1yut_A 1yuu_A 2egd_A 2k8m_B 2ki4_B* 2ki6_C* 2kot_A* 2l5x_B 2cxj_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3nxa_A Protein S100-A16; S100 family, calcium binding protein, APO, EF-hand calcium binding proteins, S100 proteins, protein dynamics, binding protein; 2.10A {Homo sapiens} SCOP: a.39.1.0 PDB: 2l0u_A 2l0v_A 2l50_A 2l51_A Back     alignment and structure
>2y5i_A S100Z, S100 calcium binding protein Z; metal-binding protein, EF-hand, calcium regulation, oligomer neuronal development, spine2; 2.03A {Danio rerio} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>2wcb_A Protein S100-A12; calcium signalling, HOST-parasite response, metal binding PR; 1.73A {Homo sapiens} PDB: 1odb_A* 2wc8_A 2wcf_A 2wce_A 1e8a_A 1gqm_A Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1j55_A S-100P protein; metal binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.2 PDB: 1ozo_A Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2kax_A Protein S100-A5; EF-hand, calcium binding protien, calcium, polymorphism, structural genomics, spine2, structural proteomics in europe, spine; NMR {Homo sapiens} PDB: 2kay_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2jq6_A EH domain-containing protein 1; metal binding protein; NMR {Homo sapiens} PDB: 2kff_A 2kfg_A 2kfh_A 2ksp_A Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1eh2_A EPS15; calcium binding, signaling domain, NPF binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 PDB: 2jxc_A 1f8h_A 1ff1_A Back     alignment and structure
>1xk4_C Calgranulin B; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1irj_A* Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1psr_A Psoriasin, S100A7; EF-hand protein, MAD phasing, psoriasis, S100 protein family; 1.05A {Homo sapiens} SCOP: a.39.1.2 PDB: 2psr_A 2wor_A* 2wos_A* 3psr_A 2wnd_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1a4p_A S100A10; S100 family, EF-hand protein, ligand of annexin II, calcium/phospholipid binding protein, calcium-phospholipid protein complex; 2.25A {Homo sapiens} SCOP: a.39.1.2 PDB: 1bt6_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>1tuz_A Diacylglycerol kinase alpha; transferase, HR532, nesgc, structural genomics, PSI, protein structure initiative; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3hsa_A Pleckstrin homology domain; YP_926556.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE MLY; 1.99A {Shewanella amazonensis SB2B} SCOP: b.55.1.13 PDB: 3dcx_A* Back     alignment and structure
>2jt1_A PEFI protein; solution structure, winged helix-turn-helix, transcripti regulatory protein, structural genomics, PSI-2; NMR {Salmonella typhimurium LT2} Back     alignment and structure
>1xn7_A Hypothetical protein YHGG; alpha+beta, GFT structural genomics, protein structure initiative, PSI, NESG; NMR {Escherichia coli} SCOP: a.4.5.62 Back     alignment and structure
>1pfj_A TFIIH basal transcription factor complex P62 subunit; PH/PTB domain, structural proteomics in europe, spine, structural genomics; NMR {Homo sapiens} SCOP: b.55.1.9 PDB: 2rnr_B Back     alignment and structure
>2k02_A Ferrous iron transport protein C; FEOC, iron-sulfur, metal-binding, metal binding protein; NMR {Klebsiella pneumoniae subsp} Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Back     alignment and structure
>1zyi_A Methylosome subunit picln; PH domain, cell volume regulation, RNA splicing, translation; NMR {Canis lupus familiaris} Back     alignment and structure
>2htj_A P fimbrial regulatory protein KS71A; winged helix-turn-helix, PAP PILI, transcription activator; NMR {Escherichia coli} SCOP: a.4.5.73 Back     alignment and structure
>1qbj_A Protein (double-stranded RNA specific adenosine D (ADAR1)); protein-Z-DNA complex, hydrolase-DNA complex; HET: DNA; 2.10A {Homo sapiens} SCOP: a.4.5.19 PDB: 3f21_A* 3f22_A* 3f23_A* 3irr_A* 3irq_D* 2gxb_A 2acj_A 2l54_A Back     alignment and structure
>1oyi_A Double-stranded RNA-binding protein; (alpha+beta) helix-turn-helix, viral protein; NMR {Vaccinia virus} SCOP: a.4.5.19 Back     alignment and structure
>1xmk_A Double-stranded RNA-specific adenosine deaminase; winged helix-turn-helix, RNA editing, interferon, ADAR1, hydrolase; 0.97A {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>1y5o_A TFB1, RNA polymerase II transcription factor B 73 kDa subunit; TFIIH, PH domain, phosphoinositides, VP16; NMR {Saccharomyces cerevisiae} SCOP: b.55.1.9 PDB: 2gs0_A 2k2u_A 2l2i_A 2lox_A* Back     alignment and structure
>1qgp_A Protein (double stranded RNA adenosine deaminase); Z-alpha-Z-DNA binding domain, RNA-editing, Z-DNA recognition, ADAR1, helix- turn-helix; NMR {Homo sapiens} SCOP: a.4.5.19 Back     alignment and structure
>2yf0_A Myotubularin-related protein 6; hydrolase; 2.65A {Homo sapiens} Back     alignment and structure
>2fu4_A Ferric uptake regulation protein; DNA binding domain, helix-turn-helix, DNA binding protein; 1.80A {Escherichia coli} Back     alignment and structure
>3b73_A PHIH1 repressor-like protein; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 2.12A {Haloarcula marismortui atcc 43049} Back     alignment and structure
>3cuo_A Uncharacterized HTH-type transcriptional regulato; DNA-binding transcriptional regulator, structural genomics, MCSG; 2.00A {Escherichia coli K12} Back     alignment and structure
>3jth_A Transcription activator HLYU; transcription factor, RTXA, DNA-binding, transcription regulation; 2.00A {Vibrio vulnificus} Back     alignment and structure
