Psyllid ID: psy4164
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 147 | ||||||
| 242007822 | 142 | mitosis protein dim1, putative [Pediculu | 0.183 | 0.190 | 0.962 | 9e-08 | |
| 357626133 | 142 | mitosis protein dim1 [Danaus plexippus] | 0.183 | 0.190 | 0.962 | 1e-07 | |
| 170041711 | 142 | mitosis protein dim1 [Culex quinquefasci | 0.183 | 0.190 | 0.925 | 5e-07 | |
| 31222366 | 142 | AGAP008298-PA [Anopheles gambiae str. PE | 0.183 | 0.190 | 0.925 | 6e-07 | |
| 157113361 | 142 | mitosis protein dim1 [Aedes aegypti] gi| | 0.183 | 0.190 | 0.925 | 6e-07 | |
| 91080733 | 142 | PREDICTED: similar to mitosis protein di | 0.183 | 0.190 | 0.925 | 6e-07 | |
| 443711305 | 142 | hypothetical protein CAPTEDRAFT_164052 [ | 0.183 | 0.190 | 0.962 | 6e-07 | |
| 327270008 | 142 | PREDICTED: thioredoxin-like protein 4A-l | 0.204 | 0.211 | 0.833 | 7e-07 | |
| 156550769 | 142 | PREDICTED: thioredoxin-like protein 4A-l | 0.183 | 0.190 | 0.925 | 7e-07 | |
| 66533106 | 142 | PREDICTED: thioredoxin-like protein 4A-l | 0.183 | 0.190 | 0.925 | 7e-07 |
| >gi|242007822|ref|XP_002424719.1| mitosis protein dim1, putative [Pediculus humanus corporis] gi|212508212|gb|EEB11981.1| mitosis protein dim1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 62.0 bits (149), Expect = 9e-08, Method: Compositional matrix adjust.
Identities = 26/27 (96%), Positives = 27/27 (100%)
Query: 1 MSYMLGHLHNGWQVDQAILSEEDRVVI 27
MSYMLGHLHNGWQVDQAILSEEDRVV+
Sbjct: 1 MSYMLGHLHNGWQVDQAILSEEDRVVV 27
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|357626133|gb|EHJ76331.1| mitosis protein dim1 [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|170041711|ref|XP_001848597.1| mitosis protein dim1 [Culex quinquefasciatus] gi|167865257|gb|EDS28640.1| mitosis protein dim1 [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|31222366|ref|XP_317168.1| AGAP008298-PA [Anopheles gambiae str. PEST] gi|21300089|gb|EAA12234.1| AGAP008298-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|157113361|ref|XP_001657795.1| mitosis protein dim1 [Aedes aegypti] gi|94469104|gb|ABF18401.1| U4/U6.U5 snRNP/mitosis protein DIM1 component [Aedes aegypti] gi|108877785|gb|EAT42010.1| AAEL006401-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|91080733|ref|XP_975428.1| PREDICTED: similar to mitosis protein dim1 [Tribolium castaneum] gi|270006427|gb|EFA02875.1| thioredoxin-like 4A [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|443711305|gb|ELU05133.1| hypothetical protein CAPTEDRAFT_164052 [Capitella teleta] gi|443722557|gb|ELU11364.1| hypothetical protein CAPTEDRAFT_97509 [Capitella teleta] | Back alignment and taxonomy information |
|---|
| >gi|327270008|ref|XP_003219784.1| PREDICTED: thioredoxin-like protein 4A-like [Anolis carolinensis] gi|327291099|ref|XP_003230259.1| PREDICTED: thioredoxin-like protein 4A-like [Anolis carolinensis] | Back alignment and taxonomy information |
|---|
| >gi|156550769|ref|XP_001605455.1| PREDICTED: thioredoxin-like protein 4A-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|66533106|ref|XP_624360.1| PREDICTED: thioredoxin-like protein 4A-like [Apis mellifera] gi|340715438|ref|XP_003396220.1| PREDICTED: thioredoxin-like protein 4A-like [Bombus terrestris] gi|350414516|ref|XP_003490342.1| PREDICTED: thioredoxin-like protein 4A-like [Bombus impatiens] gi|380013410|ref|XP_003690753.1| PREDICTED: thioredoxin-like protein 4A-like [Apis florea] gi|383861978|ref|XP_003706461.1| PREDICTED: thioredoxin-like protein 4A-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 147 | ||||||
| FB|FBgn0031601 | 142 | Dim1 "Dim1" [Drosophila melano | 0.183 | 0.190 | 0.925 | 4.7e-09 | |
| UNIPROTKB|E1C1X5 | 142 | TXNL4A "Uncharacterized protei | 0.183 | 0.190 | 0.925 | 4.7e-09 | |
| UNIPROTKB|F1MTU6 | 142 | TXNL4A "Uncharacterized protei | 0.183 | 0.190 | 0.925 | 4.7e-09 | |
| UNIPROTKB|E2R204 | 142 | TXNL4A "Uncharacterized protei | 0.183 | 0.190 | 0.925 | 4.7e-09 | |
| UNIPROTKB|K7EJU2 | 57 | TXNL4A "Thioredoxin-like prote | 0.183 | 0.473 | 0.925 | 4.7e-09 | |
| UNIPROTKB|K7EMX5 | 86 | TXNL4A "Thioredoxin-like prote | 0.183 | 0.313 | 0.925 | 4.7e-09 | |
| UNIPROTKB|K7EPA6 | 54 | TXNL4A "Thioredoxin-like prote | 0.183 | 0.5 | 0.925 | 4.7e-09 | |
| UNIPROTKB|K7ES07 | 103 | TXNL4A "Thioredoxin-like prote | 0.183 | 0.262 | 0.925 | 4.7e-09 | |
| UNIPROTKB|O14835 | 91 | TXNL4A "Dim1p homolog" [Homo s | 0.183 | 0.296 | 0.925 | 4.7e-09 | |
| UNIPROTKB|P83876 | 142 | TXNL4A "Thioredoxin-like prote | 0.183 | 0.190 | 0.925 | 4.7e-09 |
| FB|FBgn0031601 Dim1 "Dim1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 134 (52.2 bits), Expect = 4.7e-09, P = 4.7e-09
Identities = 25/27 (92%), Positives = 26/27 (96%)
Query: 1 MSYMLGHLHNGWQVDQAILSEEDRVVI 27
MSYML HLHNGWQVDQAILSEEDRVV+
Sbjct: 1 MSYMLPHLHNGWQVDQAILSEEDRVVV 27
|
|
| UNIPROTKB|E1C1X5 TXNL4A "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MTU6 TXNL4A "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R204 TXNL4A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7EJU2 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7EMX5 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7EPA6 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7ES07 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O14835 TXNL4A "Dim1p homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P83876 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 147 | |||
| PLN00410 | 142 | PLN00410, PLN00410, U5 snRNP protein, DIM1 family; | 7e-10 | |
| pfam02966 | 133 | pfam02966, DIM1, Mitosis protein DIM1 | 2e-07 | |
| cd02954 | 114 | cd02954, DIM1, Dim1 family; Dim1 is also referred | 3e-04 |
| >gnl|CDD|215109 PLN00410, PLN00410, U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
Score = 53.7 bits (129), Expect = 7e-10
Identities = 19/27 (70%), Positives = 25/27 (92%)
Query: 1 MSYMLGHLHNGWQVDQAILSEEDRVVI 27
MSY+L HLH+GW VDQAIL+EE+R+V+
Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVV 27
|
Length = 142 |
| >gnl|CDD|190488 pfam02966, DIM1, Mitosis protein DIM1 | Back alignment and domain information |
|---|
| >gnl|CDD|239252 cd02954, DIM1, Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 147 | |||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 99.81 | |
| KOG1644|consensus | 233 | 99.66 | ||
| KOG2123|consensus | 388 | 99.47 | ||
| KOG2982|consensus | 418 | 98.98 | ||
| KOG2739|consensus | 260 | 98.96 | ||
| KOG3207|consensus | 505 | 98.77 | ||
| KOG3414|consensus | 142 | 98.75 | ||
| KOG3763|consensus | 585 | 98.61 | ||
| KOG1259|consensus | 490 | 98.53 | ||
| PF02966 | 133 | DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th | 98.19 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.97 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 97.69 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.47 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.42 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.4 | |
| smart00446 | 26 | LRRcap occurring C-terminal to leucine-rich repeat | 97.34 | |
| KOG1644|consensus | 233 | 97.02 | ||
| KOG1859|consensus | 1096 | 96.99 | ||
| KOG0531|consensus | 414 | 96.88 | ||
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 96.34 | |
| KOG0617|consensus | 264 | 96.33 | ||
| KOG0618|consensus | 1081 | 95.98 | ||
| KOG4579|consensus | 177 | 95.42 | ||
| KOG3665|consensus | 699 | 95.41 | ||
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 95.16 | |
| KOG0531|consensus | 414 | 95.12 | ||
| KOG2123|consensus | 388 | 95.06 | ||
| PLN00410 | 142 | U5 snRNP protein, DIM1 family; Provisional | 94.99 | |
| KOG4194|consensus | 873 | 94.87 | ||
| KOG2982|consensus | 418 | 94.85 | ||
| KOG2739|consensus | 260 | 94.78 | ||
| KOG0618|consensus | 1081 | 94.75 | ||
| KOG3207|consensus | 505 | 94.4 | ||
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 94.36 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 94.36 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 94.18 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 94.08 | |
| KOG1259|consensus | 490 | 94.03 | ||
| KOG0617|consensus | 264 | 93.63 | ||
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 93.55 | |
| KOG4237|consensus | 498 | 93.51 | ||
| KOG4194|consensus | 873 | 93.34 | ||
| KOG0472|consensus | 565 | 93.34 | ||
| KOG3665|consensus | 699 | 92.89 | ||
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 92.83 | |
| KOG4237|consensus | 498 | 92.44 | ||
| PLN03150 | 623 | hypothetical protein; Provisional | 92.33 | |
| KOG1859|consensus | 1096 | 91.01 | ||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 90.39 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 90.35 | |
| KOG1909|consensus | 382 | 90.3 | ||
| KOG3864|consensus | 221 | 89.69 | ||
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 88.5 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 88.12 | |
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 87.2 | |
| KOG0444|consensus | 1255 | 85.99 | ||
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 83.93 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 83.64 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 82.69 | |
| KOG0472|consensus | 565 | 82.32 | ||
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 82.22 |
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
Probab=99.81 E-value=9e-21 Score=145.71 Aligned_cols=83 Identities=31% Similarity=0.468 Sum_probs=52.6
Q ss_pred hccccccEEEeeCCCccchhhhhhhhhccCccccccccccccCcccCcccHHHHHHHHCCCCccccCcccCHHHHHHHHH
Q psy4164 37 RRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNA 116 (147)
Q Consensus 37 ~~l~~L~~L~L~~N~I~~~~~l~~L~~~~lp~L~~Ld~~l~gNPv~~~~~YR~~vi~~lp~L~~LD~~~Vt~~eR~~A~~ 116 (147)
..||+|+.|+|++|+|.++.++..|.. +|+|+.| .+.|||+|+.++||.+|++.+|+|+.|||..|+++||+.|+.
T Consensus 85 ~~lp~L~~L~L~~N~I~~l~~l~~L~~--l~~L~~L--~L~~NPv~~~~~YR~~vi~~lP~Lk~LD~~~V~~~ER~~A~~ 160 (175)
T PF14580_consen 85 KNLPNLQELYLSNNKISDLNELEPLSS--LPKLRVL--SLEGNPVCEKKNYRLFVIYKLPSLKVLDGQDVTEEERQEAEK 160 (175)
T ss_dssp HH-TT--EEE-TTS---SCCCCGGGGG---TT--EE--E-TT-GGGGSTTHHHHHHHH-TT-SEETTEETTS-B------
T ss_pred HhCCcCCEEECcCCcCCChHHhHHHHc--CCCccee--eccCCcccchhhHHHHHHHHcChhheeCCEEccHHHhccccc
Confidence 368999999999999999999999987 9999999 799999999999999999999999999999999999999999
Q ss_pred HHHHHhh
Q psy4164 117 LNAEIRS 123 (147)
Q Consensus 117 ~~~~~~~ 123 (147)
+|..-+.
T Consensus 161 ~f~~~~~ 167 (175)
T PF14580_consen 161 LFKGKRA 167 (175)
T ss_dssp -------
T ss_pred ccccccc
Confidence 9876443
|
|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >KOG2739|consensus | Back alignment and domain information |
|---|
| >KOG3207|consensus | Back alignment and domain information |
|---|
| >KOG3414|consensus | Back alignment and domain information |
|---|
| >KOG3763|consensus | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >smart00446 LRRcap occurring C-terminal to leucine-rich repeats | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >KOG1859|consensus | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >KOG3665|consensus | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >PLN00410 U5 snRNP protein, DIM1 family; Provisional | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >KOG2739|consensus | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >KOG3207|consensus | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >KOG3665|consensus | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1859|consensus | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909|consensus | Back alignment and domain information |
|---|
| >KOG3864|consensus | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 147 | ||||
| 1qgv_A | 142 | Human Spliceosomal Protein U5-15kd Length = 142 | 2e-09 | ||
| 1pqn_A | 127 | Dominant Negative Human Hdim1 (Hdim1 1-128) Length | 9e-09 | ||
| 2av4_A | 160 | Crystal Structure Of Plasmodium Yoelii Thioredoxin- | 9e-04 |
| >pdb|1QGV|A Chain A, Human Spliceosomal Protein U5-15kd Length = 142 | Back alignment and structure |
|
| >pdb|1PQN|A Chain A, Dominant Negative Human Hdim1 (Hdim1 1-128) Length = 127 | Back alignment and structure |
| >pdb|2AV4|A Chain A, Crystal Structure Of Plasmodium Yoelii Thioredoxin-like Protein 4a (dim1) Length = 160 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 147 | |||
| 1qgv_A | 142 | Spliceosomal protein U5-15KD; snRNP, thioredoxin, | 3e-11 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 2e-10 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-09 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 7e-08 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 6e-09 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 2e-07 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-08 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-07 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 3e-08 | |
| 3gix_A | 149 | Thioredoxin-like protein 4B; PRE-mRNA splicing, TX | 9e-08 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 3e-06 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 1e-05 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 3e-04 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 9e-04 |
| >1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Length = 142 | Back alignment and structure |
|---|
Score = 56.6 bits (136), Expect = 3e-11
Identities = 25/27 (92%), Positives = 26/27 (96%)
Query: 1 MSYMLGHLHNGWQVDQAILSEEDRVVI 27
MSYML HLHNGWQVDQAILSEEDRVV+
Sbjct: 1 MSYMLPHLHNGWQVDQAILSEEDRVVV 27
|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Length = 160 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 147 | |||
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.29 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 99.26 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.14 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.72 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.61 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.14 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.9 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 97.78 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.76 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.59 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 97.49 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 97.47 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.41 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.41 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.36 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.36 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 97.35 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 97.33 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.33 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 97.3 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 97.29 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 97.28 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 97.2 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.14 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 97.14 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.09 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.08 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 97.05 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 97.01 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 96.94 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 96.92 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.88 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 96.87 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 96.87 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 96.85 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 96.83 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 96.82 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 96.81 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 96.78 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.77 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 96.75 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 96.72 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 96.71 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 96.68 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.65 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 96.63 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 96.63 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.62 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 96.61 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 96.54 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 96.53 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.5 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.5 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.48 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 96.46 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 96.45 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 96.44 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 96.44 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 96.43 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 96.42 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 96.42 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 96.38 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 96.28 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 96.28 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.28 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 96.27 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 96.27 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 96.26 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 96.23 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 96.22 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 96.19 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 96.18 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 96.18 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 96.18 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 96.15 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 96.15 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 96.15 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 96.14 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 96.12 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 96.11 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 96.05 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.03 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 96.03 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 96.0 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 95.98 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 95.98 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 95.98 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 95.97 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 95.95 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 95.9 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 95.89 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 95.89 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 95.88 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 95.81 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 95.81 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 95.79 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 95.77 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 95.76 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 95.73 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 95.71 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 95.68 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 95.66 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 95.64 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 95.63 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 95.62 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 95.56 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 95.55 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 95.51 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 95.44 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 95.39 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 95.39 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 95.36 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 95.35 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 95.23 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 95.22 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 95.18 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 95.18 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 95.17 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 95.15 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 95.11 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 95.11 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 95.03 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 94.92 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 94.91 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 94.9 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 94.84 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 94.84 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 94.74 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 94.66 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 94.65 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 94.57 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 94.45 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 94.42 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 94.22 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 94.21 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 94.19 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 94.17 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 94.14 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 93.95 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 93.95 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 93.89 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 93.85 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 93.78 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 93.77 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 93.75 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 93.69 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 93.61 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 91.4 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 91.21 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 89.9 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 87.8 | |
| 2av4_A | 160 | Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI | 86.0 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 80.25 |
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
Probab=99.29 E-value=1.1e-11 Score=91.47 Aligned_cols=81 Identities=23% Similarity=0.338 Sum_probs=73.6
Q ss_pred hhccccccEEEeeCCCccchhhhhhhhhccCccccccccccccCcccCcccHHHHHHHHCCCCccccCcccCHHHHHHHH
Q psy4164 36 LRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETN 115 (147)
Q Consensus 36 L~~l~~L~~L~L~~N~I~~~~~l~~L~~~~lp~L~~Ld~~l~gNPv~~~~~YR~~vi~~lp~L~~LD~~~Vt~~eR~~A~ 115 (147)
+..+++|+.|+|++|+|+++..+..+.. +++|+.| .+.+||++..+.||..++..+|+|+.||...++.+||..|+
T Consensus 84 ~~~l~~L~~L~L~~N~i~~~~~~~~l~~--l~~L~~L--~l~~N~i~~~~~~~~~~~~~l~~L~~Ld~~~n~~~~~~~~~ 159 (176)
T 1a9n_A 84 DQALPDLTELILTNNSLVELGDLDPLAS--LKSLTYL--CILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAE 159 (176)
T ss_dssp HHHCTTCCEEECCSCCCCCGGGGGGGGG--CTTCCEE--ECCSSGGGGSTTHHHHHHHHCTTCSEETTEECCHHHHHHHH
T ss_pred hhcCCCCCEEECCCCcCCcchhhHhhhc--CCCCCEE--EecCCCCCCcHhHHHHHHHHCCccceeCCCcCCHHHHHHHH
Confidence 3788999999999999999888777766 8999999 69999999999999999999999999999999999999999
Q ss_pred HHHHH
Q psy4164 116 ALNAE 120 (147)
Q Consensus 116 ~~~~~ 120 (147)
.++..
T Consensus 160 ~~~~~ 164 (176)
T 1a9n_A 160 KMFKG 164 (176)
T ss_dssp HTTC-
T ss_pred HHHhc
Confidence 88644
|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 147 | ||||
| d1qgva_ | 137 | c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human | 1e-08 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 1e-04 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 2e-04 |
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Thioredoxin fold superfamily: Thioredoxin-like family: spliceosomal protein U5-15Kd domain: spliceosomal protein U5-15Kd species: Human (Homo sapiens) [TaxId: 9606]
Score = 48.6 bits (115), Expect = 1e-08
Identities = 24/26 (92%), Positives = 25/26 (96%)
Query: 2 SYMLGHLHNGWQVDQAILSEEDRVVI 27
SYML HLHNGWQVDQAILSEEDRVV+
Sbjct: 1 SYMLPHLHNGWQVDQAILSEEDRVVV 26
|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 147 | |||
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.72 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.55 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 99.31 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.05 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.11 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.8 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 97.78 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.74 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.68 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 97.67 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.53 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 97.49 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.41 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.35 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 97.29 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 97.11 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 96.84 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.76 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.59 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.5 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 96.46 | |
| d1qgva_ | 137 | spliceosomal protein U5-15Kd {Human (Homo sapiens) | 96.14 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 95.74 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 95.68 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 95.41 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.31 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 95.26 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 95.24 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 95.2 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 95.16 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 94.85 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 94.58 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 93.93 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 93.41 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 92.77 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 92.72 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 92.52 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 92.2 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 92.13 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 91.34 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 90.42 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 86.86 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 81.88 |
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: U2A'-like domain: Splicesomal U2A' protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.72 E-value=6.9e-18 Score=123.82 Aligned_cols=79 Identities=24% Similarity=0.352 Sum_probs=74.2
Q ss_pred hhccccccEEEeeCCCccchhhhhhhhhccCccccccccccccCcccCcccHHHHHHHHCCCCccccCcccCHHHHHHHH
Q psy4164 36 LRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETN 115 (147)
Q Consensus 36 L~~l~~L~~L~L~~N~I~~~~~l~~L~~~~lp~L~~Ld~~l~gNPv~~~~~YR~~vi~~lp~L~~LD~~~Vt~~eR~~A~ 115 (147)
+..+++|+.|+|++|+|+++.++..+.. +|+|++| .+.|||++..++||.++++.+|+|++|||.+|+++||+.|+
T Consensus 83 ~~~l~~L~~L~L~~N~i~~~~~l~~l~~--l~~L~~L--~l~~N~i~~~~~~r~~~i~~lp~L~~LD~~~i~~~er~~A~ 158 (162)
T d1a9na_ 83 DQALPDLTELILTNNSLVELGDLDPLAS--LKSLTYL--CILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAE 158 (162)
T ss_dssp HHHCTTCCEEECCSCCCCCGGGGGGGGG--CTTCCEE--ECCSSGGGGSTTHHHHHHHHCTTCSEETTEECCHHHHHHHH
T ss_pred cccccccccceecccccccccccccccc--ccccchh--hcCCCccccccchHHHHHHHCCCcCeeCCCCCCHHHHHHHH
Confidence 4578999999999999999999888876 9999999 79999999999999999999999999999999999999999
Q ss_pred HHH
Q psy4164 116 ALN 118 (147)
Q Consensus 116 ~~~ 118 (147)
.+|
T Consensus 159 ~~~ 161 (162)
T d1a9na_ 159 KMF 161 (162)
T ss_dssp HTT
T ss_pred HHh
Confidence 875
|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|