Diaphorina citri psyllid: psy4160

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160

MALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY

ccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccEEEEEEEcccccccccccccccccEEEEEECccEEEEEEccccccEEEEEcccHHHHHHHHHHHHHHHHcccEEEEccccccccccc

*ALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYS*****

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Thioredoxin-like protein 4A	Essential role in pre-mRNA splicing.	very confident	P83876
Thioredoxin-like protein 4A	Essential role in pre-mRNA splicing.	very confident	P83877
Thioredoxin-like protein 4A homolog	Essential role in pre-mRNA splicing.	very confident	Q553S5

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0071011 [CC]	precatalytic spliceosome	confident	GO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0000245 [BP]	spliceosomal complex assembly	confident	GO:0022607, GO:0043933, GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:0034622, GO:0071840, GO:0006139, GO:0071826, GO:0044260, GO:0016043, GO:0065003, GO:0071704, GO:0010467, GO:0022618, GO:1901360, GO:0022613, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0044085, GO:0006396, GO:0006397
GO:0007067 [BP]	mitosis	confident	GO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049
GO:0005654 [CC]	nucleoplasm	confident	GO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0007052 [BP]	mitotic spindle organization	confident	GO:0006996, GO:0007017, GO:0007010, GO:0000278, GO:0071822, GO:0043933, GO:0071840, GO:0009987, GO:0044763, GO:0016043, GO:0008150, GO:0007051, GO:0022402, GO:0044699, GO:0000226, GO:0007049
GO:0022008 [BP]	neurogenesis	confident	GO:0032502, GO:0048856, GO:0044707, GO:0007399, GO:0048869, GO:0030154, GO:0008150, GO:0032501, GO:0044763, GO:0048731, GO:0009987, GO:0007275, GO:0044699
GO:0005737 [CC]	cytoplasm	confident	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0005515 [MF]	protein binding	confident	GO:0003674, GO:0005488
GO:0046540 [CC]	U4/U6 x U5 tri-snRNP complex	probable	GO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0051301 [BP]	cell division	probable	GO:0008150, GO:0009987, GO:0044763, GO:0044699
GO:0005682 [CC]	U5 snRNP	probable	GO:0005575, GO:0032991, GO:0043231, GO:0030532, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0007030 [BP]	Golgi organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0016197 [BP]	endosomal transport	probable	GO:0009987, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0016049 [BP]	cell growth	probable	GO:0008150, GO:0009987, GO:0044763, GO:0040007, GO:0044699
GO:0000902 [BP]	cell morphogenesis	probable	GO:0032502, GO:0009987, GO:0048869, GO:0048856, GO:0016043, GO:0032989, GO:0044767, GO:0044763, GO:0071840, GO:0008150, GO:0009653, GO:0044699
GO:0006623 [BP]	protein targeting to vacuole	probable	GO:0008104, GO:0072666, GO:0072665, GO:0044699, GO:0070727, GO:0006886, GO:0071702, GO:0016482, GO:0006810, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0015031, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0051179, GO:0051641, GO:0033036, GO:0046907, GO:0007034, GO:0033365, GO:0044763, GO:0009987
GO:0003824 [MF]	catalytic activity	probable	GO:0003674
GO:0007033 [BP]	vacuole organization	probable	GO:0006996, GO:0009987, GO:0016043, GO:0044763, GO:0044699, GO:0008150, GO:0071840
GO:0045292 [BP]	mRNA cis splicing, via spliceosome	probable	GO:0090304, GO:0034641, GO:0006807, GO:0044237, GO:1901360, GO:0006139, GO:0044260, GO:0071704, GO:0010467, GO:0008380, GO:0044238, GO:0009987, GO:0006725, GO:0000375, GO:0000377, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0016071, GO:0000398, GO:0043170, GO:0006396, GO:0006397
GO:0048193 [BP]	Golgi vesicle transport	probable	GO:0009987, GO:0016192, GO:0046907, GO:0006810, GO:0044765, GO:0008150, GO:0051649, GO:0044763, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0006944 [BP]	cellular membrane fusion	probable	GO:0016044, GO:0009987, GO:0016043, GO:0061025, GO:0061024, GO:0044763, GO:0071840, GO:0008150, GO:0044699

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1QGV, chain A
Confidence level:very confident
Coverage over the Query: 43-156
View the alignment between query and template
View the model in PyMOL

Template: 1Z6N, chain A
Confidence level:probable
Coverage over the Query: 23-108
View the alignment between query and template
View the model in PyMOL

Template: 1NUB, chain A
Confidence level:probable
Coverage over the Query: 1-42
View the alignment between query and template
View the model in PyMOL