>1y0u_A Arsenical resistance operon repressor, putative; structural genomics, protein structure initiative, PSI; HET: MSE; 1.60A {Archaeoglobus fulgidus} SCOP: a.4.5.5 Back     alignment and structure
>1p6r_A Penicillinase repressor; transcription regulation, DNA-binding, winged helix protein, bacterial resistance to antibiotics; NMR {Bacillus licheniformis} SCOP: a.4.5.39 PDB: 2p7c_B Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3i4p_A Transcriptional regulator, ASNC family; PSI, structural genom protein structure initiative, midwest center for structural genomics; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2heo_A Z-DNA binding protein 1; protein DLM1-Z-DNA complex, immune system-DNA complex; 1.70A {Mus musculus} PDB: 1j75_A Back     alignment and structure
>1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 Back     alignment and structure
>1u2w_A CADC repressor, cadmium efflux system accessory protein; LEAD, SOFT metal ION resistance, ARSR/SM family, DNA binding protein; 1.90A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 3f72_A Back     alignment and structure
>1sfu_A 34L protein; protein/Z-DNA complex, DNA binding protein/DNA complex; 2.00A {Yaba-like disease virus} SCOP: a.4.5.19 Back     alignment and structure
>1on2_A Transcriptional regulator MNTR; helix-turn-helix, DNA-binding protein, metalloregulatory protein; 1.61A {Bacillus subtilis} SCOP: a.4.5.24 a.76.1.1 PDB: 2ev0_A 1on1_A 2ev5_A 2ev6_A* 2f5c_A 2f5d_A 2f5e_A 2f5f_A 2hyf_A* 2hyg_D 3r60_A* 3r61_A* Back     alignment and structure
>3hrs_A Metalloregulator SCAR; DTXR/MNTR family member, transcription; 2.70A {Streptococcus gordonii} PDB: 3hrt_A 3hru_A Back     alignment and structure
>2cfx_A HTH-type transcriptional regulator LRPC; transcriptional regulation, DNA binding, FFRP; 2.4A {Bacillus subtilis} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2p5v_A Transcriptional regulator, LRP/ASNC family; NMB0573, structu genomics; 1.99A {Neisseria meningitidis} PDB: 2p6s_A 2p6t_A Back     alignment and structure
>3b77_A Uncharacterized protein; pleckstrin-homology domain, structural genomics, joint cente structural genomics, JCSG; 2.42A {Exiguobacterium sibiricum} SCOP: b.55.1.13 Back     alignment and structure
>2dbb_A Putative HTH-type transcriptional regulator PH006; ASNC family, helix-turn-helix (HTH) domain, structural genom NPPSFA; 2.00A {Pyrococcus horikoshii} Back     alignment and structure
>2k4b_A Transcriptional regulator; DNA binding protein, winged helix; NMR {Lactococcus lactis subsp} Back     alignment and structure
>1i1g_A Transcriptional regulator LRPA; helix-turn-helix, LRP/ASNC family; 2.90A {Pyrococcus furiosus} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2w25_A Probable transcriptional regulatory protein; transcription regulation, mutant, RV3291C, Glu104Ala, DNA-binding; 2.15A {Mycobacterium tuberculosis} PDB: 2vbw_A* 2vbx_A* 2vby_A* 2vbz_A* 2vc0_A 2vc1_A 2w24_A 2ivm_A 2w29_A 2qz8_A Back     alignment and structure
>2cg4_A Regulatory protein ASNC; DNA binding, FFRP, LRP family, transcription, DNA- binding, transcription regulation; 2.4A {Escherichia coli} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2pn6_A ST1022, 150AA long hypothetical transcriptional regulator; LRP/ASNC family Gln binding, structural genomics, NPPSFA; HET: GLN; 1.44A {Sulfolobus tokodaii} PDB: 2efn_A* 2e7x_A* 2e7w_A* 2yx4_A* 2efq_A* 2pmh_A* 2yx7_A* 2efp_A* 2efo_A* Back     alignment and structure
>3i71_A Ethanolamine utilization protein EUTK; helix-turn-helix, unknown function; HET: FLC; 2.10A {Escherichia coli} Back     alignment and structure
>2cyy_A Putative HTH-type transcriptional regulator PH151; structural genomics, pyrococcus horikosii OT3, NPPSFA; HET: MSE GLN; 1.80A {Pyrococcus horikoshii} SCOP: a.4.5.32 d.58.4.2 Back     alignment and structure
>2h09_A Transcriptional regulator MNTR; transcription regulator, diphtheria toxin, manganese transport, structural genomics, NPPSFA; 2.10A {Escherichia coli} Back     alignment and structure
>1r1u_A CZRA, repressor protein; zinc, DNA binding, transcriptional regulation, winged HTH protein, transcription repressor; 2.00A {Staphylococcus aureus} SCOP: a.4.5.5 PDB: 1r1v_A 2kjb_A 2kjc_A Back     alignment and structure
>1sfx_A Conserved hypothetical protein AF2008; structural genomics, HTH MOT protein structure initiative, midwest center for structural genomics; 1.55A {Archaeoglobus fulgidus} SCOP: a.4.5.50 Back     alignment and structure
>2ia0_A Putative HTH-type transcriptional regulator PF086; ASNC, PSI, structural genomics, southeast collaboratory for structural genomics; 2.37A {Pyrococcus furiosus} Back     alignment and structure
>2x4h_A Hypothetical protein SSO2273; transcription; 2.30A {Sulfolobus solfataricus} Back     alignment and structure
>2kko_A Possible transcriptional regulatory protein (possibly ARSR-family); NESG, DNA-binding, transcription regulation, WHTH, homodimer; NMR {Mycobacterium bovis} PDB: 3gw2_A Back     alignment and structure
>2oqg_A Possible transcriptional regulator, ARSR family P; winged-helix-turn-helix, structural genomics, PSI-2, protein structure initiative; 1.54A {Rhodococcus SP} Back     alignment and structure
>3pqk_A Biofilm growth-associated repressor; helix-turn-helix motif, winged-helix fold, transcriptional R DNA binding, transcription; 2.09A {Xylella fastidiosa} PDB: 3pqj_A Back     alignment and structure
>3k2z_A LEXA repressor; winged helix-turn-helix, SOS system, autoca cleavage, DNA damage, DNA repair, DNA replication, DNA-BIND hydrolase; 1.37A {Thermotoga maritima} Back     alignment and structure
>3ech_A MEXR, multidrug resistance operon repressor; winged helix, helix-turn-helix, protein-peptide complex; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 PDB: 1lnw_A 3mex_A Back     alignment and structure
>3bpv_A Transcriptional regulator; MARR, DNA binding, transcription factor, winged helix motif, DNA-binding; 1.40A {Methanobacterium thermoautotrophicum} PDB: 3bpx_A* Back     alignment and structure
>3g3z_A NMB1585, transcriptional regulator, MARR family; transcription factor, structur genomics, oxford protein production facility; 2.10A {Neisseria meningitidis serogroup B} Back     alignment and structure
>3bro_A Transcriptional regulator; helix_TURN_helix, multiple antibiotic resistance protein (MA structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.04A {Oenococcus oeni} SCOP: a.4.5.28 Back     alignment and structure
>1r7j_A Conserved hypothetical protein SSO10A; winged helix-turn-helix, two-stranded antiparallel coiled CO structural genomics, PSI; 1.47A {Sulfolobus solfataricus} SCOP: a.4.5.49 PDB: 1xsx_A Back     alignment and structure
>2fbh_A Transcriptional regulator PA3341; MARR, transcription regulator, APC5857, structural genomics, protein structure initiative; 1.80A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>3tgn_A ADC operon repressor ADCR; helix-turn-helix, transcriptional regulator, transcription; 2.00A {Streptococcus pneumoniae} Back     alignment and structure
>3bj6_A Transcriptional regulator, MARR family; helix-turn-helix, trasnscription regulator, STR genomics, PSI-2, protein structure initiative; 2.01A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2pex_A Transcriptional regulator OHRR; transcription regulator; 1.90A {Xanthomonas campestris} PDB: 2pfb_A Back     alignment and structure
>2fa5_A Transcriptional regulator MARR/EMRR family; multiple antibiotics resistance repressor, XCC structural genomics, X-RAY diffraction; 1.80A {Xanthomonas campestris} Back     alignment and structure
>3bdd_A Regulatory protein MARR; putative multiple antibiotic-resistance repressor, structura genomics, joint center for structural genomics, JCSG; 2.20A {Streptococcus suis} Back     alignment and structure
>3nrv_A Putative transcriptional regulator (MARR/EMRR FAM; PSI-2, protein structure initiati structural genomics; HET: MSE; 2.00A {Acinetobacter SP} Back     alignment and structure
>2rdp_A Putative transcriptional regulator MARR; PFAM PF01047, winged-helix binding motif, structural genomics, PSI-2; 2.30A {Geobacillus stearothermophilus} Back     alignment and structure
>1ku9_A Hypothetical protein MJ223; putative transcription factor, homodimeric winged-helix fold, structural genomics, PSI; 2.80A {Methanocaldococcus jannaschii} SCOP: a.4.5.36 Back     alignment and structure
>1r1t_A Transcriptional repressor SMTB; zinc, transcriptional regulation, winged HTH protein, DNA binding, transcription repressor; 1.70A {Synechococcus elongatus pcc 7942} SCOP: a.4.5.5 PDB: 1r23_A 1smt_A 1r22_A Back     alignment and structure
>2d1h_A ST1889, 109AA long hypothetical transcriptional regulator; helix-turn-helix, intermolecular and intramolecular S-S bond structural genomics; 2.05A {Sulfolobus tokodaii} SCOP: a.4.5.50 Back     alignment and structure
>2hr3_A Probable transcriptional regulator; MCSG, structural genomics, PSI-2, protein structure initiati midwest center for structural genomics; 2.40A {Pseudomonas aeruginosa} SCOP: a.4.5.28 Back     alignment and structure
>2a61_A Transcriptional regulator TM0710; APC4350, MCSG, midwest center for structural genomics, PSI, protein structure initiative, MARR; 1.80A {Thermotoga maritima} SCOP: a.4.5.28 Back     alignment and structure
>2gxg_A 146AA long hypothetical transcriptional regulator; winged helix; 1.45A {Sulfolobus tokodaii} PDB: 2eb7_A 2yr2_A 3gez_A 3gf2_A* 3gfi_A 3gfm_A 3gfj_A 3gfl_A Back     alignment and structure
>3cdh_A Transcriptional regulator, MARR family; helix-turn-hleix, structura genomics, PSI-2, protein structure initiative; 2.69A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>2qww_A Transcriptional regulator, MARR family; YP_013417.1, multiple antibiotic-resistance repressor (MARR) structural genomics; HET: MSE; 2.07A {Listeria monocytogenes str} Back     alignment and structure
>3f6o_A Probable transcriptional regulator, ARSR family protein; transcriptional regulator,RHA00566,MCSG, structural genomics, PSI-2; 1.90A {Rhodococcus SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 473
d2hthb1129 b.55.1.12 (B:3-131) Vacuolar protein sorting prote 1e-34
d2caya1130 b.55.1.12 (A:1-99,A:252-282) Vacuolar protein sort 4e-18
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 1e-16
d1xo5a_180 a.39.1.5 (A:) Calcium- and integrin-binding protei 8e-06
d1u5tb194 a.4.5.54 (B:396-489) Vacuolar protein sorting-asso 2e-15
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 1e-10
d1pvaa_109 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.001
d5pala_109 a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis 8e-10
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 1e-09
d1auib_165 a.39.1.5 (B:) Calcineurin regulatory subunit (B-ch 2e-07
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-09
d1g8ia_187 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-05
d1rroa_108 a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) 2e-09
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 2e-09
d2pvba_107 a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [Tax 0.002
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-09
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 2e-05
d1fpwa_190 a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1 3e-05
d1rwya_109 a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [Ta 3e-09
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 2e-08
d1bjfa_181 a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId 2e-05
d1dtla_156 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-08
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 3e-08
d2zfda1183 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 { 2e-04
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 3e-08
d1exra_146 a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetr 2e-07
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 3e-08
d1topa_162 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-05
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 2e-07
d1omra_201 a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 7e-04
d1jbaa_189 a.39.1.5 (A:) Guanylate cyclase activating protein 3e-07
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 3e-07
d1uhka1187 a.39.1.5 (A:3-189) Calcium-regulated photoprotein 3e-05
d2opoa181 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Che 4e-07
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 4e-07
d2obha1141 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapien 3e-06
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 5e-07
d1tiza_67 a.39.1.5 (A:) Calmodulin-related protein T21P5.17 5e-04
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 5e-07
d1c7va_68 a.39.1.5 (A:) Calcium vector protein {Amphioxus (B 0.002
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 8e-07
d1nyaa_176 a.39.1.5 (A:) Calerythrin {Saccharopolyspora eryth 3e-04
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 9e-07
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 6e-06
d2scpa_174 a.39.1.5 (A:) Sarcoplasmic calcium-binding protein 7e-04
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 1e-06
d1oqpa_77 a.39.1.5 (A:) Caltractin (centrin 2) {Green algae 0.002
d1avsa_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 2e-06
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 3e-06
d1k94a_165 a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [Ta 4e-04
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 3e-06
d1lkja_146 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 7e-06
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 3e-06
d1hqva_181 a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mous 0.002
d1fi5a_81 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), 6e-06
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 7e-06
d1jc2a_75 a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) 0.002
d1s6ja_87 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 9e-06
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 2e-05
d1qxpa2188 a.39.1.8 (A:515-702) Calpain large subunit, C-term 0.002
d1tuza_118 a.39.1.7 (A:) Diacylglycerol kinase alpha, N-termi 4e-05
d1fw4a_65 a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 5e-05
d1c07a_95 a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 5e-05
d1y1xa_182 a.39.1.8 (A:) Programmed cell death 6 protein-like 5e-05
d1f54a_77 a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharom 9e-05
d1wlza183 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {H 1e-04
d2fcea161 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [ 2e-04
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 2e-04
d1df0a1186 a.39.1.8 (A:515-700) Calpain large subunit, C-term 0.003
d2pq3a173 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [T 3e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 5e-04
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 0.001
d1cb1a_78 a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [Tax 7e-04
d1s6ca_178 a.39.1.5 (A:) Kchip1, Kv4 potassium channel-intera 0.001
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 0.001
d2zkmx1170 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human 0.002
d1fi6a_92 a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 0.001
d1juoa_172 a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 0.002
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 0.002
d1qv0a_189 a.39.1.5 (A:) Calcium-regulated photoprotein {Hydr 0.002
d1snla_99 a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo 0.002
d1s6ia_182 a.39.1.5 (A:) Calcium-dependent protein kinase sk5 0.002
d1a4pa_92 a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapien 0.003
d1yuta198 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sa 0.003
d3c1va193 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sa 0.003
>d2hthb1 b.55.1.12 (B:3-131) Vacuolar protein sorting protein 36, VPS36 {Human (Homo sapiens) [TaxId: 9606]} Length = 129 Back     information, alignment and structure

class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: VPS36 N-terminal domain-like
domain: Vacuolar protein sorting protein 36, VPS36
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  124 bits (312), Expect = 1e-34
 Identities = 46/132 (34%), Positives = 69/132 (52%), Gaps = 7/132 (5%)

Query: 3   RFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFW----QKDITLCLA 58
           RF + S  L  +E+ V++   VR+YDGE K +F  G L+L++HRL W      +  + + 
Sbjct: 1   RFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAIL 60

Query: 59  LSYIQNAVEEAKSMFNLTAGRKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFL 118
           LS I    E+A  +       KI+++L  A P K  GP  +S   Y+KLSF+E  Q EF 
Sbjct: 61  LSQIVFIEEQAAGIG---KSAKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFY 117

Query: 119 DALKSTVDAKIW 130
             L   +  + W
Sbjct: 118 RRLSEEMTQRRW 129


>d2caya1 b.55.1.12 (A:1-99,A:252-282) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 130 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Length = 180 Back     information, alignment and structure
>d1u5tb1 a.4.5.54 (B:396-489) Vacuolar protein sorting-associated protein VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 94 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 109 Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Length = 109 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 187 Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 108 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Length = 107 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 190 Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Length = 109 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Length = 181 Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 156 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 183 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Length = 146 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 162 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Length = 189 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Length = 187 Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Length = 81 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Length = 141 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 67 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Length = 68 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Length = 176 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Length = 174 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Length = 77 Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Length = 165 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 146 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 181 Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Length = 81 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Length = 75 Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 87 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Length = 188 Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 65 Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Length = 182 Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 77 Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Length = 61 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Length = 186 Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Length = 73 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Length = 78 Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 178 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 170 Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 92 Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Length = 172 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Length = 189 Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Length = 182 Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Length = 93 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query473
d2hthb1129 Vacuolar protein sorting protein 36, VPS36 {Human 100.0
d2caya1130 Vacuolar protein sorting protein 36, VPS36 {Baker' 99.98
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.69
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.68
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.67
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.66
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.64
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.62
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.62
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.6
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.6
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.59
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.59
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.59
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.58
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 99.58
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.58
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.58
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.57
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.57
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 99.56
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.55
d1alva_173 Calpain small (regulatory) subunit (domain VI) {Pi 99.55
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.54
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.54
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.53
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.53
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 99.52
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 99.52
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 99.52
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.51
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 99.5
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.5
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 99.5
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 99.49
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.49
d1qxpa2188 Calpain large subunit, C-terminal domain (domain I 99.49
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.49
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 99.48
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.48
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 99.46
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 99.45
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.45
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.45
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 99.44
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 99.42
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.4
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 99.39
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.38
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 99.38
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 99.37
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 99.37
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 99.37
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.35
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 99.33
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.33
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.33
d1g8ia_187 Frequenin (neuronal calcium sensor 1) {Human (Homo 99.29
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 99.29
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 99.28
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 99.25
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 99.24
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.24
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.22
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 99.21
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.2
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 99.18
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 99.18
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 99.15
d1bjfa_181 Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} 99.14
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 99.13
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 99.13
d1s6ca_178 Kchip1, Kv4 potassium channel-interacting protein 99.12
d1u5tb194 Vacuolar protein sorting-associated protein VPS36 99.08
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 99.05
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 99.05
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 99.05
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 99.0
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 99.0
d1xo5a_180 Calcium- and integrin-binding protein, CIB {Human 98.99
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 98.97
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.92
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 98.91
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.91
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 98.9
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.88
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.88
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.87
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.85
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.85
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.82
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.82
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 98.82
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.81
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.81
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.78
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.76
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.68
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.67
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 98.66
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.62
d1u5tb275 Vacuolar protein sorting-associated protein VPS36 98.59
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 98.59
d1s6ja_87 Calcium-dependent protein kinase sk5 CLD {Soybean 98.58
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 98.57
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 98.57
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 98.56
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.54
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.51
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.49
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.49
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 98.49
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.46
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.46
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.45
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 98.45
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.45
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 98.42
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 98.41
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.39
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 98.38
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.36
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 98.36
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.35
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.31
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 98.3
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.29
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 98.28
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 98.21
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 98.21
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 98.2
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 98.2
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 98.15
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 98.15
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 98.15
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 98.11
d1zsqa1125 Myotubularin-related protein 2, N-terminal domain 98.11
d1ksoa_93 Calcyclin (S100) {Human (Homo sapiens), s100a3 [Ta 98.06
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 98.05
d1yuta198 Calcyclin (S100) {Human (Homo sapiens), s100a13 [T 98.04
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 98.04
d1cb1a_78 Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} 98.0
d1xk4a187 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.99
d1k8ua_89 Calcyclin (S100) {Human (Homo sapiens), s100a6 [Ta 97.92
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.9
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 97.85
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.72
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 97.7
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 97.61
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 97.6
d1psra_100 Calcyclin (S100) {Human (Homo sapiens), psoriasin 97.54
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 97.53
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 97.46
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.45
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 97.28
d1tuza_118 Diacylglycerol kinase alpha, N-terminal domain {Hu 97.27
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 97.23
d3cr5x190 Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 97.08
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 97.07
d1qlsa_95 Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s1 96.57
d1xk4c183 Calcyclin (S100) {Human (Homo sapiens), s100a9 (mr 96.5
d1j55a_94 Calcyclin (S100) {Human (Homo sapiens), s100p [Tax 96.39
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 96.36
d1ctda_34 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.13
d2rnrb1108 TFIIH basal transcription factor complex p62 subun 95.66
d3dcxa1116 Uncharacterized protein Shew0819 {Shewanella loihi 94.64
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 94.58
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 94.54
d1stza187 Heat-inducible transcription repressor HrcA, N-ter 94.46
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 94.2
d2ev0a161 Manganese transport regulator MntR {Bacillus subti 94.17
d1biaa163 Biotin repressor, N-terminal domain {Escherichia c 94.15
d2isya163 Iron-dependent regulator IdeR {Mycobacterium tuber 93.89
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 93.81
d1sfua_70 34L {Yaba-like disease virus, YLDV [TaxId: 132475] 93.49
d1jhfa171 LexA repressor, N-terminal DNA-binding domain {Esc 93.21
d1sfxa_109 Hypothetical protein AF2008 {Archaeoglobus fulgidu 91.25
d1u5ta268 Vacuolar sorting protein SNF8 {Baker's yeast (Sacc 90.57
d1z05a171 Transcriptional regulator VC2007 N-terminal domain 90.24
d1mkma175 Transcriptional regulator IclR, N-terminal domain 90.16
d1y5oa1114 RNA polymerase II transcription factor B 73 kDa, T 90.0
d2d1ha1109 Hypothetical transcriptional regulator ST1889 {Sul 89.19
d1sraa_151 C-terminal (EC) domain of BM-40/SPARC/osteonectin 88.09
d1wi9a_72 Hypothetical protein C20orf116 homolog {Mouse (Mus 87.61
d2htja173 P fimbrial regulatory protein PapI {Escherichia co 85.0
d2gxba159 Z-alpha domain of dsRNA-specific adenosine deamina 84.48
d1j5ya165 Putative transcriptional regulator TM1602, N-termi 84.11
d1z6ra170 Mlc protein N-terminal domain {Escherichia coli [T 84.07
d3ctaa185 Ta1064 (RFK), N-terminal domain {Thermoplasma acid 83.37
d2etha1140 Putative transcriptional regulator TM0816 {Thermot 82.08
>d2hthb1 b.55.1.12 (B:3-131) Vacuolar protein sorting protein 36, VPS36 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: PH domain-like barrel
superfamily: PH domain-like
family: VPS36 N-terminal domain-like
domain: Vacuolar protein sorting protein 36, VPS36
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.3e-37  Score=262.74  Aligned_cols=125  Identities=37%  Similarity=0.615  Sum_probs=121.5

Q ss_pred             cccccCCCCCCCCceEEeecceeeecCCCCCcccCcEEEeeeeeeeee----cCccccccchhhhhHHHhhhhcccccCc
Q psy4132           3 RFEYCSFELSPDESPVLKHSNVRLYDGENKSQFQRGELILTSHRLFWQ----KDITLCLALSYIQNAVEEAKSMFNLTAG   78 (473)
Q Consensus         3 ~~~~~~~~l~~~E~~~~~~~~v~ly~g~~~~~~~~G~l~LTshRii~~----~~~~~~l~l~~v~~~~~~~~~~~~~~~s   78 (473)
                      ||+||++.|++||.++++++||+||+|+.|+++++|+||||||||||+    +..|++|||.+|.+++.++++|   ++|
T Consensus         1 rf~~~~~ll~~~E~~l~~~~~V~lydG~~k~~~~~G~l~LTthRli~~~~~~~~~s~~lpl~~i~~~e~~~~~f---g~s   77 (129)
T d2hthb1           1 RFVWTSGLLEINETLVIQQRGVRIYDGEEKIKFDAGTLLLSTHRLIWRDQKNHECCMAILLSQIVFIEEQAAGI---GKS   77 (129)
T ss_dssp             CCEECCSCCCTTCCEEEEEEEEEEEETTCSSCCCCEEEEEESSEEEEEETTCCSCCEEEEGGGEEEEEEECCTT---SSC
T ss_pred             CcEEEcCCCCCCcEEEEEeCCEEeecCCCcccccceEEEEEeceEEEecCCCCceEEEEEhHHceeeeEEcccc---cCC
Confidence            899999999999999999999999999999999999999999999999    7789999999999999999877   799


Q ss_pred             ccEEEEeecCCCCCCCCCCCCCCCCeEEEeccCCCchHHHHHHHHHHhhhhh
Q psy4132          79 RKIILYLSKAVPGKNLGPSATSAYDYVKLSFREGIQNEFLDALKSTVDAKIW  130 (473)
Q Consensus        79 ~ki~~~l~~~~~~~~~~p~~~~~~~~iklsFr~gg~~~F~~~l~~~l~~~~w  130 (473)
                      |||+++++++++++++||..+++..+||||||+||+++|+++|.++|.+|+|
T Consensus        78 ~ki~l~l~~~~~~~~~gp~~~s~~~~~KLsFk~GG~~eF~~~l~~al~~k~W  129 (129)
T d2hthb1          78 AKIVVHLHPAPPNKEPGPFQSSKNSYIKLSFKEHGQIEFYRRLSEEMTQRRW  129 (129)
T ss_dssp             CEEEEEECCCCCCSSSCCCSTTSCCEEEEEETTSCHHHHHHHHHHHHHHCCC
T ss_pred             ceEEEEEccCCcCCcCCCcCcCCceEEEEEECCCCHHHHHHHHHHHHHhccC
Confidence            9999999999999999999999999999999999999999999999999999



>d2caya1 b.55.1.12 (A:1-99,A:252-282) Vacuolar protein sorting protein 36, VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1alva_ a.39.1.8 (A:) Calpain small (regulatory) subunit (domain VI) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qxpa2 a.39.1.8 (A:515-702) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), mu-type [TaxId: 10116]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1g8ia_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1bjfa_ a.39.1.5 (A:) Neurocalcin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1s6ca_ a.39.1.5 (A:) Kchip1, Kv4 potassium channel-interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1u5tb1 a.4.5.54 (B:396-489) Vacuolar protein sorting-associated protein VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1xo5a_ a.39.1.5 (A:) Calcium- and integrin-binding protein, CIB {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1u5tb2 a.4.5.54 (B:490-564) Vacuolar protein sorting-associated protein VPS36 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1s6ja_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zsqa1 b.55.1.8 (A:74-198) Myotubularin-related protein 2, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ksoa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a3 [TaxId: 9606]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d1yuta1 a.39.1.2 (A:1-98) Calcyclin (S100) {Human (Homo sapiens), s100a13 [TaxId: 9606]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cb1a_ a.39.1.1 (A:) Calbindin D9K {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4a1 a.39.1.2 (A:1-87) Calcyclin (S100) {Human (Homo sapiens), calgranulin s100a8, MRP8 [TaxId: 9606]} Back     information, alignment and structure
>d1k8ua_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100a6 [TaxId: 9606]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psra_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), psoriasin s100a7 [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1tuza_ a.39.1.7 (A:) Diacylglycerol kinase alpha, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d3cr5x1 a.39.1.2 (X:0-89) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d1qlsa_ a.39.1.2 (A:) Calcyclin (S100) {Pig (Sus scrofa), calgizzarin s100c (s100a11) [TaxId: 9823]} Back     information, alignment and structure
>d1xk4c1 a.39.1.2 (C:4-86) Calcyclin (S100) {Human (Homo sapiens), s100a9 (mrp14) [TaxId: 9606]} Back     information, alignment and structure
>d1j55a_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), s100p [TaxId: 9606]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ctda_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2rnrb1 b.55.1.9 (B:1-108) TFIIH basal transcription factor complex p62 subunit (BTF2-p62), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dcxa1 b.55.1.13 (A:9-124) Uncharacterized protein Shew0819 {Shewanella loihica [TaxId: 359303]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1stza1 a.4.5.51 (A:14-100) Heat-inducible transcription repressor HrcA, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ev0a1 a.4.5.24 (A:2-62) Manganese transport regulator MntR {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1biaa1 a.4.5.1 (A:1-63) Biotin repressor, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2isya1 a.4.5.24 (A:2-64) Iron-dependent regulator IdeR {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1sfua_ a.4.5.19 (A:) 34L {Yaba-like disease virus, YLDV [TaxId: 132475]} Back     information, alignment and structure
>d1jhfa1 a.4.5.2 (A:2-72) LexA repressor, N-terminal DNA-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sfxa_ a.4.5.50 (A:) Hypothetical protein AF2008 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1u5ta2 a.4.5.54 (A:165-232) Vacuolar sorting protein SNF8 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1z05a1 a.4.5.63 (A:10-80) Transcriptional regulator VC2007 N-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1mkma1 a.4.5.33 (A:1-75) Transcriptional regulator IclR, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y5oa1 b.55.1.9 (A:2-115) RNA polymerase II transcription factor B 73 kDa, TFB1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2d1ha1 a.4.5.50 (A:1-109) Hypothetical transcriptional regulator ST1889 {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2htja1 a.4.5.73 (A:1-73) P fimbrial regulatory protein PapI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gxba1 a.4.5.19 (A:140-198) Z-alpha domain of dsRNA-specific adenosine deaminase, ADAR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j5ya1 a.4.5.1 (A:3-67) Putative transcriptional regulator TM1602, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z6ra1 a.4.5.63 (A:12-81) Mlc protein N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3ctaa1 a.4.5.28 (A:5-89) Ta1064 (RFK), N-terminal domain {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2etha1 a.4.5.28 (A:1-140) Putative transcriptional regulator TM0816 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure