Psyllid ID: psy4164

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------
MSYMLGHLHNGWQVDQAILSEEDRVVIEEYLSVFVLRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRSYLLPKYEKLEAATFKRTAVSVESE
ccccccccccHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEEccccccccHHHHHHHHHHccccccccccEEEccccccHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHccccccc
cccccHccccccHEcHHHHcHHccEEHHHHHHEEEEHHHccEEEEEEccccHHHHHHHHHHHHHHcHHccccccEcccccHHHHHHHHHHHHHHccccEEcccEEEcccHHHHHcHHHHHHHHHHHHHHHHHHHHHccHcEEEEEcc
msymlghlhngwqvDQAILSEEDRVVIEEYLSVFVLRRVNSLrtlslygnpieKIREYRAVVSTMIPQLVTldsvlygnpiEKIREYRAVVSTMIpqlvtldsvfilpsekqetNALNAEIRSYLLPKYEKLEAATFKRTAVSVESE
msymlghlhngWQVDQAILSEEDRVVIEEYLSVFvlrrvnslrtlslygnpieKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRSYLlpkyekleaatfkrtavsvese
MSYMLGHLHNGWQVDQAILSEEDRVVIEEYLSVFVLRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRSYLLPKYEKLEAATFKRTAVSVESE
***MLGHLHNGWQVDQAILSEEDRVVIEEYLSVFVLRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRSYLLPKYEKLEAATF**********
*SYMLGHLHNGWQVDQAILSEEDRVVIEEYLSVFVLRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRS************************
MSYMLGHLHNGWQVDQAILSEEDRVVIEEYLSVFVLRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRSYLLPKYEKLEAATF**********
*SYMLGHLHNGWQVDQAILSEEDRVVIEEYLSVFVLRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRSYLLPKYEKLEAATFKRTAVSVES*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYMLGHLHNGWQVDQAILSEEDRVVIEEYLSVFVLRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNALNAEIRSYLLPKYEKLEAATFKRTAVSVESE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query147 2.2.26 [Sep-21-2011]
P83877142 Thioredoxin-like protein yes N/A 0.183 0.190 0.925 2e-08
P83876142 Thioredoxin-like protein yes N/A 0.183 0.190 0.925 2e-08
P87215142 Mitosis protein dim1 OS=S yes N/A 0.183 0.190 0.703 4e-05
Q4R6X9 523 Leucine-rich repeat-conta N/A N/A 0.197 0.055 0.425 6e-05
Q5EAD8192 Leucine-rich repeat-conta no N/A 0.612 0.468 0.323 0.0002
B6CZ61192 Leucine-rich repeat-conta no N/A 0.612 0.468 0.323 0.0003
Q9DAK8192 Leucine-rich repeat-conta no N/A 0.612 0.468 0.323 0.0004
>sp|P83877|TXN4A_MOUSE Thioredoxin-like protein 4A OS=Mus musculus GN=Txnl4a PE=2 SV=1 Back     alignment and function desciption
 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 25/27 (92%), Positives = 26/27 (96%)

