Psyllid ID: psy4160

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160
MALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY
ccccccccccccccccccccccHHHHHHHHHHccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccEEEEEEEcccccccccccccccccEEEEEEEccEEEEEEccccccEEEEEcccHHHHHHHHHHHHHHHHcccEEEEccccccccccc
ccHHHHHcHHHccccccccccEEHHHHcHHccccHHHHHHHcHEEEEEcccccHHHHHHHHHHHHHHHHHHccEEEEEEEccccccHHHHEEcccccEEEEEEcccEEEEEccccccccEEEEcccHHHHHHHHHHHHHHHHcccEEEEccccccccccc
malehciapflnkcdadddhLITLKEWARCLELNEDEIEDQCEDVIrfghdwdptcmKMDEVLYSIAEKVKNFAVIYLVDitkvpdfnkmyelydpctcmfffrnKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGarkgrglvvspkdystkyry
MALEHCIApflnkcdadddHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVyrgarkgrglvvspkdystkyry
MALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY
***EHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVV***********
*ALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYS*****
MALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPK********
*ALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYST****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALEHCIAPFLNKCDADDDHLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query160 2.2.26 [Sep-21-2011]
P83877142 Thioredoxin-like protein yes N/A 0.725 0.816 0.956 6e-63
P83876142 Thioredoxin-like protein yes N/A 0.725 0.816 0.956 6e-63
P87215142 Mitosis protein dim1 OS=S yes N/A 0.725 0.816 0.793 3e-50
Q553S5160 Thioredoxin-like protein yes N/A 0.725 0.725 0.741 3e-49
Q75BD8143 Spliceosomal protein DIB1 yes N/A 0.706 0.790 0.681 3e-41
Q06819143 Spliceosomal protein DIB1 yes N/A 0.706 0.790 0.672 2e-39
Q6FMI2142 Spliceosomal protein DIB1 yes N/A 0.706 0.795 0.628 2e-36
Q9NX01149 Thioredoxin-like protein no N/A 0.675 0.724 0.363 3e-18
Q8BUH1149 Thioredoxin-like protein no N/A 0.675 0.724 0.363 3e-17
P34714264 SPARC OS=Caenorhabditis e yes N/A 0.262 0.159 0.5 2e-06
>sp|P83877|TXN4A_MOUSE Thioredoxin-like protein 4A OS=Mus musculus GN=Txnl4a PE=2 SV=1 Back     alignment and function desciption
 Score =  239 bits (609), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 111/116 (95%), Positives = 115/116 (99%)

Query: 45  VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFR 104
           VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDIT+VPDFNKMYELYDPCT MFFFR
Sbjct: 27  VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFR 86

Query: 105 NKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY 160
           NKHIMIDLGTGNNNKINWA+EDKQEM+DI+ETVYRGARKGRGLVVSPKDYSTKYRY
Sbjct: 87  NKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY 142
Essential role in pre-mRNA splicing.
Mus musculus (taxid: 10090)
>sp|P83876|TXN4A_HUMAN Thioredoxin-like protein 4A OS=Homo sapiens GN=TXNL4A PE=1 SV=1 Back     alignment and function description
>sp|P87215|DIMI_SCHPO Mitosis protein dim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dim1 PE=1 SV=1 Back     alignment and function description
>sp|Q553S5|TXN4A_DICDI Thioredoxin-like protein 4A homolog OS=Dictyostelium discoideum GN=txnl4a PE=3 SV=4 Back     alignment and function description
>sp|Q75BD8|DIB1_ASHGO Spliceosomal protein DIB1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DIB1 PE=3 SV=1 Back     alignment and function description
>sp|Q06819|DIB1_YEAST Spliceosomal protein DIB1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIB1 PE=1 SV=1 Back     alignment and function description
>sp|Q6FMI2|DIB1_CANGA Spliceosomal protein DIB1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DIB1 PE=3 SV=1 Back     alignment and function description
>sp|Q9NX01|TXN4B_HUMAN Thioredoxin-like protein 4B OS=Homo sapiens GN=TXNL4B PE=1 SV=1 Back     alignment and function description
>sp|Q8BUH1|TXN4B_MOUSE Thioredoxin-like protein 4B OS=Mus musculus GN=Txnl4b PE=2 SV=1 Back     alignment and function description
>sp|P34714|SPRC_CAEEL SPARC OS=Caenorhabditis elegans GN=ost-1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
242007822142 mitosis protein dim1, putative [Pediculu 0.725 0.816 0.982 7e-62
193643588142 PREDICTED: thioredoxin-like protein 4A-l 0.725 0.816 0.982 7e-62
62860202142 thioredoxin-like 4A [Xenopus (Silurana) 0.725 0.816 0.974 2e-61
359465619142 thioredoxin-like protein 4A [Equus cabal 0.725 0.816 0.965 2e-61
170041711142 mitosis protein dim1 [Culex quinquefasci 0.725 0.816 0.974 3e-61
391339696142 PREDICTED: thioredoxin-like protein 4A-l 0.725 0.816 0.965 3e-61
5729802142 thioredoxin-like protein 4A [Homo sapien 0.725 0.816 0.956 3e-61
321461719142 hypothetical protein DAPPUDRAFT_308067 [ 0.725 0.816 0.965 4e-61
350536925142 Thioredoxin-like protein 4A [Oncorhynchu 0.725 0.816 0.965 4e-61
54400404142 thioredoxin-like protein 4A [Danio rerio 0.725 0.816 0.965 4e-61
>gi|242007822|ref|XP_002424719.1| mitosis protein dim1, putative [Pediculus humanus corporis] gi|212508212|gb|EEB11981.1| mitosis protein dim1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  241 bits (615), Expect = 7e-62,   Method: Compositional matrix adjust.
 Identities = 114/116 (98%), Positives = 115/116 (99%)

Query: 45  VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFR 104
           VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDIT+VPDFNKMYELYDPCT MFFFR
Sbjct: 27  VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFR 86

Query: 105 NKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY 160
           NKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY
Sbjct: 87  NKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY 142

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|193643588|ref|XP_001951327.1| PREDICTED: thioredoxin-like protein 4A-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|62860202|ref|NP_001016646.1| thioredoxin-like 4A [Xenopus (Silurana) tropicalis] gi|89269554|emb|CAJ82675.1| thioredoxin-like 4A [Xenopus (Silurana) tropicalis] gi|163916412|gb|AAI57182.1| thioredoxin-like 4A [Xenopus (Silurana) tropicalis] Back     alignment and taxonomy information
>gi|359465619|ref|NP_001240770.1| thioredoxin-like protein 4A [Equus caballus] gi|50733538|ref|XP_418903.1| PREDICTED: thioredoxin-like 4A isoform 2 [Gallus gallus] gi|73945343|ref|XP_533363.2| PREDICTED: thioredoxin-like 4A isoform 1 [Canis lupus familiaris] gi|126321922|ref|XP_001366433.1| PREDICTED: thioredoxin-like protein 4A-like [Monodelphis domestica] gi|149627057|ref|XP_001507748.1| PREDICTED: thioredoxin-like protein 4A-like [Ornithorhynchus anatinus] gi|194033756|ref|XP_001924886.1| PREDICTED: thioredoxin-like 4A [Sus scrofa] gi|301769997|ref|XP_002920414.1| PREDICTED: thioredoxin-like protein 4A-like [Ailuropoda melanoleuca] gi|326916891|ref|XP_003204738.1| PREDICTED: thioredoxin-like protein 4A-like [Meleagris gallopavo] gi|344268884|ref|XP_003406286.1| PREDICTED: thioredoxin-like protein 4A-like [Loxodonta africana] gi|410977885|ref|XP_003995329.1| PREDICTED: thioredoxin-like protein 4A [Felis catus] gi|426253527|ref|XP_004020444.1| PREDICTED: thioredoxin-like protein 4A [Ovis aries] gi|281349237|gb|EFB24821.1| hypothetical protein PANDA_009153 [Ailuropoda melanoleuca] gi|296473912|tpg|DAA16027.1| TPA: thioredoxin-like 4A [Bos taurus] gi|328909081|gb|AEB61208.1| thioredoxin-like protein 4A-like protein [Equus caballus] gi|431907033|gb|ELK11152.1| Thioredoxin-like protein 4A [Pteropus alecto] gi|432105441|gb|ELK31656.1| Thioredoxin-like protein 4A [Myotis davidii] gi|440896295|gb|ELR48269.1| Thioredoxin-like protein 4A [Bos grunniens mutus] Back     alignment and taxonomy information
>gi|170041711|ref|XP_001848597.1| mitosis protein dim1 [Culex quinquefasciatus] gi|167865257|gb|EDS28640.1| mitosis protein dim1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|391339696|ref|XP_003744183.1| PREDICTED: thioredoxin-like protein 4A-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|5729802|ref|NP_006692.1| thioredoxin-like protein 4A [Homo sapiens] gi|13384656|ref|NP_079575.1| thioredoxin-like protein 4A isoform a [Mus musculus] gi|386780898|ref|NP_001247795.1| thioredoxin-like protein 4A [Macaca mulatta] gi|296222921|ref|XP_002757397.1| PREDICTED: thioredoxin-like protein 4A-like [Callithrix jacchus] gi|332262376|ref|XP_003280237.1| PREDICTED: thioredoxin-like protein 4A [Nomascus leucogenys] gi|348555102|ref|XP_003463363.1| PREDICTED: thioredoxin-like protein 4A-like [Cavia porcellus] gi|354479374|ref|XP_003501886.1| PREDICTED: N-alpha-acetyltransferase 11, NatA catalytic subunit-like isoform 3 [Cricetulus griseus] gi|395830655|ref|XP_003788435.1| PREDICTED: thioredoxin-like protein 4A [Otolemur garnettii] gi|397467053|ref|XP_003805244.1| PREDICTED: thioredoxin-like protein 4A isoform 1 [Pan paniscus] gi|397467055|ref|XP_003805245.1| PREDICTED: thioredoxin-like protein 4A isoform 2 [Pan paniscus] gi|397467057|ref|XP_003805246.1| PREDICTED: thioredoxin-like protein 4A isoform 3 [Pan paniscus] gi|402903431|ref|XP_003914569.1| PREDICTED: thioredoxin-like protein 4A [Papio anubis] gi|426386305|ref|XP_004059627.1| PREDICTED: thioredoxin-like protein 4A [Gorilla gorilla gorilla] gi|46577662|sp|P83876.1|TXN4A_HUMAN RecName: Full=Thioredoxin-like protein 4A; AltName: Full=DIM1 protein homolog; AltName: Full=Spliceosomal U5 snRNP-specific 15 kDa protein; AltName: Full=Thioredoxin-like U5 snRNP protein U5-15kD gi|46577663|sp|P83877.1|TXN4A_MOUSE RecName: Full=Thioredoxin-like protein 4A; AltName: Full=DIM1 protein homolog; AltName: Full=Spliceosomal U5 snRNP-specific 15 kDa protein; AltName: Full=Thioredoxin-like U5 snRNP protein U5-15kD gi|6730460|pdb|1QGV|A Chain A, Human Spliceosomal Protein U5-15kd gi|82407298|pdb|1SYX|A Chain A, The Crystal Structure Of A Binary U5 Snrnp Complex gi|82407300|pdb|1SYX|C Chain C, The Crystal Structure Of A Binary U5 Snrnp Complex gi|82407302|pdb|1SYX|E Chain E, The Crystal Structure Of A Binary U5 Snrnp Complex gi|6572636|gb|AAF17332.1|AF146373_1 thioredoxin-like U5 snRNP protein U5-15kD [Homo sapiens] gi|2565275|gb|AAB81950.1| Dim1p homolog [Homo sapiens] gi|12654441|gb|AAH01046.1| Thioredoxin-like 4A [Homo sapiens] gi|12835058|dbj|BAB23137.1| unnamed protein product [Mus musculus] gi|12840811|dbj|BAB24966.1| unnamed protein product [Mus musculus] gi|17939455|gb|AAH19272.1| Thioredoxin-like 4A [Homo sapiens] gi|21595023|gb|AAH31634.1| Txnl4a protein [Mus musculus] gi|74151380|dbj|BAE38809.1| unnamed protein product [Mus musculus] gi|74201684|dbj|BAE28459.1| unnamed protein product [Mus musculus] gi|119587044|gb|EAW66640.1| thioredoxin-like 4A, isoform CRA_b [Homo sapiens] gi|148677469|gb|EDL09416.1| mCG18172, isoform CRA_c [Mus musculus] gi|149015925|gb|EDL75232.1| similar to DNA segment, Chr 18, Wayne State University 98, expressed (predicted), isoform CRA_b [Rattus norvegicus] gi|189067433|dbj|BAG37415.1| unnamed protein product [Homo sapiens] gi|261860602|dbj|BAI46823.1| thioredoxin-like protein 4A [synthetic construct] gi|325463865|gb|ADZ15703.1| thioredoxin-like 4A [synthetic construct] gi|380783349|gb|AFE63550.1| thioredoxin-like protein 4A [Macaca mulatta] gi|383414455|gb|AFH30441.1| thioredoxin-like protein 4A [Macaca mulatta] gi|384944932|gb|AFI36071.1| thioredoxin-like protein 4A [Macaca mulatta] gi|410208702|gb|JAA01570.1| thioredoxin-like 4A [Pan troglodytes] gi|410259812|gb|JAA17872.1| thioredoxin-like 4A [Pan troglodytes] gi|410299262|gb|JAA28231.1| thioredoxin-like 4A [Pan troglodytes] gi|410340531|gb|JAA39212.1| thioredoxin-like 4A [Pan troglodytes] Back     alignment and taxonomy information
>gi|321461719|gb|EFX72748.1| hypothetical protein DAPPUDRAFT_308067 [Daphnia pulex] Back     alignment and taxonomy information
>gi|350536925|ref|NP_001233254.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss] gi|209733586|gb|ACI67662.1| Thioredoxin-like protein 4A [Salmo salar] gi|221220248|gb|ACM08785.1| Thioredoxin-like protein 4A [Salmo salar] gi|221221168|gb|ACM09245.1| Thioredoxin-like protein 4A [Salmo salar] gi|225703746|gb|ACO07719.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss] gi|225703876|gb|ACO07784.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss] gi|225704250|gb|ACO07971.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss] gi|225704498|gb|ACO08095.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss] gi|225705790|gb|ACO08741.1| Thioredoxin-like protein 4A [Oncorhynchus mykiss] gi|303665643|gb|ADM16191.1| Thioredoxin-like protein 4A [Salmo salar] Back     alignment and taxonomy information
>gi|54400404|ref|NP_001005953.1| thioredoxin-like protein 4A [Danio rerio] gi|53734161|gb|AAH83448.1| Zgc:103632 [Danio rerio] gi|182890994|gb|AAI64224.1| Zgc:103632 protein [Danio rerio] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query160
UNIPROTKB|E1C1X5142 TXNL4A "Uncharacterized protei 0.725 0.816 0.965 6.4e-60
UNIPROTKB|F1MTU6142 TXNL4A "Uncharacterized protei 0.725 0.816 0.965 6.4e-60
UNIPROTKB|E2R204142 TXNL4A "Uncharacterized protei 0.725 0.816 0.965 6.4e-60
UNIPROTKB|F1RZA0142 TXNL4A "Uncharacterized protei 0.725 0.816 0.965 6.4e-60
UNIPROTKB|P83876142 TXNL4A "Thioredoxin-like prote 0.725 0.816 0.956 8.1e-60
ZFIN|ZDB-GENE-041010-25142 txnl4a "thioredoxin-like 4A" [ 0.725 0.816 0.965 1.3e-59
FB|FBgn0031601142 Dim1 "Dim1" [Drosophila melano 0.725 0.816 0.956 5.7e-59
TAIR|locus:2150768142 YLS8 "AT5G08290" [Arabidopsis 0.725 0.816 0.870 5.5e-54
GENEDB_PFALCIPARUM|PFL1520w139 PFL1520w "dim1 protein homolog 0.718 0.827 0.773 2.5e-49
UNIPROTKB|G4MT32143 MGG_07115 "Thioredoxin-like pr 0.762 0.853 0.754 2.3e-48
UNIPROTKB|E1C1X5 TXNL4A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 614 (221.2 bits), Expect = 6.4e-60, P = 6.4e-60
 Identities = 112/116 (96%), Positives = 115/116 (99%)

Query:    45 VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFR 104
             VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDIT+VPDFNKMYELYDPCT MFFFR
Sbjct:    27 VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFR 86

Query:   105 NKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY 160
             NKHIMIDLGTGNNNKINWA+EDKQEMIDI+ETVYRGARKGRGLVVSPKDYSTKYRY
Sbjct:    87 NKHIMIDLGTGNNNKINWAMEDKQEMIDIIETVYRGARKGRGLVVSPKDYSTKYRY 142
GO:0005681 "spliceosomal complex" evidence=IEA
GO:0007067 "mitosis" evidence=IEA
UNIPROTKB|F1MTU6 TXNL4A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R204 TXNL4A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RZA0 TXNL4A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P83876 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041010-25 txnl4a "thioredoxin-like 4A" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0031601 Dim1 "Dim1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
TAIR|locus:2150768 YLS8 "AT5G08290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
GENEDB_PFALCIPARUM|PFL1520w PFL1520w "dim1 protein homolog, putative" [Plasmodium falciparum (taxid:5833)] Back     alignment and assigned GO terms
UNIPROTKB|G4MT32 MGG_07115 "Thioredoxin-like protein 4A" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q75BD8DIB1_ASHGONo assigned EC number0.68140.70620.7902yesN/A
P83876TXN4A_HUMANNo assigned EC number0.95680.7250.8169yesN/A
Q06819DIB1_YEASTNo assigned EC number0.67250.70620.7902yesN/A
Q553S5TXN4A_DICDINo assigned EC number0.74130.7250.725yesN/A
Q6FMI2DIB1_CANGANo assigned EC number0.62830.70620.7957yesN/A
P87215DIMI_SCHPONo assigned EC number0.79310.7250.8169yesN/A
P83877TXN4A_MOUSENo assigned EC number0.95680.7250.8169yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
PLN00410142 PLN00410, PLN00410, U5 snRNP protein, DIM1 family; 5e-83
pfam02966133 pfam02966, DIM1, Mitosis protein DIM1 3e-75
cd02954114 cd02954, DIM1, Dim1 family; Dim1 is also referred 4e-63
cd02986114 cd02986, DLP, Dim1 family, Dim1-like protein (DLP) 9e-22
cd00252116 cd00252, SPARC_EC, SPARC_EC; extracellular Ca2+ bi 1e-12
pfam10591112 pfam10591, SPARC_Ca_bdg, Secreted protein acidic a 2e-11
>gnl|CDD|215109 PLN00410, PLN00410, U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information 
 Score =  240 bits (614), Expect = 5e-83
 Identities = 104/116 (89%), Positives = 110/116 (94%)

Query: 45  VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFR 104
           VIRFGHDWD TCM+MDEVL S+AE +KNFAVIYLVDIT+VPDFN MYELYDPCT MFFFR
Sbjct: 27  VIRFGHDWDETCMQMDEVLASVAETIKNFAVIYLVDITEVPDFNTMYELYDPCTVMFFFR 86

Query: 105 NKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY 160
           NKHIMIDLGTGNNNKINWAL+DKQE IDIVETVYRGARKGRGLV+SPKDYSTKYRY
Sbjct: 87  NKHIMIDLGTGNNNKINWALKDKQEFIDIVETVYRGARKGRGLVISPKDYSTKYRY 142

Length = 142
>gnl|CDD|190488 pfam02966, DIM1, Mitosis protein DIM1 Back     alignment and domain information
>gnl|CDD|239252 cd02954, DIM1, Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>gnl|CDD|239284 cd02986, DLP, Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>gnl|CDD|238155 cd00252, SPARC_EC, SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>gnl|CDD|204523 pfam10591, SPARC_Ca_bdg, Secreted protein acidic and rich in cysteine Ca binding region Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 160
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 100.0
KOG3414|consensus142 100.0
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 100.0
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 100.0
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.9
KOG3555|consensus434 99.4
cd00252116 SPARC_EC SPARC_EC; extracellular Ca2+ binding doma 99.05
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 98.17
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 98.05
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 97.72
PRK10996139 thioredoxin 2; Provisional 97.6
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 97.58
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 97.5
cd0294793 TRX_family TRX family; composed of two groups: Gro 97.47
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 97.43
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 97.34
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 97.19
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 97.14
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 97.14
PF1320225 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ 97.1
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 97.06
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 97.05
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 97.04
KOG4578|consensus421 97.02
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 96.99
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 96.95
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 96.95
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 96.95
cd02962152 TMX2 TMX2 family; composed of proteins similar to 96.94
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 96.92
PRK09381109 trxA thioredoxin; Provisional 96.81
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 96.81
PTZ0005198 thioredoxin; Provisional 96.81
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 96.79
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 96.79
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 96.67
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 96.64
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 96.59
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 96.56
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 96.54
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 96.52
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 96.47
PHA02278103 thioredoxin-like protein 96.47
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 96.27
PTZ00443224 Thioredoxin domain-containing protein; Provisional 96.22
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 96.21
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 96.16
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 96.15
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 96.11
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 96.0
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 95.98
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 95.9
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 95.67
KOG0910|consensus150 95.62
cd02955124 SSP411 TRX domain, SSP411 protein family; members 95.49
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 95.47
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 95.28
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 95.11
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 95.09
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 94.91
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 94.82
PTZ00062204 glutaredoxin; Provisional 94.73
PLN02309457 5'-adenylylsulfate reductase 94.18
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 94.08
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 93.9
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 93.5
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 93.46
PF1383354 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 93.16
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 93.14
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 93.04
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 92.75
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 92.65
KOG0907|consensus106 92.22
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 92.18
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 90.51
PTZ00102477 disulphide isomerase; Provisional 89.15
PRK00293571 dipZ thiol:disulfide interchange protein precursor 89.0
cd0005267 EH Eps15 homology domain; found in proteins implic 88.61
PTZ00102 477 disulphide isomerase; Provisional 88.22
TIGR02740271 TraF-like TraF-like protein. This protein is relat 88.11
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 87.38
COG3118 304 Thioredoxin domain-containing protein [Posttransla 86.36
cd02958114 UAS UAS family; UAS is a domain of unknown functio 85.84
PHA0212575 thioredoxin-like protein 85.44
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 84.11
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 83.91
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information 
Probab=100.00  E-value=1.8e-71  Score=434.39  Aligned_cols=123  Identities=77%  Similarity=1.330  Sum_probs=108.6

Q ss_pred             cCChhhHHhhh-------hhhhhccCCCChhhhhhHHHHHHHHHhhhcceEEEEEeCCccccccccccccccceeeeeee
Q psy4160          32 ELNEDEIEDQC-------EDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFR  104 (160)
Q Consensus        32 ~L~e~~~d~rc-------~~viRFGrd~dp~Cm~mDevL~kia~kvknfavIYlvDi~~Vpdfn~myeL~dP~tvmFFfr  104 (160)
                      +|+++|..++.       .+||||||+|||+||+|||+|+++|++|||||+||+||+++||+||+||||+||||||||||
T Consensus         4 ~L~s~~~VDqAI~~e~drvvViRFG~d~d~~Cm~mDeiL~~~a~~v~~~a~IY~vDi~~Vpdfn~~yel~dP~tvmFF~r   83 (133)
T PF02966_consen    4 HLHSGWHVDQAILSEEDRVVVIRFGRDWDPVCMQMDEILYKIAEKVKNFAVIYLVDIDEVPDFNQMYELYDPCTVMFFFR   83 (133)
T ss_dssp             EE-SHHHHHHHHHH-SSSEEEEEEE-TTSHHHHHHHHHHHHHHHHHTTTEEEEEEETTTTHCCHHHTTS-SSEEEEEEET
T ss_pred             ccCccchHHHHHhccCceEEEEEeCCCCCccHHHHHHHHHHHHHHhhcceEEEEEEcccchhhhcccccCCCeEEEEEec
Confidence            46666555532       34899999999999999999999999999999999999999999999999999999999999


Q ss_pred             CceeEEecCCCCCceeeeecCChhHHHHHHHHHhhccccCCeeEECCCCc
Q psy4160         105 NKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDY  154 (160)
Q Consensus       105 nkHm~vD~GTgnnnKin~~~~~kqe~iDiie~iyrga~kGk~iv~sP~dy  154 (160)
                      |||||||+||||||||||++++|||||||||+|||||+||||||+||+||
T Consensus        84 nkhm~vD~GtgnnnKin~~~~~kqe~iDiie~iyrga~kGk~iv~sP~dy  133 (133)
T PF02966_consen   84 NKHMMVDFGTGNNNKINWAFEDKQEFIDIIETIYRGARKGKGIVVSPKDY  133 (133)
T ss_dssp             TEEEEEESSSSSSSSBCS--SCHHHHHHHHHHHHHHHHTT-SEEE-SS-G
T ss_pred             CeEEEEEecCCCccEEEEEcCcHHHHHHHHHHHHHHhhcCCeeEeCCCCC
Confidence            99999999999999999999999999999999999999999999999998

Thioredoxin serves as a general protein disulphide oxidoreductase. It interacts with a broad range of proteins by a redox mechanism based on reversible oxidation of 2 cysteine thiol groups to a disulphide, accompanied by the transfer of 2 electrons and 2 protons. The net result is the covalent interconversion of a disulphide and a dithiol. Compared to human thioredoxin, human U5 snRNP-specific protein U5-15kDa contains 37 additional residues that may cause structural changes which most likely form putative binding sites for other spliceosomal proteins or RNA. Although U5-15kDa apparently lacks protein disulphide isomerase activity, it is strictly required for pre-mRNA splicing [].; GO: 0007067 mitosis, 0005681 spliceosomal complex; PDB: 1SYX_E 1PQN_A 1QGV_A 2AV4_A 1XBS_A 3GIX_A.
>KOG3414|consensus Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>KOG3555|consensus Back     alignment and domain information
>cd00252 SPARC_EC SPARC_EC; extracellular Ca2+ binding domain (containing 2 EF-hand motifs) of SPARC and related proteins (QR1, SC1/hevin, testican and tsc-36/FRP) Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>PF13202 EF-hand_5: EF hand; PDB: 3DD4_A 2Q4U_A 2BE4_A 1UHJ_B 1UHI_A 1UHH_B 1EJ3_B 1UHK_A 2ZFD_A 1UHN_A Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>KOG4578|consensus Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>KOG0910|consensus Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PF13833 EF-hand_8: EF-hand domain pair; PDB: 3KF9_A 1TTX_A 1WLZ_A 1ALV_A 1NX3_A 1ALW_A 1NX2_A 1NX1_A 1NX0_A 1DF0_A Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>KOG0907|consensus Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd00052 EH Eps15 homology domain; found in proteins implicated in endocytosis, vesicle transport, and signal transduction Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
1qgv_A142 Human Spliceosomal Protein U5-15kd Length = 142 6e-64
1pqn_A127 Dominant Negative Human Hdim1 (Hdim1 1-128) Length 2e-55
2av4_A160 Crystal Structure Of Plasmodium Yoelii Thioredoxin- 6e-53
1xbs_A149 Crystal Structure Of Human Dim2: A Dim1-Like Protei 3e-19
3gix_A149 Crystal Structure Of Human Splicing Factor Dim2 Len 3e-19
2diy_A130 The Solution Structure Of The Thioredoxin Domain Of 3e-04
2wz9_A153 Crystal Structure Of The Thioredoxin Domain Of Huma 5e-04
>pdb|1QGV|A Chain A, Human Spliceosomal Protein U5-15kd Length = 142 Back     alignment and structure 
Iteration: 1

 Score =  239 bits (609), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 111/116 (95%), Positives = 115/116 (99%)
Query: 45  VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFR 104
           VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDIT+VPDFNKMYELYDPCT MFFFR
Sbjct: 27  VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFR 86
Query: 105 NKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY 160
           NKHIMIDLGTGNNNKINWA+EDKQEM+DI+ETVYRGARKGRGLVVSPKDYSTKYRY
Sbjct: 87  NKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY 142
>pdb|1PQN|A Chain A, Dominant Negative Human Hdim1 (Hdim1 1-128) Length = 127 Back     alignment and structure
>pdb|2AV4|A Chain A, Crystal Structure Of Plasmodium Yoelii Thioredoxin-like Protein 4a (dim1) Length = 160 Back     alignment and structure
>pdb|1XBS|A Chain A, Crystal Structure Of Human Dim2: A Dim1-Like Protein Length = 149 Back     alignment and structure
>pdb|3GIX|A Chain A, Crystal Structure Of Human Splicing Factor Dim2 Length = 149 Back     alignment and structure
>pdb|2DIY|A Chain A, The Solution Structure Of The Thioredoxin Domain Of Human Thioredoxin-Like Protein 2 Length = 130 Back     alignment and structure
>pdb|2WZ9|A Chain A, Crystal Structure Of The Thioredoxin Domain Of Human Txnl2 Length = 153 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query160
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 2e-65
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 3e-61
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 2e-52
1sra_A151 Sparc; extracellular matrix protein, calcium-bindi 5e-12
1nub_A229 Basement membrane protein BM-40; extracellular mod 7e-10
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Length = 142 Back     alignment and structure
 Score =  195 bits (496), Expect = 2e-65
 Identities = 112/122 (91%), Positives = 117/122 (95%)

Query: 39  EDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCT 98
           E+    VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDIT+VPDFNKMYELYDPCT
Sbjct: 21  EEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT 80

Query: 99  CMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKY 158
            MFFFRNKHIMIDLGTGNNNKINWA+EDKQEM+DI+ETVYRGARKGRGLVVSPKDYSTKY
Sbjct: 81  VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKY 140

Query: 159 RY 160
           RY
Sbjct: 141 RY 142
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Length = 160 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 Back     alignment and structure
>1sra_A Sparc; extracellular matrix protein, calcium-binding protein; 2.00A {Homo sapiens} SCOP: a.39.1.3 Length = 151 Back     alignment and structure
>1nub_A Basement membrane protein BM-40; extracellular module, glycoprotein, anti-adhesive protein, C binding, site-directed mutagenesis; HET: NAG; 2.80A {Homo sapiens} SCOP: a.39.1.3 g.3.11.3 g.68.1.1 PDB: 2v53_A* 1bmo_A* Length = 229 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 100.0
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 99.91
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.89
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 98.07
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 97.99
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 97.95
4euy_A105 Uncharacterized protein; structural genomics, PSI- 97.93
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 97.91
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 97.86
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 97.81
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 97.8
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 97.71
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 97.7
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 97.69
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 97.67
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 97.67
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 97.66
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 97.65
2yzu_A109 Thioredoxin; redox protein, electron transport, st 97.63
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 97.57
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 97.56
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 97.56
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 97.55
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 97.54
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 97.52
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 97.52
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 97.51
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 97.51
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 97.5
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 97.49
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 97.49
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 97.49
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 97.45
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 97.43
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 97.43
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 97.41
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 97.4
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 97.39
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 97.37
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 97.37
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 97.35
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 97.34
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 97.3
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 97.27
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 97.26
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 97.25
2l57_A126 Uncharacterized protein; structural genomics, unkn 97.23
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 97.22
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 97.2
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 97.2
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 97.19
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 97.19
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 97.16
1mek_A120 Protein disulfide isomerase; electron transport, r 97.16
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 97.12
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 97.12
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 97.11
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 97.1
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 97.09
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 97.07
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 97.07
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 97.01
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 96.99
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 96.95
1wmj_A130 Thioredoxin H-type; structural genomics, program f 96.91
2l5l_A136 Thioredoxin; structural genomics, electron transpo 96.89
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 96.85
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 96.78
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 96.76
2qsi_A137 Putative hydrogenase expression/formation protein; 96.75
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 96.75
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 96.72
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 96.7
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 96.69
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 96.54
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 96.52
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 96.47
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 96.43
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 96.43
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 95.34
3f9u_A172 Putative exported cytochrome C biogenesis-related; 96.27
1zma_A118 Bacterocin transport accessory protein; alpha-beta 96.12
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 96.1
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 96.07
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 96.0
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 95.98
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 95.9
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 95.88
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 95.88
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 95.82
2kuc_A130 Putative disulphide-isomerase; structural genomics 95.75
2lrn_A152 Thiol:disulfide interchange protein; structural ge 95.38
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 95.28
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 95.21
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 94.19
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 94.89
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 94.86
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 94.71
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 94.54
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 94.46
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 94.44
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 94.4
3ira_A173 Conserved protein; methanosarcina mazei,structural 94.31
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 94.19
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 94.16
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 94.1
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 94.0
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 93.96
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 93.81
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 93.64
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 93.61
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 93.39
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 93.16
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 93.13
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 93.08
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 93.02
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 93.0
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 92.73
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 92.62
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 92.56
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 92.45
2ywi_A196 Hypothetical conserved protein; uncharacterized co 92.36
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 92.28
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 92.17
3li6_A66 Calcium-binding protein; calcium signaling protein 92.12
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 91.91
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 91.83
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 91.72
3raz_A151 Thioredoxin-related protein; structural genomics, 91.48
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 91.44
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 91.3
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 91.05
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 90.77
2hls_A 243 Protein disulfide oxidoreductase; thioredoxin fold 90.77
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 90.69
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 90.51
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 90.4
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 90.39
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 90.25
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 89.85
3li6_A66 Calcium-binding protein; calcium signaling protein 89.84
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 89.63
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 89.27
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 88.7
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 88.66
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 88.56
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 88.55
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 88.47
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 88.26
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 88.15
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 87.84
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 87.8
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 87.73
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 87.72
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 87.7
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 87.57
2l5o_A153 Putative thioredoxin; structural genomics, unknown 87.52
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 87.5
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 87.48
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 87.48
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 87.45
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 87.04
4evm_A138 Thioredoxin family protein; structural genomics, n 87.0
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 86.79
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 86.73
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 86.59
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 86.42
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 86.34
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 86.31
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 86.24
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 86.02
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 85.92
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 85.71
1ttz_A87 Conserved hypothetical protein; structural genomic 85.32
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 85.19
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 85.14
2lrt_A152 Uncharacterized protein; structural genomics, thio 85.12
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 85.08
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 85.04
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 84.95
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 84.87
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 84.55
1avs_A90 Troponin C; muscle contraction, calcium-activated, 84.43
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 84.41
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 84.41
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 84.07
2jnf_A158 Troponin C; stretch activated muscle contraction, 83.91
1xk4_A93 Calgranulin A; S100 family, heterotetramer, metal 83.84
1qjt_A99 EH1, epidermal growth factor receptor substrate su 83.8
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 83.7
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 83.7
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 83.65
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 83.46
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 83.39
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 83.31
1c07_A95 Protein (epidermal growth factor receptor pathway 83.2
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 83.13
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 83.08
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 83.07
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 83.07
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 82.99
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 82.91
3rm1_A92 Protein S100-B; alpha-helical, EF hand, metal bind 82.81
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 82.42
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 82.37
3akb_A166 Putative calcium binding protein; EF-hand, metal b 82.2
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 82.15
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 82.05
1avs_A90 Troponin C; muscle contraction, calcium-activated, 81.89
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 81.81
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 81.73
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 81.7
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 81.64
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 81.58
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 81.57
2qc7_A240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 81.57
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 81.5
2lv7_A100 Calcium-binding protein 7; metal binding protein; 81.37
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 81.33
2hps_A186 Coelenterazine-binding protein with bound coelent; 81.13
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 81.12
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 81.11
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 81.08
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 81.06
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 81.04
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 81.04
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 81.04
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 81.0
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 80.94
3fwb_A161 Cell division control protein 31; gene gating, com 80.87
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 80.64
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 80.57
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 80.44
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 80.21
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 80.08
3akb_A166 Putative calcium binding protein; EF-hand, metal b 80.02
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
Probab=100.00  E-value=8.3e-42  Score=271.64  Aligned_cols=118  Identities=76%  Similarity=1.355  Sum_probs=110.3

Q ss_pred             hhhhhccCCCChhhhhhHHHHHHHHHhhhcceEEEEEeCCccccccccccccccceeeeeeeCceeEEecCCCCCceeee
Q psy4160          43 EDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINW  122 (160)
Q Consensus        43 ~~viRFGrd~dp~Cm~mDevL~kia~kvknfavIYlvDi~~Vpdfn~myeL~dP~tvmFFfrnkHm~vD~GTgnnnKin~  122 (160)
                      .+|++|+.+|.++|++|+.+|.++|++.++.+.+|.||+|++|++.++|++..++|+|||++++||+||+|||||||++|
T Consensus        43 ~VVVdF~A~WCgPCk~m~PvleelA~e~~~~v~f~kVDVDe~~e~a~~y~V~siPT~~fFk~G~~v~vd~Gtgd~~k~vG  122 (160)
T 2av4_A           43 LVCIRFGHDYDPDCMKMDELLYKVADDIKNFCVIYLVDITEVPDFNTMYELYDPVSVMFFYRNKHMMIDLGTGNNNKINW  122 (160)
T ss_dssp             EEEEEEECTTSHHHHHHHHHHHHHHHHHTTTEEEEEEETTTCCTTTTTTTCCSSEEEEEEETTEEEEEECSSSCCSCBCS
T ss_pred             EEEEEEECCCChhHHHHHHHHHHHHHHccCCcEEEEEECCCCHHHHHHcCCCCCCEEEEEECCEEEEEecCCCCcCeEEe
Confidence            47999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCChhHHHHHHHHHhhccccCCeeEECCCCcccccCC
Q psy4160         123 ALEDKQEMIDIVETVYRGARKGRGLVVSPKDYSTKYRY  160 (160)
Q Consensus       123 ~~~~kqe~iDiie~iyrga~kGk~iv~sP~dy~~~~~~  160 (160)
                      ++.+||+|+++||++||||+||||||+||+||||+|||
T Consensus       123 a~~~k~~l~~~ie~~~r~a~~g~~~v~~p~~~~~~~~~  160 (160)
T 2av4_A          123 PMNNKQEFIDIVETIFRGARKGRGLVISPKDYSTKYKY  160 (160)
T ss_dssp             CCCCHHHHHHHHHHHHHHHHTTCSEEECSSCC------
T ss_pred             ecCCHHHHHHHHHHHHHHhhcCCeEEECCCccchhccC
Confidence            99999999999999999999999999999999999997
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>1xk4_A Calgranulin A; S100 family, heterotetramer, metal binding protein; HET: FLC; 1.80A {Homo sapiens} SCOP: a.39.1.2 PDB: 1mr8_A Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>3rm1_A Protein S100-B; alpha-helical, EF hand, metal binding protein-protein bindin; 1.24A {Bos taurus} PDB: 3rlz_A 1cfp_A 3cr2_A 3cr4_X* 3cr5_X* 3gk1_A* 3gk2_A* 3gk4_X* 3iqo_A 3iqq_A 3lle_A* 1psb_A 3czt_X 2h61_A 3d0y_A* 3d10_A* 3hcm_A* 3lk1_A* 3lk0_A* 1b4c_A ... Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 160
d1qgva_137 c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human 6e-36
d1sraa_151 a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPAR 1e-12
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: spliceosomal protein U5-15Kd
domain: spliceosomal protein U5-15Kd
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  119 bits (299), Expect = 6e-36
 Identities = 111/137 (81%), Positives = 119/137 (86%), Gaps = 5/137 (3%)

Query: 20  HLITLKEWARCLELNEDEIEDQCEDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLV 79
           HL    +  + +   ED +      VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLV
Sbjct: 6   HLHNGWQVDQAILSEEDRVV-----VIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLV 60

Query: 80  DITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINWALEDKQEMIDIVETVYR 139
           DIT+VPDFNKMYELYDPCT MFFFRNKHIMIDLGTGNNNKINWA+EDKQEM+DI+ETVYR
Sbjct: 61  DITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYR 120

Query: 140 GARKGRGLVVSPKDYST 156
           GARKGRGLVVSPKDYST
Sbjct: 121 GARKGRGLVVSPKDYST 137
>d1sraa_ a.39.1.3 (A:) C-terminal (EC) domain of BM-40/SPARC/osteonectin {Human (Homo sapiens) [TaxId: 9606]} Length = 151 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query160
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 100.0
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 98.15
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 98.14
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 98.1
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 98.02
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 98.01
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.9
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 97.86
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.79
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 97.75
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 97.67
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 97.66
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 97.65
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 97.6
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 97.53
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 97.3
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 97.24
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 97.03
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 96.49
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 96.18
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 96.12
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 95.34
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 95.21
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 95.06
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 94.57
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 94.42
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 94.32
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 93.88
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 93.43
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 93.41
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 92.68
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 92.41
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 91.75
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 90.61
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 90.6
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 89.31
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 88.98
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 88.97
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 88.91
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 88.51
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 88.39
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 88.21
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 87.25
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 87.2
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 86.42
d1zfsa193 Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 86.4
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 86.07
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 85.55
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 85.38
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 85.13
d1a4pa_92 Calcyclin (S100) {Human (Homo sapiens), P11 s100a1 84.95
d3c1va193 Calcyclin (S100) {Human (Homo sapiens), s100a4 [Ta 84.92
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 84.72
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 84.66
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 84.58
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 84.57
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 84.27
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 83.84
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 83.38
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 83.35
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 83.07
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 83.01
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 82.93
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 82.88
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 82.86
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 82.13
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 81.77
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 81.71
d1qx2a_76 Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} 81.46
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 81.13
d1rmja_107 Insulin-like growth factor binding protein 6 {Huma 80.54
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: spliceosomal protein U5-15Kd
domain: spliceosomal protein U5-15Kd
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-33  Score=213.47  Aligned_cols=114  Identities=94%  Similarity=1.510  Sum_probs=104.9

Q ss_pred             hhhhhccCCCChhhhhhHHHHHHHHHhhhcceEEEEEeCCccccccccccccccceeeeeeeCceeEEecCCCCCceeee
Q psy4160          43 EDVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITKVPDFNKMYELYDPCTCMFFFRNKHIMIDLGTGNNNKINW  122 (160)
Q Consensus        43 ~~viRFGrd~dp~Cm~mDevL~kia~kvknfavIYlvDi~~Vpdfn~myeL~dP~tvmFFfrnkHm~vD~GTgnnnKin~  122 (160)
                      .+||.|+.+|-++|.+|+.+|.++|++.++.+.+|.||+++.|++.+.|.+...+|++||.+|+||++|+|+|+|+|+++
T Consensus        24 ~vvv~F~a~wC~~C~~~~p~l~~la~~~~~~v~~~~VDvd~~~~la~~~~I~~~PT~~~f~~g~~i~~~~g~~~~~k~~~  103 (137)
T d1qgva_          24 VVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCTVMFFFRNKHIMIDLGTGNNNKINW  103 (137)
T ss_dssp             EEEEEEECTTSHHHHHHHHHHHHHHHHHTTTEEEEEEETTTCCTTTTSSCSCSSCEEEEEETTEEEEEECC------CCS
T ss_pred             EEEEEEECCCCccchhcChHHHHHHHHhhccceEEEeeccccchhhhhcCeeeEEEEEEEeCCcEEEEEecCCCcceeee
Confidence            35899999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ecCChhHHHHHHHHHhhccccCCeeEECCCCccc
Q psy4160         123 ALEDKQEMIDIVETVYRGARKGRGLVVSPKDYST  156 (160)
Q Consensus       123 ~~~~kqe~iDiie~iyrga~kGk~iv~sP~dy~~  156 (160)
                      +++++|||+++||.+||||++|||+|+||+||||
T Consensus       104 ~l~~~~~~i~~ie~i~~~~~~gk~~~~sp~~~~~  137 (137)
T d1qgva_         104 AMEDKQEMVDIIETVYRGARKGRGLVVSPKDYST  137 (137)
T ss_dssp             CCSCHHHHHHHHHHHHHHHTTTCSEEECCCCCC-
T ss_pred             ehhhhHHHHHHHHHHHHHHhhCCceEeCCcccCC
Confidence            9999999999999999999999999999999997
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1zfsa1 a.39.1.2 (A:1-93) Calcyclin (S100) {Rat (Rattus norvegicus), s100a1 [TaxId: 10116]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a4pa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), P11 s100a10, calpactin [TaxId: 9606]} Back     information, alignment and structure
>d3c1va1 a.39.1.2 (A:2-94) Calcyclin (S100) {Human (Homo sapiens), s100a4 [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1qx2a_ a.39.1.1 (A:) Calbindin D9K {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1rmja_ g.28.1.1 (A:) Insulin-like growth factor binding protein 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure