Diaphorina citri psyllid: psy4164


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MSYMLGHLHNGWQVDQAILSEEDRVVIEEYLSVFVLRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRSYLLPKYEKLEAATFKRTAVSVESE
cccccccccccHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHccccccccccEECccccccHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccc
*SYMLGHLHNGWQVDQAILSEEDRVVIEEYLSVFVLRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRSYLLPKYEKLEAATF**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYMLGHLHNGWQVDQAILSEEDRVVIEEYLSVFVLRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRSYLLPKYEKLEAATFKRTAVSVESE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005681 [CC]spliceosomal complexprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0044422
GO:0007067 [BP]mitosisprobableGO:0006996, GO:0044699, GO:0000278, GO:0071840, GO:0009987, GO:0000280, GO:0016043, GO:0008150, GO:0022402, GO:0048285, GO:0044763, GO:0007049

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1A9N, chain A
Confidence level:very confident
Coverage over the Query: 36-119
View the alignment between query and template
View the model in PyMOL
Template: 2AV4, chain A
Confidence level:confident
Coverage over the Query: 4-32
View the alignment between query and template
View the model in PyMOL