Query: 1  MSYMLGHLHNGWQVDQAILSEEDRVVI 27
          MSYML HLHNGWQVDQAILSEEDRVV+
Sbjct: 1  MSYMLPHLHNGWQVDQAILSEEDRVVV 27
Essential role in pre-mRNA splicing.
Mus musculus (taxid: 10090)
>sp|P83876|TXN4A_HUMAN Thioredoxin-like protein 4A OS=Homo sapiens GN=TXNL4A PE=1 SV=1 Back     alignment and function description
>sp|P87215|DIMI_SCHPO Mitosis protein dim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dim1 PE=1 SV=1 Back     alignment and function description
>sp|Q4R6X9|LRC48_MACFA Leucine-rich repeat-containing protein 48 OS=Macaca fascicularis GN=LRRC48 PE=2 SV=1 Back     alignment and function description
>sp|Q5EAD8|LRC51_BOVIN Leucine-rich repeat-containing protein 51 OS=Bos taurus GN=LRRC51 PE=2 SV=1 Back     alignment and function description
>sp|B6CZ61|LRC51_RAT Leucine-rich repeat-containing protein 51 OS=Rattus norvegicus GN=Lrrc51 PE=2 SV=1 Back     alignment and function description
>sp|Q9DAK8|LRC51_MOUSE Leucine-rich repeat-containing protein 51 OS=Mus musculus GN=Lrrc51 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
242007822142 mitosis protein dim1, putative [Pediculu 0.183 0.190 0.962 9e-08
357626133142 mitosis protein dim1 [Danaus plexippus] 0.183 0.190 0.962 1e-07
170041711142 mitosis protein dim1 [Culex quinquefasci 0.183 0.190 0.925 5e-07
31222366142 AGAP008298-PA [Anopheles gambiae str. PE 0.183 0.190 0.925 6e-07
157113361142 mitosis protein dim1 [Aedes aegypti] gi| 0.183 0.190 0.925 6e-07
91080733142 PREDICTED: similar to mitosis protein di 0.183 0.190 0.925 6e-07
443711305142 hypothetical protein CAPTEDRAFT_164052 [ 0.183 0.190 0.962 6e-07
327270008142 PREDICTED: thioredoxin-like protein 4A-l 0.204 0.211 0.833 7e-07
156550769142 PREDICTED: thioredoxin-like protein 4A-l 0.183 0.190 0.925 7e-07
66533106142 PREDICTED: thioredoxin-like protein 4A-l 0.183 0.190 0.925 7e-07
>gi|242007822|ref|XP_002424719.1| mitosis protein dim1, putative [Pediculus humanus corporis] gi|212508212|gb|EEB11981.1| mitosis protein dim1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 62.0 bits (149), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 26/27 (96%), Positives = 27/27 (100%)

Query: 1  MSYMLGHLHNGWQVDQAILSEEDRVVI 27
          MSYMLGHLHNGWQVDQAILSEEDRVV+
Sbjct: 1  MSYMLGHLHNGWQVDQAILSEEDRVVV 27

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357626133|gb|EHJ76331.1| mitosis protein dim1 [Danaus plexippus] Back     alignment and taxonomy information
>gi|170041711|ref|XP_001848597.1| mitosis protein dim1 [Culex quinquefasciatus] gi|167865257|gb|EDS28640.1| mitosis protein dim1 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|31222366|ref|XP_317168.1| AGAP008298-PA [Anopheles gambiae str. PEST] gi|21300089|gb|EAA12234.1| AGAP008298-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157113361|ref|XP_001657795.1| mitosis protein dim1 [Aedes aegypti] gi|94469104|gb|ABF18401.1| U4/U6.U5 snRNP/mitosis protein DIM1 component [Aedes aegypti] gi|108877785|gb|EAT42010.1| AAEL006401-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|91080733|ref|XP_975428.1| PREDICTED: similar to mitosis protein dim1 [Tribolium castaneum] gi|270006427|gb|EFA02875.1| thioredoxin-like 4A [Tribolium castaneum] Back     alignment and taxonomy information
>gi|443711305|gb|ELU05133.1| hypothetical protein CAPTEDRAFT_164052 [Capitella teleta] gi|443722557|gb|ELU11364.1| hypothetical protein CAPTEDRAFT_97509 [Capitella teleta] Back     alignment and taxonomy information
>gi|327270008|ref|XP_003219784.1| PREDICTED: thioredoxin-like protein 4A-like [Anolis carolinensis] gi|327291099|ref|XP_003230259.1| PREDICTED: thioredoxin-like protein 4A-like [Anolis carolinensis] Back     alignment and taxonomy information
>gi|156550769|ref|XP_001605455.1| PREDICTED: thioredoxin-like protein 4A-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|66533106|ref|XP_624360.1| PREDICTED: thioredoxin-like protein 4A-like [Apis mellifera] gi|340715438|ref|XP_003396220.1| PREDICTED: thioredoxin-like protein 4A-like [Bombus terrestris] gi|350414516|ref|XP_003490342.1| PREDICTED: thioredoxin-like protein 4A-like [Bombus impatiens] gi|380013410|ref|XP_003690753.1| PREDICTED: thioredoxin-like protein 4A-like [Apis florea] gi|383861978|ref|XP_003706461.1| PREDICTED: thioredoxin-like protein 4A-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query147
FB|FBgn0031601142 Dim1 "Dim1" [Drosophila melano 0.183 0.190 0.925 4.7e-09
UNIPROTKB|E1C1X5142 TXNL4A "Uncharacterized protei 0.183 0.190 0.925 4.7e-09
UNIPROTKB|F1MTU6142 TXNL4A "Uncharacterized protei 0.183 0.190 0.925 4.7e-09
UNIPROTKB|E2R204142 TXNL4A "Uncharacterized protei 0.183 0.190 0.925 4.7e-09
UNIPROTKB|K7EJU257 TXNL4A "Thioredoxin-like prote 0.183 0.473 0.925 4.7e-09
UNIPROTKB|K7EMX586 TXNL4A "Thioredoxin-like prote 0.183 0.313 0.925 4.7e-09
UNIPROTKB|K7EPA654 TXNL4A "Thioredoxin-like prote 0.183 0.5 0.925 4.7e-09
UNIPROTKB|K7ES07103 TXNL4A "Thioredoxin-like prote 0.183 0.262 0.925 4.7e-09
UNIPROTKB|O1483591 TXNL4A "Dim1p homolog" [Homo s 0.183 0.296 0.925 4.7e-09
UNIPROTKB|P83876142 TXNL4A "Thioredoxin-like prote 0.183 0.190 0.925 4.7e-09
FB|FBgn0031601 Dim1 "Dim1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 134 (52.2 bits), Expect = 4.7e-09, P = 4.7e-09
 Identities = 25/27 (92%), Positives = 26/27 (96%)

Query:     1 MSYMLGHLHNGWQVDQAILSEEDRVVI 27
             MSYML HLHNGWQVDQAILSEEDRVV+
Sbjct:     1 MSYMLPHLHNGWQVDQAILSEEDRVVV 27
GO:0005682 "U5 snRNP" evidence=ISS
GO:0000398 "mRNA splicing, via spliceosome" evidence=IC;ISS
GO:0030532 "small nuclear ribonucleoprotein complex" evidence=ISS
GO:0007067 "mitosis" evidence=IEA
GO:0007052 "mitotic spindle organization" evidence=IMP
GO:0071011 "precatalytic spliceosome" evidence=IDA
GO:0022008 "neurogenesis" evidence=IMP
UNIPROTKB|E1C1X5 TXNL4A "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1MTU6 TXNL4A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R204 TXNL4A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|K7EJU2 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EMX5 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7EPA6 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|K7ES07 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O14835 TXNL4A "Dim1p homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P83876 TXNL4A "Thioredoxin-like protein 4A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
PLN00410142 PLN00410, PLN00410, U5 snRNP protein, DIM1 family; 7e-10
pfam02966133 pfam02966, DIM1, Mitosis protein DIM1 2e-07
cd02954114 cd02954, DIM1, Dim1 family; Dim1 is also referred 3e-04
>gnl|CDD|215109 PLN00410, PLN00410, U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information 
 Score = 53.7 bits (129), Expect = 7e-10
 Identities = 19/27 (70%), Positives = 25/27 (92%)

Query: 1  MSYMLGHLHNGWQVDQAILSEEDRVVI 27
          MSY+L HLH+GW VDQAIL+EE+R+V+
Sbjct: 1  MSYLLPHLHSGWAVDQAILAEEERLVV 27

Length = 142
>gnl|CDD|190488 pfam02966, DIM1, Mitosis protein DIM1 Back     alignment and domain information
>gnl|CDD|239252 cd02954, DIM1, Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 147
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.81
KOG1644|consensus233 99.66
KOG2123|consensus 388 99.47
KOG2982|consensus418 98.98
KOG2739|consensus260 98.96
KOG3207|consensus505 98.77
KOG3414|consensus142 98.75
KOG3763|consensus 585 98.61
KOG1259|consensus490 98.53
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 98.19
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.97
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 97.69
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.47
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.42
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 97.4
smart0044626 LRRcap occurring C-terminal to leucine-rich repeat 97.34
KOG1644|consensus233 97.02
KOG1859|consensus 1096 96.99
KOG0531|consensus 414 96.88
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 96.34
KOG0617|consensus 264 96.33
KOG0618|consensus 1081 95.98
KOG4579|consensus177 95.42
KOG3665|consensus 699 95.41
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.16
KOG0531|consensus 414 95.12
KOG2123|consensus 388 95.06
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 94.99
KOG4194|consensus 873 94.87
KOG2982|consensus 418 94.85
KOG2739|consensus260 94.78
KOG0618|consensus 1081 94.75
KOG3207|consensus 505 94.4
smart0037026 LRR Leucine-rich repeats, outliers. 94.36
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 94.36
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 94.18
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.08
KOG1259|consensus490 94.03
KOG0617|consensus 264 93.63
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 93.55
KOG4237|consensus 498 93.51
KOG4194|consensus 873 93.34
KOG0472|consensus565 93.34
KOG3665|consensus 699 92.89
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 92.83
KOG4237|consensus 498 92.44
PLN03150623 hypothetical protein; Provisional 92.33
KOG1859|consensus 1096 91.01
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 90.39
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 90.35
KOG1909|consensus382 90.3
KOG3864|consensus221 89.69
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 88.5
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 88.12
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 87.2
KOG0444|consensus 1255 85.99
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 83.93
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 83.64
PLN03150623 hypothetical protein; Provisional 82.69
KOG0472|consensus 565 82.32
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 82.22
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information 
Probab=99.81  E-value=9e-21  Score=145.71  Aligned_cols=83  Identities=31%  Similarity=0.468  Sum_probs=52.6

Q ss_pred             hccccccEEEeeCCCccchhhhhhhhhccCccccccccccccCcccCcccHHHHHHHHCCCCccccCcccCHHHHHHHHH
Q psy4164          37 RRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETNA  116 (147)
Q Consensus        37 ~~l~~L~~L~L~~N~I~~~~~l~~L~~~~lp~L~~Ld~~l~gNPv~~~~~YR~~vi~~lp~L~~LD~~~Vt~~eR~~A~~  116 (147)
                      ..||+|+.|+|++|+|.++.++..|..  +|+|+.|  .+.|||+|+.++||.+|++.+|+|+.|||..|+++||+.|+.
T Consensus        85 ~~lp~L~~L~L~~N~I~~l~~l~~L~~--l~~L~~L--~L~~NPv~~~~~YR~~vi~~lP~Lk~LD~~~V~~~ER~~A~~  160 (175)
T PF14580_consen   85 KNLPNLQELYLSNNKISDLNELEPLSS--LPKLRVL--SLEGNPVCEKKNYRLFVIYKLPSLKVLDGQDVTEEERQEAEK  160 (175)
T ss_dssp             HH-TT--EEE-TTS---SCCCCGGGGG---TT--EE--E-TT-GGGGSTTHHHHHHHH-TT-SEETTEETTS-B------
T ss_pred             HhCCcCCEEECcCCcCCChHHhHHHHc--CCCccee--eccCCcccchhhHHHHHHHHcChhheeCCEEccHHHhccccc
Confidence            368999999999999999999999987  9999999  799999999999999999999999999999999999999999


Q ss_pred             HHHHHhh
Q psy4164         117 LNAEIRS  123 (147)
Q Consensus       117 ~~~~~~~  123 (147)
                      +|..-+.
T Consensus       161 ~f~~~~~  167 (175)
T PF14580_consen  161 LFKGKRA  167 (175)
T ss_dssp             -------
T ss_pred             ccccccc
Confidence            9876443

>KOG1644|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3414|consensus Back     alignment and domain information
>KOG3763|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>smart00446 LRRcap occurring C-terminal to leucine-rich repeats Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
1qgv_A142 Human Spliceosomal Protein U5-15kd Length = 142 2e-09
1pqn_A127 Dominant Negative Human Hdim1 (Hdim1 1-128) Length 9e-09
2av4_A160 Crystal Structure Of Plasmodium Yoelii Thioredoxin- 9e-04
>pdb|1QGV|A Chain A, Human Spliceosomal Protein U5-15kd Length = 142 Back     alignment and structure 
Iteration: 1

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 25/27 (92%), Positives = 26/27 (96%)
Query: 1  MSYMLGHLHNGWQVDQAILSEEDRVVI 27
          MSYML HLHNGWQVDQAILSEEDRVV+
Sbjct: 1  MSYMLPHLHNGWQVDQAILSEEDRVVV 27
>pdb|1PQN|A Chain A, Dominant Negative Human Hdim1 (Hdim1 1-128) Length = 127 Back     alignment and structure
>pdb|2AV4|A Chain A, Crystal Structure Of Plasmodium Yoelii Thioredoxin-like Protein 4a (dim1) Length = 160 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query147
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 3e-11
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 2e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 6e-09
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-08
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 9e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 3e-04
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-04
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Length = 142 Back     alignment and structure
 Score = 56.6 bits (136), Expect = 3e-11
 Identities = 25/27 (92%), Positives = 26/27 (96%)

Query: 1  MSYMLGHLHNGWQVDQAILSEEDRVVI 27
          MSYML HLHNGWQVDQAILSEEDRVV+
Sbjct: 1  MSYMLPHLHNGWQVDQAILSEEDRVVV 27
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Length = 160 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.29
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.14
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.72
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 98.14
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.9
3e6j_A229 Variable lymphocyte receptor diversity region; var 97.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.76
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.59
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 97.49
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 97.47
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.41
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.41
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 97.36
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 97.35
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 97.33
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.33
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 97.3
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 97.29
4ezg_A197 Putative uncharacterized protein; internalin-A, le 97.28
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 97.2
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 97.14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 97.14
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 97.09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 97.08
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 97.05
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 97.01
1o6v_A 466 Internalin A; bacterial infection, extracellular r 96.94
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 96.92
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 96.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 96.87
1o6v_A 466 Internalin A; bacterial infection, extracellular r 96.87
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.85
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 96.83
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 96.82
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 96.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 96.78
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 96.75
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 96.72
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 96.71
3m19_A251 Variable lymphocyte receptor A diversity region; a 96.68
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 96.65
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 96.63
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 96.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.62
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 96.61
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 96.54
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 96.53
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 96.5
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 96.5
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 96.48
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.46
3m19_A251 Variable lymphocyte receptor A diversity region; a 96.45
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 96.44
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 96.44
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 96.43
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 96.42
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 96.42
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 96.38
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 96.28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 96.28
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 96.28
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 96.27
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 96.27
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 96.26
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 96.23
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 96.22
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 96.19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 96.18
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 96.18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 96.18
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 96.15
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 96.15
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 96.15
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 96.14
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 96.12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 96.11
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 96.05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.03
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 96.03
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 96.0
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 95.98
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 95.98
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 95.98
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 95.97
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 95.95
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 95.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 95.89
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 95.89
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 95.88
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 95.81
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 95.81
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 95.79
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 95.77
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 95.76
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 95.73
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 95.71
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 95.68
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 95.66
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 95.64
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 95.63
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 95.62
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 95.56
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 95.55
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 95.51
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 95.44
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 95.39
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 95.39
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 95.36
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 95.35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 95.23
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 95.22
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 95.18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 95.18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 95.17
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 95.15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 95.11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 95.11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 95.03
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 94.92
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 94.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 94.9
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 94.84
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 94.84
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 94.74
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 94.66
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 94.65
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 94.57
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 94.45
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 94.42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 94.22
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 94.21
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 94.19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 94.17
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 94.14
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 93.95
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 93.95
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 93.89
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 93.85
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 93.78
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 93.77
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 93.75
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 93.69
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 93.61
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 91.4
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 91.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 89.9
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 87.8
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 86.0
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 80.25
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
Probab=99.29  E-value=1.1e-11  Score=91.47  Aligned_cols=81  Identities=23%  Similarity=0.338  Sum_probs=73.6

Q ss_pred             hhccccccEEEeeCCCccchhhhhhhhhccCccccccccccccCcccCcccHHHHHHHHCCCCccccCcccCHHHHHHHH
Q psy4164          36 LRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETN  115 (147)
Q Consensus        36 L~~l~~L~~L~L~~N~I~~~~~l~~L~~~~lp~L~~Ld~~l~gNPv~~~~~YR~~vi~~lp~L~~LD~~~Vt~~eR~~A~  115 (147)
                      +..+++|+.|+|++|+|+++..+..+..  +++|+.|  .+.+||++..+.||..++..+|+|+.||...++.+||..|+
T Consensus        84 ~~~l~~L~~L~L~~N~i~~~~~~~~l~~--l~~L~~L--~l~~N~i~~~~~~~~~~~~~l~~L~~Ld~~~n~~~~~~~~~  159 (176)
T 1a9n_A           84 DQALPDLTELILTNNSLVELGDLDPLAS--LKSLTYL--CILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAE  159 (176)
T ss_dssp             HHHCTTCCEEECCSCCCCCGGGGGGGGG--CTTCCEE--ECCSSGGGGSTTHHHHHHHHCTTCSEETTEECCHHHHHHHH
T ss_pred             hhcCCCCCEEECCCCcCCcchhhHhhhc--CCCCCEE--EecCCCCCCcHhHHHHHHHHCCccceeCCCcCCHHHHHHHH
Confidence            3788999999999999999888777766  8999999  69999999999999999999999999999999999999999


Q ss_pred             HHHHH
Q psy4164         116 ALNAE  120 (147)
Q Consensus       116 ~~~~~  120 (147)
                      .++..
T Consensus       160 ~~~~~  164 (176)
T 1a9n_A          160 KMFKG  164 (176)
T ss_dssp             HTTC-
T ss_pred             HHHhc
Confidence            88644
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 147
d1qgva_137 c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human 1e-08
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Length = 137 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Thioredoxin fold
superfamily: Thioredoxin-like
family: spliceosomal protein U5-15Kd
domain: spliceosomal protein U5-15Kd
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 48.6 bits (115), Expect = 1e-08
 Identities = 24/26 (92%), Positives = 25/26 (96%)

Query: 2  SYMLGHLHNGWQVDQAILSEEDRVVI 27
          SYML HLHNGWQVDQAILSEEDRVV+
Sbjct: 1  SYMLPHLHNGWQVDQAILSEEDRVVV 26
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query147
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.72
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.55
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 99.31
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.05
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 98.11
d2omza2 384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.8
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 97.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.68
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 97.67
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.53
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 97.49
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.41
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.35
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 97.29
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 97.11
d1p9ag_ 266 von Willebrand factor binding domain of glycoprote 96.84
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.76
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.59
d2ifga3156 High affinity nerve growth factor receptor, N-term 96.5
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 96.46
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 96.14
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 95.74
d1p9ag_266 von Willebrand factor binding domain of glycoprote 95.68
d2astb2 284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 95.41
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.31
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 95.26
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 95.24
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 95.2
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 95.16
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 94.85
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 94.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 93.93
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 93.41
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 92.77
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 92.72
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 92.52
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 92.2
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 92.13
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 91.34
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 90.42
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 86.86
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 81.88
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: U2A'-like
domain: Splicesomal U2A' protein
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.72  E-value=6.9e-18  Score=123.82  Aligned_cols=79  Identities=24%  Similarity=0.352  Sum_probs=74.2

Q ss_pred             hhccccccEEEeeCCCccchhhhhhhhhccCccccccccccccCcccCcccHHHHHHHHCCCCccccCcccCHHHHHHHH
Q psy4164          36 LRRVNSLRTLSLYGNPIEKIREYRAVVSTMIPQLVTLDSVLYGNPIEKIREYRAVVSTMIPQLVTLDSVFILPSEKQETN  115 (147)
Q Consensus        36 L~~l~~L~~L~L~~N~I~~~~~l~~L~~~~lp~L~~Ld~~l~gNPv~~~~~YR~~vi~~lp~L~~LD~~~Vt~~eR~~A~  115 (147)
                      +..+++|+.|+|++|+|+++.++..+..  +|+|++|  .+.|||++..++||.++++.+|+|++|||.+|+++||+.|+
T Consensus        83 ~~~l~~L~~L~L~~N~i~~~~~l~~l~~--l~~L~~L--~l~~N~i~~~~~~r~~~i~~lp~L~~LD~~~i~~~er~~A~  158 (162)
T d1a9na_          83 DQALPDLTELILTNNSLVELGDLDPLAS--LKSLTYL--CILRNPVTNKKHYRLYVIYKVPQVRVLDFQKVKLKERQEAE  158 (162)
T ss_dssp             HHHCTTCCEEECCSCCCCCGGGGGGGGG--CTTCCEE--ECCSSGGGGSTTHHHHHHHHCTTCSEETTEECCHHHHHHHH
T ss_pred             cccccccccceecccccccccccccccc--ccccchh--hcCCCccccccchHHHHHHHCCCcCeeCCCCCCHHHHHHHH
Confidence            4578999999999999999999888876  9999999  79999999999999999999999999999999999999999


Q ss_pred             HHH
Q psy4164         116 ALN  118 (147)
Q Consensus       116 ~~~  118 (147)
                      .+|
T Consensus       159 ~~~  161 (162)
T d1a9na_         159 KMF  161 (162)
T ss_dssp             HTT
T ss_pred             HHh
Confidence            875
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure