Psyllid ID: psy4166


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MSMKYDAKADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKELLLGLLKRNAMDRISFEQLFAHPFLQPLAPHPLIPEPHAGSPVTLSPEDSTDDFVVIPNSADVVSTSPPRPSSLLLSPAPSQHVAIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTISIN
cccccccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccccccHHHHHHHHHHHcccccEEEEEEEEEEccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccc
cccccccHHcHHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcccHHcccHHHHcccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccEEEEEEEcccccccHHHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccEEEEEccccc
msmkydakadLYSVGTIVFQcltgkapfiansppqlkqyyeknlvlvpkvpvgtsAELKELLLGLLKRNamdrisfeqlfahpflqplaphplipephagspvtlspedstddfvvipnsadvvstspprpsslllspapsqHVAIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLyfhdftpwSFVILYTISIN
msmkydakADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKELLLGLLKRNAMDRISFEQLFAHPFLQPLAPHPLIPEPHAGSPVTLSPEDSTDDFVVIPNSADVVSTSPPRPSSLLLSPAPSQHVAIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTISIN
MSMKYDAKADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAelkelllgllkRNAMDRISFEQLFAHPFLQPLAPHPLIPEPHAGSPVTLSPEDSTDDFVVIPNSADVVSTspprpsslllspapsQHVAIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTISIN
*******KADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKELLLGLLKRNAMDRISFEQLFAHPFLQPLAP******************************************************AIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTIS**
****YDA*ADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKELLLGLLKRNAMDRISFEQLFAHPFLQPLAPHPLIPEPHAGSPVTLSPEDSTDDFVVIPNSADVVSTSPPRPSSLLLS******************************KELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTI***
********ADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKELLLGLLKRNAMDRISFEQLFAHPFLQPLAPHPLIPEPHAGSPVTLSPEDSTDDFVVIPNSAD*************LSPAPSQHVAIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTISIN
***KYDAKADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKELLLGLLKRNAMDRISFEQLFAHPFLQPLAPHP*******************************************LSPAPSQHVAIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTISIN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMKYDAKADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKELLLGLLKRNAMDRISFEQLFAHPFLQPLAPHPLIPEPHAGSPVTLSPEDSTDDFVVIPNSADVVSTSPPRPSSLLLSPAPSQHVAIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTISIN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query249 2.2.26 [Sep-21-2011]
Q23023 856 Serine/threonine-protein yes N/A 0.369 0.107 0.677 2e-24
Q8IYT8 1036 Serine/threonine-protein yes N/A 0.317 0.076 0.647 4e-21
Q9QY01 1037 Serine/threonine-protein yes N/A 0.317 0.076 0.647 4e-21
O70405 1051 Serine/threonine-protein no N/A 0.345 0.081 0.6 6e-20
O75385 1050 Serine/threonine-protein no N/A 0.309 0.073 0.641 7e-20
Q52EB3 982 Serine/threonine-protein N/A N/A 0.457 0.116 0.370 6e-13
A2QIL5 1007 Serine/threonine-protein yes N/A 0.510 0.126 0.348 5e-12
Q7RX99 932 Serine/threonine-protein N/A N/A 0.325 0.086 0.440 1e-11
Q6H9I1 952 Serine/threonine-protein N/A N/A 0.325 0.085 0.428 3e-11
A6RYB8 952 Serine/threonine-protein N/A N/A 0.325 0.085 0.428 3e-11
>sp|Q23023|UNC51_CAEEL Serine/threonine-protein kinase unc-51 OS=Caenorhabditis elegans GN=unc-51 PE=1 SV=1 Back     alignment and function desciption
 Score =  112 bits (280), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 63/93 (67%), Positives = 72/93 (77%), Gaps = 1/93 (1%)

Query: 1   MSMKYDAKADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKE 60
           MSM+YDAKADL+S+GTI+FQCLTGKAPF+A +PPQLK YYEK   L P +P   S  L++
Sbjct: 191 MSMQYDAKADLWSIGTILFQCLTGKAPFVAQTPPQLKAYYEKTRELRPNIPEWCSPNLRD 250

Query: 61  LLLGLLKRNAMDRISFEQLFAHPFL-QPLAPHP 92
           LLL LLKRNA DRISFE  F HPFL  PL P P
Sbjct: 251 LLLRLLKRNAKDRISFEDFFNHPFLTSPLLPSP 283




Protein kinase important for axonal elongation and axonal guidance. Functions in the CAN axons to direct both anterior and posterior migrations. Phosphorylates both unc-14 and vab-8.
Caenorhabditis elegans (taxid: 6239)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q8IYT8|ULK2_HUMAN Serine/threonine-protein kinase ULK2 OS=Homo sapiens GN=ULK2 PE=1 SV=3 Back     alignment and function description
>sp|Q9QY01|ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus GN=Ulk2 PE=1 SV=1 Back     alignment and function description
>sp|O70405|ULK1_MOUSE Serine/threonine-protein kinase ULK1 OS=Mus musculus GN=Ulk1 PE=1 SV=1 Back     alignment and function description
>sp|O75385|ULK1_HUMAN Serine/threonine-protein kinase ULK1 OS=Homo sapiens GN=ULK1 PE=1 SV=2 Back     alignment and function description
>sp|Q52EB3|ATG1_MAGO7 Serine/threonine-protein kinase ATG1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=ATG1 PE=1 SV=1 Back     alignment and function description
>sp|A2QIL5|ATG1_ASPNC Serine/threonine-protein kinase atg1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=atg1 PE=3 SV=1 Back     alignment and function description
>sp|Q7RX99|ATG1_NEUCR Serine/threonine-protein kinase atg-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=atg-1 PE=3 SV=1 Back     alignment and function description
>sp|Q6H9I1|ATG1_BOTFU Serine/threonine-protein kinase ATG1 OS=Botryotinia fuckeliana GN=atg1 PE=3 SV=1 Back     alignment and function description
>sp|A6RYB8|ATG1_BOTFB Serine/threonine-protein kinase atg1 OS=Botryotinia fuckeliana (strain B05.10) GN=atg1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
328721480 663 PREDICTED: serine/threonine-protein kina 0.534 0.200 0.523 2e-32
242010598 695 serine/threonine-protein kinase ULK2, pu 0.614 0.220 0.464 6e-31
170030128 686 conserved hypothetical protein [Culex qu 0.594 0.215 0.447 8e-31
66560999 752 PREDICTED: serine/threonine-protein kina 0.574 0.190 0.448 3e-30
380030403 752 PREDICTED: serine/threonine-protein kina 0.570 0.188 0.451 4e-30
345480210 772 PREDICTED: serine/threonine-protein kina 0.574 0.185 0.437 4e-30
156544369 765 PREDICTED: serine/threonine-protein kina 0.574 0.186 0.437 5e-30
340712126 753 PREDICTED: serine/threonine-protein kina 0.570 0.188 0.464 6e-30
350398945 753 PREDICTED: serine/threonine-protein kina 0.558 0.184 0.457 1e-29
383857154 753 PREDICTED: serine/threonine-protein kina 0.574 0.189 0.456 2e-29
>gi|328721480|ref|XP_001944514.2| PREDICTED: serine/threonine-protein kinase unc-51-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  145 bits (366), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 79/151 (52%), Positives = 100/151 (66%), Gaps = 18/151 (11%)

Query: 1   MSMKYDAKADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKE 60
           MS++YDAKADL+S+GTI+FQCL GKAPF ANSP  LKQ YEK   L+PK+P GTS++L  
Sbjct: 191 MSLQYDAKADLWSLGTIIFQCLAGKAPFFANSPAGLKQIYEKTSNLMPKIPPGTSSDLSN 250

Query: 61  LLLGLLKRNAMDRISFEQLFAHPFLQPLAPHPLIPEPHAGSPVT-----------LSPED 109
           LL GLLKRN  DRISFE  F H FL+   P   +P P A SP T           +SP D
Sbjct: 251 LLFGLLKRNPKDRISFETFFDHTFLKMKPPPVTMPSPLANSPKTPSVFDQGYQYSVSP-D 309

Query: 110 STDDFVVIPNSADV------VSTSPPRPSSL 134
            +D++V++P++         +S SPPRPS+L
Sbjct: 310 LSDEYVIVPSNIPAYHHEKDISASPPRPSTL 340




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242010598|ref|XP_002426052.1| serine/threonine-protein kinase ULK2, putative [Pediculus humanus corporis] gi|212510062|gb|EEB13314.1| serine/threonine-protein kinase ULK2, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|170030128|ref|XP_001842942.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167865948|gb|EDS29331.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|66560999|ref|XP_624950.1| PREDICTED: serine/threonine-protein kinase ULK2 [Apis mellifera] Back     alignment and taxonomy information
>gi|380030403|ref|XP_003698838.1| PREDICTED: serine/threonine-protein kinase ULK2-like [Apis florea] Back     alignment and taxonomy information
>gi|345480210|ref|XP_003424105.1| PREDICTED: serine/threonine-protein kinase ULK2-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|156544369|ref|XP_001607390.1| PREDICTED: serine/threonine-protein kinase ULK2-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340712126|ref|XP_003394615.1| PREDICTED: serine/threonine-protein kinase ULK2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350398945|ref|XP_003485359.1| PREDICTED: serine/threonine-protein kinase ULK2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383857154|ref|XP_003704070.1| PREDICTED: serine/threonine-protein kinase ULK2-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query249
FB|FBgn0260945 855 Atg1 "Autophagy-specific gene 0.317 0.092 0.775 4.3e-25
WB|WBGene00006786 856 unc-51 [Caenorhabditis elegans 0.369 0.107 0.602 8.6e-25
UNIPROTKB|Q23023 856 unc-51 "Serine/threonine-prote 0.369 0.107 0.602 8.6e-25
UNIPROTKB|O75385 1050 ULK1 "Serine/threonine-protein 0.481 0.114 0.451 5.4e-21
ZFIN|ZDB-GENE-071203-2 1011 ulk1b "unc-51-like kinase 1b ( 0.309 0.076 0.679 2.9e-20
MGI|MGI:1270126 1051 Ulk1 "unc-51 like kinase 1" [M 0.481 0.114 0.451 1.5e-20
RGD|1589743 1057 Ulk1 "Unc-51 like kinase 1 (C. 0.481 0.113 0.451 1.5e-20
UNIPROTKB|I3L6G0145 I3L6G0 "Uncharacterized protei 0.409 0.703 0.462 4.4e-20
ZFIN|ZDB-GENE-080723-31 1038 ulk1a "unc-51-like kinase 1a ( 0.445 0.106 0.435 4.7e-20
UNIPROTKB|E2RF62 1037 ULK2 "Uncharacterized protein" 0.405 0.097 0.490 5e-20
FB|FBgn0260945 Atg1 "Autophagy-specific gene 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 296 (109.3 bits), Expect = 4.3e-25, P = 4.3e-25
 Identities = 62/80 (77%), Positives = 65/80 (81%)

Query:   144 VAIKRITKKNLAKTQNF-GKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGD 202
             VAIK ITKK   KTQN  GKEI ILKELTELHHENVV LL CKES   V LVME+CNGGD
Sbjct:    35 VAIKCITKKGQLKTQNLLGKEIKILKELTELHHENVVALLDCKESQDCVSLVMEYCNGGD 94

Query:   203 LADYLVSKGTLSEDTIRIFL 222
             LADYL  KGTLSEDT+R+FL
Sbjct:    95 LADYLSVKGTLSEDTVRLFL 114


GO:0004674 "protein serine/threonine kinase activity" evidence=ISS;IMP
GO:0006468 "protein phosphorylation" evidence=NAS
GO:0004672 "protein kinase activity" evidence=ISS;IDA;IMP;NAS
GO:0016301 "kinase activity" evidence=NAS
GO:0005524 "ATP binding" evidence=IEA
GO:0016236 "macroautophagy" evidence=IMP
GO:0006914 "autophagy" evidence=IMP
GO:0019894 "kinesin binding" evidence=IMP
GO:0032007 "negative regulation of TOR signaling cascade" evidence=IMP
GO:0001558 "regulation of cell growth" evidence=IMP
GO:0008088 "axon cargo transport" evidence=IMP
GO:0050808 "synapse organization" evidence=IMP
GO:0050804 "regulation of synaptic transmission" evidence=IMP
GO:0051124 "synaptic growth at neuromuscular junction" evidence=IMP
GO:0045476 "nurse cell apoptotic process" evidence=IMP
GO:0035069 "larval midgut histolysis" evidence=IMP
GO:0046777 "protein autophosphorylation" evidence=IMP
GO:0010506 "regulation of autophagy" evidence=IMP
WB|WBGene00006786 unc-51 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|Q23023 unc-51 "Serine/threonine-protein kinase unc-51" [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|O75385 ULK1 "Serine/threonine-protein kinase ULK1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071203-2 ulk1b "unc-51-like kinase 1b (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1270126 Ulk1 "unc-51 like kinase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1589743 Ulk1 "Unc-51 like kinase 1 (C. elegans)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|I3L6G0 I3L6G0 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-080723-31 ulk1a "unc-51-like kinase 1a (C. elegans)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RF62 ULK2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.7.11.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
smart00220 254 smart00220, S_TKc, Serine/Threonine protein kinase 4e-22
cd00180215 cd00180, PKc, Catalytic domain of Protein Kinases 2e-18
pfam00069 260 pfam00069, Pkinase, Protein kinase domain 3e-18
smart00220254 smart00220, S_TKc, Serine/Threonine protein kinase 4e-14
cd06606 260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 3e-13
cd05123250 cd05123, STKc_AGC, Catalytic domain of AGC family 2e-12
cd00192 262 cd00192, PTKc, Catalytic domain of Protein Tyrosin 2e-12
cd05122 253 cd05122, PKc_STE, Catalytic domain of STE family P 6e-12
pfam07714 258 pfam07714, Pkinase_Tyr, Protein tyrosine kinase 3e-11
smart00219 257 smart00219, TyrKc, Tyrosine kinase, catalytic doma 3e-11
smart00221 258 smart00221, STYKc, Protein kinase; unclassified sp 5e-11
cd06627 254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 5e-11
cd08215 258 cd08215, STKc_Nek, Catalytic domain of the Protein 2e-10
cd05579 265 cd05579, STKc_MAST_like, Catalytic domain of Micro 2e-10
cd05581 280 cd05581, STKc_PDK1, Catalytic domain of the Protei 2e-10
cd05600 333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 2e-10
pfam00069260 pfam00069, Pkinase, Protein kinase domain 4e-10
cd05123 250 cd05123, STKc_AGC, Catalytic domain of AGC family 8e-10
cd08215258 cd08215, STKc_Nek, Catalytic domain of the Protein 1e-09
cd06606260 cd06606, STKc_MAPKKK, Catalytic domain of the Prot 8e-09
cd05573 350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 9e-09
cd06614 286 cd06614, STKc_PAK, Catalytic domain of the Protein 1e-08
cd08217 265 cd08217, STKc_Nek2, Catalytic domain of the Protei 1e-08
cd05039 256 cd05039, PTKc_Csk_like, Catalytic domain of C-term 2e-08
cd05580 290 cd05580, STKc_PKA, Catalytic domain of the Protein 2e-08
cd05573350 cd05573, STKc_ROCK_NDR_like, Catalytic domain of R 5e-08
cd05572 262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 6e-08
cd06623264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 6e-08
cd08217265 cd08217, STKc_Nek2, Catalytic domain of the Protei 9e-08
cd06625 263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 9e-08
cd05581280 cd05581, STKc_PDK1, Catalytic domain of the Protei 1e-07
cd07829 282 cd07829, STKc_CDK_like, Catalytic domain of Cyclin 1e-07
cd05578258 cd05578, STKc_Yank1, Catalytic domain of the Prote 1e-07
cd07834 330 cd07834, STKc_MAPK, Catalytic domain of the Serine 2e-07
cd06610 267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 3e-07
cd06613 262 cd06613, STKc_MAP4K3_like, Catalytic domain of Mit 4e-07
cd06612 256 cd06612, STKc_MST1_2, Catalytic domain of the Prot 5e-07
cd06632258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 6e-07
cd05606278 cd05606, STKc_beta_ARK, Catalytic domain of the Pr 8e-07
cd08218256 cd08218, STKc_Nek1, Catalytic domain of the Protei 8e-07
cd05599364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 1e-06
cd05627360 cd05627, STKc_NDR2, Catalytic domain of the Protei 2e-06
cd07841 298 cd07841, STKc_CDK7, Catalytic domain of the Serine 2e-06
cd06631265 cd06631, STKc_YSK4, Catalytic domain of the Protei 2e-06
COG0515384 COG0515, SPS1, Serine/threonine protein kinase [Ge 2e-06
COG0515 384 COG0515, SPS1, Serine/threonine protein kinase [Ge 3e-06
cd06624268 cd06624, STKc_ASK, Catalytic domain of the Protein 3e-06
cd07855 334 cd07855, STKc_ERK5, Catalytic domain of the Serine 3e-06
cd05578 258 cd05578, STKc_Yank1, Catalytic domain of the Prote 4e-06
cd06628 267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 4e-06
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 4e-06
cd05611 260 cd05611, STKc_Rim15_like, Catalytic domain of fung 4e-06
cd06625263 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ 6e-06
cd05148 261 cd05148, PTKc_Srm_Brk, Catalytic domain of the Pro 6e-06
cd06648285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 6e-06
cd06617283 cd06617, PKc_MKK3_6, Catalytic domain of the dual- 8e-06
cd07835 283 cd07835, STKc_CDK1_like, Catalytic domain of Cycli 8e-06
cd08219 255 cd08219, STKc_Nek3, Catalytic domain of the Protei 8e-06
cd05633279 cd05633, STKc_GRK3, Catalytic domain of the Protei 8e-06
cd07834330 cd07834, STKc_MAPK, Catalytic domain of the Serine 1e-05
cd06626 264 cd06626, STKc_MEKK4, Catalytic domain of the Prote 1e-05
cd05609 305 cd05609, STKc_MAST, Catalytic domain of the Protei 2e-05
cd06659297 cd06659, STKc_PAK6, Catalytic domain of the Protei 2e-05
cd05048 283 cd05048, PTKc_Ror, Catalytic Domain of the Protein 2e-05
cd06614286 cd06614, STKc_PAK, Catalytic domain of the Protein 3e-05
cd08221256 cd08221, STKc_Nek9, Catalytic domain of the Protei 3e-05
cd08220 256 cd08220, STKc_Nek8, Catalytic domain of the Protei 3e-05
cd05592316 cd05592, STKc_nPKC_theta_delta, Catalytic domain o 4e-05
cd06609 274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 5e-05
cd05090 283 cd05090, PTKc_Ror1, Catalytic domain of the Protei 5e-05
cd05574 316 cd05574, STKc_phototropin_like, Catalytic domain o 6e-05
cd05118 283 cd05118, STKc_CMGC, Catalytic domain of CMGC famil 6e-05
cd06611 280 cd06611, STKc_SLK_like, Catalytic domain of Ste20- 6e-05
cd05611260 cd05611, STKc_Rim15_like, Catalytic domain of fung 7e-05
cd05082 256 cd05082, PTKc_Csk, Catalytic domain of the Protein 7e-05
cd05032 277 cd05032, PTKc_InsR_like, Catalytic domain of Insul 7e-05
PTZ00267478 PTZ00267, PTZ00267, NIMA-related protein kinase; P 8e-05
cd07838 287 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyc 9e-05
cd05612 291 cd05612, STKc_PRKX_like, Catalytic domain of PRKX- 9e-05
cd07832 286 cd07832, STKc_CCRK, Catalytic domain of the Serine 9e-05
cd07839 284 cd07839, STKc_CDK5, Catalytic domain of the Serine 9e-05
cd05599 364 cd05599, STKc_NDR_like, Catalytic domain of Nuclea 1e-04
cd06624 268 cd06624, STKc_ASK, Catalytic domain of the Protein 1e-04
cd06627254 cd06627, STKc_Cdc7_like, Catalytic domain of Cell 2e-04
cd06628267 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain o 2e-04
cd05083 254 cd05083, PTKc_Chk, Catalytic domain of the Protein 2e-04
cd05629 377 cd05629, STKc_NDR_like_fungal, Catalytic domain of 2e-04
cd08530256 cd08530, STKc_CNK2-like, Catalytic domain of the P 2e-04
cd05080 283 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) doma 2e-04
cd06623 264 cd06623, PKc_MAPKK_plant_like, Catalytic domain of 3e-04
cd06648 285 cd06648, STKc_PAK_II, Catalytic domain of the Prot 3e-04
cd08219255 cd08219, STKc_Nek3, Catalytic domain of the Protei 3e-04
cd08529256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 3e-04
cd06657292 cd06657, STKc_PAK4, Catalytic domain of the Protei 3e-04
cd05583288 cd05583, STKc_MSK_N, N-terminal catalytic domain o 3e-04
cd07860 284 cd07860, STKc_CDK2_3, Catalytic domain of the Seri 3e-04
cd05598376 cd05598, STKc_LATS, Catalytic domain of the Protei 4e-04
cd07833 288 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dep 4e-04
cd05626381 cd05626, STKc_LATS2, Catalytic domain of the Prote 4e-04
cd07861 285 cd07861, STKc_CDK1_euk, Catalytic domain of the Se 4e-04
cd08225 257 cd08225, STKc_Nek5, Catalytic domain of the Protei 4e-04
cd05046 275 cd05046, PTK_CCK4, Pseudokinase domain of the Prot 4e-04
cd07845 309 cd07845, STKc_CDK10, Catalytic domain of the Serin 4e-04
cd06658292 cd06658, STKc_PAK5, Catalytic domain of the Protei 5e-04
cd06917277 cd06917, STKc_NAK1_like, Catalytic domain of Funga 5e-04
cd08528 269 cd08528, STKc_Nek10, Catalytic domain of the Prote 5e-04
cd05579265 cd05579, STKc_MAST_like, Catalytic domain of Micro 6e-04
cd05600333 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fun 6e-04
cd08218 256 cd08218, STKc_Nek1, Catalytic domain of the Protei 6e-04
cd07830 283 cd07830, STKc_MAK_like, Catalytic domain of Male g 6e-04
cd06609274 cd06609, STKc_MST3_like, Catalytic domain of Mamma 7e-04
cd08221 256 cd08221, STKc_Nek9, Catalytic domain of the Protei 8e-04
cd05034 261 cd05034, PTKc_Src_like, Catalytic domain of Src ki 8e-04
cd05601330 cd05601, STKc_CRIK, Catalytic domain of the Protei 9e-04
cd06607 307 cd06607, STKc_TAO, Catalytic domain of the Protein 9e-04
cd05122253 cd05122, PKc_STE, Catalytic domain of STE family P 0.001
cd06632 258 cd06632, STKc_MEKK1_plant, Catalytic domain of the 0.001
PTZ00266 1021 PTZ00266, PTZ00266, NIMA-related protein kinase; P 0.001
cd05609305 cd05609, STKc_MAST, Catalytic domain of the Protei 0.001
cd07851 343 cd07851, STKc_p38, Catalytic domain of the Serine/ 0.001
cd05585312 cd05585, STKc_YPK1_like, Catalytic domain of Yeast 0.001
cd05628 363 cd05628, STKc_NDR1, Catalytic domain of the Protei 0.001
cd05586330 cd05586, STKc_Sck1_like, Catalytic domain of Suppr 0.001
cd05625382 cd05625, STKc_LATS1, Catalytic domain of the Prote 0.001
cd05577277 cd05577, STKc_GRK, Catalytic domain of the Protein 0.001
cd06610267 cd06610, STKc_OSR1_SPAK, Catalytic domain of the P 0.002
cd05627 360 cd05627, STKc_NDR2, Catalytic domain of the Protei 0.002
cd05055 302 cd05055, PTKc_PDGFR, Catalytic domain of the Prote 0.002
cd05582318 cd05582, STKc_RSK_N, N-terminal catalytic domain o 0.002
cd05052 263 cd05052, PTKc_Abl, Catalytic domain of the Protein 0.002
cd07865 310 cd07865, STKc_CDK9, Catalytic domain of the Serine 0.002
PHA03390267 PHA03390, pk1, serine/threonine-protein kinase 1; 0.002
cd05042 269 cd05042, PTKc_Aatyk, Catalytic domain of the Prote 0.002
cd05041 251 cd05041, PTKc_Fes_like, Catalytic domain of Fes-li 0.002
cd05038 284 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domai 0.002
cd06608 275 cd06608, STKc_myosinIII_like, Catalytic domain of 0.002
cd05084 252 cd05084, PTKc_Fes, Catalytic domain of the Protein 0.002
cd06637272 cd06637, STKc_TNIK, Catalytic domain of the Protei 0.002
PLN00034353 PLN00034, PLN00034, mitogen-activated protein kina 0.002
cd06657 292 cd06657, STKc_PAK4, Catalytic domain of the Protei 0.003
cd07840 287 cd07840, STKc_CDK9_like, Catalytic domain of Cycli 0.003
cd07854 342 cd07854, STKc_MAPK4_6, Catalytic domain of the Ser 0.003
cd05044 269 cd05044, PTKc_c-ros, Catalytic domain of the Prote 0.003
cd05088 303 cd05088, PTKc_Tie2, Catalytic domain of the Protei 0.003
cd05049 280 cd05049, PTKc_Trk, Catalytic domain of the Protein 0.003
cd05572262 cd05572, STKc_cGK_PKG, Catalytic domain of the Pro 0.004
cd08529 256 cd08529, STKc_FA2-like, Catalytic domain of the Pr 0.004
cd05598 376 cd05598, STKc_LATS, Catalytic domain of the Protei 0.004
cd06658 292 cd06658, STKc_PAK5, Catalytic domain of the Protei 0.004
cd05628363 cd05628, STKc_NDR1, Catalytic domain of the Protei 0.004
cd06608275 cd06608, STKc_myosinIII_like, Catalytic domain of 0.004
cd05607 277 cd05607, STKc_GRK7, Catalytic domain of the Protei 0.004
cd05081 284 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) 0.004
cd07858 337 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of 0.004
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
 Score = 91.4 bits (228), Expect = 4e-22
 Identities = 42/96 (43%), Positives = 55/96 (57%), Gaps = 8/96 (8%)

Query: 142 QHVAIKRITKKNLAKT-QNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNG 200
           + VAIK I KK + K  +   +EI ILK+L    H N+V L    E +  +YLVME+C G
Sbjct: 25  KLVAIKVIKKKKIKKDRERILREIKILKKL---KHPNIVRLYDVFEDEDKLYLVMEYCEG 81

Query: 201 GDLADYLVSKGTLSEDTIRIFLKLHQMLQ--LYFHD 234
           GDL D L  +G LSED  R +L+  Q+L    Y H 
Sbjct: 82  GDLFDLLKKRGRLSEDEARFYLR--QILSALEYLHS 115


Phosphotransferases. Serine or threonine-specific kinase subfamily. Length = 254

>gnl|CDD|173623 cd00180, PKc, Catalytic domain of Protein Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|214567 smart00220, S_TKc, Serine/Threonine protein kinases, catalytic domain Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173624 cd00192, PTKc, Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|219530 pfam07714, Pkinase_Tyr, Protein tyrosine kinase Back     alignment and domain information
>gnl|CDD|197581 smart00219, TyrKc, Tyrosine kinase, catalytic domain Back     alignment and domain information
>gnl|CDD|214568 smart00221, STYKc, Protein kinase; unclassified specificity Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|215690 pfam00069, Pkinase, Protein kinase domain Back     alignment and domain information
>gnl|CDD|173660 cd05123, STKc_AGC, Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173755 cd08215, STKc_Nek, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>gnl|CDD|173724 cd06606, STKc_MAPKKK, Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|133171 cd05039, PTKc_Csk_like, Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173671 cd05580, STKc_PKA, Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173664 cd05573, STKc_ROCK_NDR_like, Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|173757 cd08217, STKc_Nek2, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173672 cd05581, STKc_PDK1, Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>gnl|CDD|173733 cd07829, STKc_CDK_like, Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173727 cd06613, STKc_MAP4K3_like, Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132943 cd06612, STKc_MST1_2, Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173697 cd05606, STKc_beta_ARK, Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|143346 cd07841, STKc_CDK7, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>gnl|CDD|132962 cd06631, STKc_YSK4, Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|223589 COG0515, SPS1, Serine/threonine protein kinase [General function prediction only / Signal transduction mechanisms / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173749 cd07855, STKc_ERK5, Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>gnl|CDD|173669 cd05578, STKc_Yank1, Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132956 cd06625, STKc_MEKK3_like, Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133248 cd05148, PTKc_Srm_Brk, Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173729 cd06617, PKc_MKK3_6, Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>gnl|CDD|173738 cd07835, STKc_CDK1_like, Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173722 cd05633, STKc_GRK3, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>gnl|CDD|173737 cd07834, STKc_MAPK, Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|132957 cd06626, STKc_MEKK4, Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|132990 cd06659, STKc_PAK6, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>gnl|CDD|133179 cd05048, PTKc_Ror, Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>gnl|CDD|173728 cd06614, STKc_PAK, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173760 cd08220, STKc_Nek8, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>gnl|CDD|173683 cd05592, STKc_nPKC_theta_delta, Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133221 cd05090, PTKc_Ror1, Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>gnl|CDD|173665 cd05574, STKc_phototropin_like, Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143333 cd05118, STKc_CMGC, Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132942 cd06611, STKc_SLK_like, Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173702 cd05611, STKc_Rim15_like, Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|133213 cd05082, PTKc_Csk, Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|173625 cd05032, PTKc_InsR_like, Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|140293 PTZ00267, PTZ00267, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173739 cd07838, STKc_CDK4_6_like, Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173703 cd05612, STKc_PRKX_like, Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173736 cd07832, STKc_CCRK, Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>gnl|CDD|143344 cd07839, STKc_CDK5, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>gnl|CDD|173690 cd05599, STKc_NDR_like, Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173730 cd06624, STKc_ASK, Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>gnl|CDD|173731 cd06627, STKc_Cdc7_like, Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173732 cd06628, STKc_MAPKKK_Byr2_like, Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>gnl|CDD|133214 cd05083, PTKc_Chk, Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>gnl|CDD|173718 cd05629, STKc_NDR_like_fungal, Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173772 cd08530, STKc_CNK2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>gnl|CDD|133211 cd05080, PTKc_Tyk2_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>gnl|CDD|132954 cd06623, PKc_MAPKK_plant_like, Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>gnl|CDD|132979 cd06648, STKc_PAK_II, Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>gnl|CDD|173759 cd08219, STKc_Nek3, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|173674 cd05583, STKc_MSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>gnl|CDD|173751 cd07860, STKc_CDK2_3, Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|143338 cd07833, STKc_CDKL, Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173715 cd05626, STKc_LATS2, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>gnl|CDD|173752 cd07861, STKc_CDK1_euk, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>gnl|CDD|173765 cd08225, STKc_Nek5, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>gnl|CDD|133178 cd05046, PTK_CCK4, Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>gnl|CDD|173742 cd07845, STKc_CDK10, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|132991 cd06917, STKc_NAK1_like, Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173770 cd08528, STKc_Nek10, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>gnl|CDD|173670 cd05579, STKc_MAST_like, Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173758 cd08218, STKc_Nek1, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>gnl|CDD|173734 cd07830, STKc_MAK_like, Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|132940 cd06609, STKc_MST3_like, Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173761 cd08221, STKc_Nek9, Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>gnl|CDD|173626 cd05034, PTKc_Src_like, Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173692 cd05601, STKc_CRIK, Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>gnl|CDD|132938 cd06607, STKc_TAO, Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>gnl|CDD|173659 cd05122, PKc_STE, Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>gnl|CDD|132963 cd06632, STKc_MEKK1_plant, Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>gnl|CDD|173502 PTZ00266, PTZ00266, NIMA-related protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|173700 cd05609, STKc_MAST, Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>gnl|CDD|143356 cd07851, STKc_p38, Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase Back     alignment and domain information
>gnl|CDD|173676 cd05585, STKc_YPK1_like, Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173677 cd05586, STKc_Sck1_like, Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173714 cd05625, STKc_LATS1, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>gnl|CDD|173668 cd05577, STKc_GRK, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>gnl|CDD|173726 cd06610, STKc_OSR1_SPAK, Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>gnl|CDD|173716 cd05627, STKc_NDR2, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>gnl|CDD|133186 cd05055, PTKc_PDGFR, Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>gnl|CDD|173673 cd05582, STKc_RSK_N, N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>gnl|CDD|173633 cd05052, PTKc_Abl, Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>gnl|CDD|173754 cd07865, STKc_CDK9, Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>gnl|CDD|223069 PHA03390, pk1, serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>gnl|CDD|133174 cd05042, PTKc_Aatyk, Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>gnl|CDD|173629 cd05041, PTKc_Fes_like, Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|173628 cd05038, PTKc_Jak_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173645 cd05084, PTKc_Fes, Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>gnl|CDD|132968 cd06637, STKc_TNIK, Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>gnl|CDD|215036 PLN00034, PLN00034, mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>gnl|CDD|132988 cd06657, STKc_PAK4, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>gnl|CDD|143345 cd07840, STKc_CDK9_like, Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|143359 cd07854, STKc_MAPK4_6, Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>gnl|CDD|173630 cd05044, PTKc_c-ros, Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>gnl|CDD|133219 cd05088, PTKc_Tie2, Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>gnl|CDD|133180 cd05049, PTKc_Trk, Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>gnl|CDD|173663 cd05572, STKc_cGK_PKG, Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>gnl|CDD|173771 cd08529, STKc_FA2-like, Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>gnl|CDD|173689 cd05598, STKc_LATS, Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>gnl|CDD|132989 cd06658, STKc_PAK5, Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>gnl|CDD|173717 cd05628, STKc_NDR1, Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>gnl|CDD|173725 cd06608, STKc_myosinIII_like, Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>gnl|CDD|173698 cd05607, STKc_GRK7, Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>gnl|CDD|133212 cd05081, PTKc_Jak2_Jak3_rpt2, Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>gnl|CDD|143363 cd07858, STKc_TEY_MAPK_plant, Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 249
KOG0595|consensus 429 99.96
KOG0603|consensus 612 99.95
KOG0615|consensus 475 99.94
KOG0616|consensus 355 99.92
KOG0581|consensus 364 99.92
KOG0598|consensus 357 99.92
KOG0610|consensus 459 99.91
KOG0575|consensus 592 99.91
KOG0605|consensus 550 99.89
KOG0592|consensus 604 99.89
KOG0583|consensus 370 99.88
KOG0611|consensus 668 99.88
KOG0588|consensus 786 99.88
KOG0600|consensus 560 99.87
KOG0661|consensus 538 99.87
KOG0032|consensus 382 99.86
KOG0607|consensus 463 99.86
KOG0604|consensus 400 99.86
KOG0198|consensus 313 99.85
KOG0597|consensus 808 99.85
KOG0580|consensus 281 99.85
KOG0593|consensus 396 99.84
KOG0659|consensus 318 99.84
KOG0605|consensus550 99.84
cd05626 381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.83
cd05629 377 STKc_NDR_like_fungal Catalytic domain of Fungal Nu 99.83
cd05599 364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.83
cd05571 323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.83
cd05628 363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.83
cd05595 323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.83
cd05625 382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.83
cd05598 376 STKc_LATS Catalytic domain of the Protein Serine/T 99.82
cd05585 312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.82
KOG0663|consensus 419 99.82
KOG0599|consensus 411 99.82
KOG1187|consensus 361 99.82
KOG0586|consensus 596 99.82
KOG0192|consensus 362 99.82
cd05588 329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.82
cd05594 325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.82
PTZ00263 329 protein kinase A catalytic subunit; Provisional 99.82
cd05593 328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.82
KOG0585|consensus 576 99.82
KOG0582|consensus 516 99.81
cd05627 360 STKc_NDR2 Catalytic domain of the Protein Serine/T 99.81
KOG0610|consensus459 99.81
KOG4717|consensus 864 99.81
cd05612 291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.81
cd05600 333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.81
KOG0694|consensus 694 99.81
KOG0578|consensus 550 99.8
cd05589 324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.8
cd05586 330 STKc_Sck1_like Catalytic domain of Suppressor of l 99.8
cd05590 320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.8
cd05592 316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.8
cd05591 321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.8
cd05617 327 STKc_aPKC_zeta Catalytic domain of the Protein Ser 99.8
cd05621 370 STKc_ROCK2 Catalytic domain of the Protein Serine/ 99.8
KOG0033|consensus 355 99.8
cd05582 318 STKc_RSK_N N-terminal catalytic domain of the Prot 99.8
PTZ00426 340 cAMP-dependent protein kinase catalytic subunit; P 99.8
cd05575 323 STKc_SGK Catalytic domain of the Protein Serine/Th 99.79
cd05618 329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.79
KOG0574|consensus 502 99.79
cd05597 331 STKc_DMPK_like Catalytic domain of Myotonic Dystro 99.79
KOG0594|consensus 323 99.79
KOG0591|consensus 375 99.79
cd05620 316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.79
KOG0589|consensus 426 99.79
cd05603 321 STKc_SGK2 Catalytic domain of the Protein Serine/T 99.79
cd05587 324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.79
cd05619 316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.79
cd05596 370 STKc_ROCK Catalytic domain of the Protein Serine/T 99.79
cd05608 280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.79
PTZ00267 478 NIMA-related protein kinase; Provisional 99.79
cd05604 325 STKc_SGK3 Catalytic domain of the Protein Serine/T 99.79
cd05570 318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.79
cd05584 323 STKc_p70S6K Catalytic domain of the Protein Serine 99.79
cd05615 323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.79
cd05573 350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.78
cd05601 330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.78
cd06650 333 PKc_MEK1 Catalytic domain of the dual-specificity 99.78
cd08227 327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.78
cd05602 325 STKc_SGK1 Catalytic domain of the Protein Serine/T 99.78
cd05624 331 STKc_MRCK_beta Catalytic domain of the Protein Ser 99.78
KOG0660|consensus 359 99.78
KOG4721|consensus 904 99.78
cd06649 331 PKc_MEK2 Catalytic domain of the dual-specificity 99.78
cd05622 371 STKc_ROCK1 Catalytic domain of the Protein Serine/ 99.78
KOG1989|consensus 738 99.77
cd05631 285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.77
KOG0667|consensus 586 99.77
cd06645 267 STKc_MAP4K3 Catalytic domain of the Protein Serine 99.77
cd05616 323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.77
KOG4250|consensus 732 99.77
cd05084 252 PTKc_Fes Catalytic domain of the Protein Tyrosine 99.77
cd07871 288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.77
cd05607 277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.76
KOG0658|consensus 364 99.76
cd05623 332 STKc_MRCK_alpha Catalytic domain of the Protein Se 99.76
KOG4236|consensus 888 99.76
cd05614 332 STKc_MSK2_N N-terminal catalytic domain of the Pro 99.76
cd06646 267 STKc_MAP4K5 Catalytic domain of the Protein Serine 99.76
KOG0197|consensus 468 99.76
KOG0598|consensus357 99.76
cd05076 274 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of th 99.76
cd07848 287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.76
cd06615 308 PKc_MEK Catalytic domain of the dual-specificity P 99.76
cd05633 279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.76
KOG0033|consensus355 99.76
cd05064 266 PTKc_EphR_A10 Catalytic domain of the Protein Tyro 99.76
cd05610 669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.76
KOG0592|consensus604 99.75
cd05606 278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.75
cd05605 285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.75
cd07869 303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.75
PHA02988 283 hypothetical protein; Provisional 99.75
KOG0694|consensus694 99.75
KOG0690|consensus 516 99.75
KOG1035|consensus 1351 99.75
cd05104 375 PTKc_Kit Catalytic domain of the Protein Tyrosine 99.75
cd05609 305 STKc_MAST Catalytic domain of the Protein Serine/T 99.75
cd06611 280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.75
KOG0616|consensus355 99.75
cd05580 290 STKc_PKA Catalytic domain of the Protein Serine/Th 99.75
cd05102 338 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi 99.74
cd05105 400 PTKc_PDGFR_alpha Catalytic domain of the Protein T 99.74
PHA03212 391 serine/threonine kinase US3; Provisional 99.74
cd05096 304 PTKc_DDR1 Catalytic domain of the Protein Tyrosine 99.74
cd05577 277 STKc_GRK Catalytic domain of the Protein Serine/Th 99.74
KOG0581|consensus364 99.74
cd07859 338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.74
KOG0612|consensus 1317 99.74
cd05106 374 PTKc_CSF-1R Catalytic domain of the Protein Tyrosi 99.74
KOG0194|consensus 474 99.74
cd06630 268 STKc_MEKK1 Catalytic domain of the Protein Serine/ 99.73
PF00069 260 Pkinase: Protein kinase domain Protein kinase; unc 99.73
KOG0578|consensus550 99.73
PLN00034 353 mitogen-activated protein kinase kinase; Provision 99.73
cd06654 296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.73
cd05078 258 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain 99.73
cd05630 285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.73
cd06628 267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.73
cd06656 297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.73
cd06625 263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.73
cd06624 268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.73
cd05046 275 PTK_CCK4 Pseudokinase domain of the Protein Tyrosi 99.73
cd05576 237 STKc_RPK118_like Catalytic domain of the Protein S 99.72
cd08226 328 PK_STRAD_beta Pseudokinase domain of STE20-related 99.72
KOG1151|consensus 775 99.72
cd06613 262 STKc_MAP4K3_like Catalytic domain of Mitogen-activ 99.72
cd06643 282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.72
cd05611 260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.72
cd06629 272 STKc_MAPKKK_Bck1_like Catalytic domain of fungal B 99.72
cd05572 262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.72
KOG0588|consensus 786 99.72
cd07853 372 STKc_NLK Catalytic domain of the Serine/Threonine 99.72
KOG0575|consensus 592 99.72
cd05081 284 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of 99.72
KOG0986|consensus 591 99.72
cd06644 292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.72
cd05578 258 STKc_Yank1 Catalytic domain of the Protein Serine/ 99.72
cd05077 262 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of th 99.72
cd05632 285 STKc_GRK5 Catalytic domain of the Protein Serine/T 99.71
cd08221 256 STKc_Nek9 Catalytic domain of the Protein Serine/T 99.71
cd08219 255 STKc_Nek3 Catalytic domain of the Protein Serine/T 99.71
KOG0608|consensus 1034 99.71
KOG1290|consensus 590 99.71
cd06620 284 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr 99.71
cd05059 256 PTKc_Tec_like Catalytic domain of Tec-like Protein 99.71
KOG0662|consensus 292 99.71
PRK10345210 hypothetical protein; Provisional 99.71
PRK13184 932 pknD serine/threonine-protein kinase; Reviewed 99.71
cd07847 286 STKc_CDKL1_4 Catalytic domain of the Serine/Threon 99.71
cd07872 309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.71
cd05574 316 STKc_phototropin_like Catalytic domain of Phototro 99.71
cd05037 259 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the 99.71
cd08228 267 STKc_Nek6 Catalytic domain of the Protein Serine/T 99.71
cd05107 401 PTKc_PDGFR_beta Catalytic domain of the Protein Ty 99.71
PHA03390 267 pk1 serine/threonine-protein kinase 1; Provisional 99.71
cd05087 269 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein 99.71
cd06655 296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.71
PTZ00266 1021 NIMA-related protein kinase; Provisional 99.71
cd06659 297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.71
cd05088 303 PTKc_Tie2 Catalytic domain of the Protein Tyrosine 99.71
KOG0201|consensus 467 99.7
cd05042 269 PTKc_Aatyk Catalytic domain of the Protein Tyrosin 99.7
KOG0660|consensus359 99.7
cd05579 265 STKc_MAST_like Catalytic domain of Microtubule-ass 99.7
cd00192 262 PTKc Catalytic domain of Protein Tyrosine Kinases. 99.7
cd05114 256 PTKc_Tec_Rlk Catalytic domain of the Protein Tyros 99.7
cd06658 292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.7
cd06652 265 STKc_MEKK2 Catalytic domain of the Protein Serine/ 99.7
KOG0615|consensus475 99.7
cd06622 286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.7
cd06640 277 STKc_MST4 Catalytic domain of the Protein Serine/T 99.7
cd06631 265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.7
cd05039 256 PTKc_Csk_like Catalytic domain of C-terminal Src k 99.7
cd05093 288 PTKc_TrkB Catalytic domain of the Protein Tyrosine 99.7
cd06632 258 STKc_MEKK1_plant Catalytic domain of the Protein S 99.7
KOG0577|consensus 948 99.7
cd05052 263 PTKc_Abl Catalytic domain of the Protein Tyrosine 99.7
cd08529 256 STKc_FA2-like Catalytic domain of the Protein Seri 99.7
cd05066 267 PTKc_EphR_A Catalytic domain of the Protein Tyrosi 99.7
cd05148 261 PTKc_Srm_Brk Catalytic domain of the Protein Tyros 99.7
cd07841 298 STKc_CDK7 Catalytic domain of the Serine/Threonine 99.7
cd08229 267 STKc_Nek7 Catalytic domain of the Protein Serine/T 99.7
cd07863 288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.7
cd06641 277 STKc_MST3 Catalytic domain of the Protein Serine/T 99.7
cd06917 277 STKc_NAK1_like Catalytic domain of Fungal Nak1-lik 99.7
cd05079 284 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the 99.69
cd07873 301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.69
cd05113 256 PTKc_Btk_Bmx Catalytic domain of the Protein Tyros 99.69
cd05065 269 PTKc_EphR_B Catalytic domain of the Protein Tyrosi 99.69
cd05055 302 PTKc_PDGFR Catalytic domain of the Protein Tyrosin 99.69
cd06642 277 STKc_STK25-YSK1 Catalytic domain of the Protein Se 99.69
cd06647 293 STKc_PAK_I Catalytic domain of the Protein Serine/ 99.69
cd05072 261 PTKc_Lyn Catalytic domain of the Protein Tyrosine 99.69
cd07862 290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.69
cd05048 283 PTKc_Ror Catalytic Domain of the Protein Tyrosine 99.69
cd05049 280 PTKc_Trk Catalytic domain of the Protein Tyrosine 99.69
cd05115 257 PTKc_Zap-70 Catalytic domain of the Protein Tyrosi 99.69
cd05036 277 PTKc_ALK_LTK Catalytic domain of the Protein Tyros 99.69
cd08224 267 STKc_Nek6_Nek7 Catalytic domain of the Protein Ser 99.69
cd05116 257 PTKc_Syk Catalytic domain of the Protein Tyrosine 99.69
smart00219 258 TyrKc Tyrosine kinase, catalytic domain. Phosphotr 99.69
cd06619 279 PKc_MKK5 Catalytic domain of the dual-specificity 99.69
cd08216 314 PK_STRAD Pseudokinase domain of STE20-related kina 99.69
cd07844 291 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like 99.69
cd05092 280 PTKc_TrkA Catalytic domain of the Protein Tyrosine 99.69
cd05090 283 PTKc_Ror1 Catalytic domain of the Protein Tyrosine 99.68
cd05033 266 PTKc_EphR Catalytic domain of Ephrin Receptor Prot 99.68
cd05080 283 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the 99.68
KOG0603|consensus612 99.68
cd05613 290 STKc_MSK1_N N-terminal catalytic domain of the Pro 99.68
cd06648 285 STKc_PAK_II Catalytic domain of the Protein Serine 99.68
cd06638 286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.68
cd05060 257 PTKc_Syk_like Catalytic domain of Spleen Tyrosine 99.68
cd07861 285 STKc_CDK1_euk Catalytic domain of the Serine/Threo 99.68
cd06626 264 STKc_MEKK4 Catalytic domain of the Protein Serine/ 99.68
cd06657 292 STKc_PAK4 Catalytic domain of the Protein Serine/T 99.68
cd05047 270 PTKc_Tie Catalytic domain of Tie Protein Tyrosine 99.68
cd05068 261 PTKc_Frk_like Catalytic domain of Fyn-related kina 99.68
cd06614 286 STKc_PAK Catalytic domain of the Protein Serine/Th 99.68
cd05041 251 PTKc_Fes_like Catalytic domain of Fes-like Protein 99.68
cd07868 317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.68
cd07836 284 STKc_Pho85 Catalytic domain of the Serine/Threonin 99.68
cd05086 268 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosi 99.68
cd05063 268 PTKc_EphR_A2 Catalytic domain of the Protein Tyros 99.68
cd05094 291 PTKc_TrkC Catalytic domain of the Protein Tyrosine 99.68
PTZ00036 440 glycogen synthase kinase; Provisional 99.68
cd05051 296 PTKc_DDR Catalytic domain of the Protein Tyrosine 99.68
KOG4279|consensus 1226 99.68
cd08218 256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.67
PF07714 259 Pkinase_Tyr: Protein tyrosine kinase Protein kinas 99.67
cd08220 256 STKc_Nek8 Catalytic domain of the Protein Serine/T 99.67
cd07832 286 STKc_CCRK Catalytic domain of the Serine/Threonine 99.67
cd05103 343 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi 99.67
cd06627 254 STKc_Cdc7_like Catalytic domain of Cell division c 99.67
cd06651 266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.67
cd05612291 STKc_PRKX_like Catalytic domain of PRKX-like Prote 99.67
cd07846 286 STKc_CDKL2_3 Catalytic domain of the Serine/Threon 99.67
cd06623 264 PKc_MAPKK_plant_like Catalytic domain of Plant dua 99.67
cd06609 274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.67
PTZ00283 496 serine/threonine protein kinase; Provisional 99.67
KOG0590|consensus 601 99.67
cd05062 277 PTKc_IGF-1R Catalytic domain of the Protein Tyrosi 99.67
cd05101 304 PTKc_FGFR2 Catalytic domain of the Protein Tyrosin 99.67
cd05040 257 PTKc_Ack_like Catalytic domain of the Protein Tyro 99.67
cd05095 296 PTKc_DDR2 Catalytic domain of the Protein Tyrosine 99.67
cd06637 272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.67
PHA03207 392 serine/threonine kinase US3; Provisional 99.67
cd05085 250 PTKc_Fer Catalytic domain of the Protein Tyrosine 99.67
cd05038 284 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the P 99.67
cd05097 295 PTKc_DDR_like Catalytic domain of Discoidin Domain 99.67
cd05123 250 STKc_AGC Catalytic domain of AGC family Protein Se 99.67
cd06653 264 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kina 99.66
PTZ00024 335 cyclin-dependent protein kinase; Provisional 99.66
cd07848287 STKc_CDKL5 Catalytic domain of the Serine/Threonin 99.66
cd05108 316 PTKc_EGFR Catalytic domain of the Protein Tyrosine 99.66
cd08223 257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.66
PTZ00284467 protein kinase; Provisional 99.66
cd07843 293 STKc_CDC2L1 Catalytic domain of the Serine/Threoni 99.66
cd07876 359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.66
cd07870 291 STKc_PFTAIRE2 Catalytic domain of the Serine/Threo 99.66
KOG4645|consensus 1509 99.66
cd05061 288 PTKc_InsR Catalytic domain of the Protein Tyrosine 99.66
cd05112 256 PTKc_Itk Catalytic domain of the Protein Tyrosine 99.66
cd05099 314 PTKc_FGFR4 Catalytic domain of the Protein Tyrosin 99.66
cd05034 261 PTKc_Src_like Catalytic domain of Src kinase-like 99.66
cd05098 307 PTKc_FGFR1 Catalytic domain of the Protein Tyrosin 99.66
cd05581 280 STKc_PDK1 Catalytic domain of the Protein Serine/T 99.66
cd06612 256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.65
KOG4279|consensus 1226 99.65
cd06621 287 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek 99.65
PTZ00263329 protein kinase A catalytic subunit; Provisional 99.65
KOG0696|consensus683 99.65
PTZ00036440 glycogen synthase kinase; Provisional 99.65
cd05032 277 PTKc_InsR_like Catalytic domain of Insulin Recepto 99.65
cd05071 262 PTKc_Src Catalytic domain of the Protein Tyrosine 99.65
cd05053 293 PTKc_FGFR Catalytic domain of the Protein Tyrosine 99.65
cd07839 284 STKc_CDK5 Catalytic domain of the Serine/Threonine 99.65
cd06605 265 PKc_MAPKK Catalytic domain of the dual-specificity 99.65
KOG0201|consensus467 99.65
cd05122 253 PKc_STE Catalytic domain of STE family Protein Kin 99.65
cd07878 343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.65
cd08225 257 STKc_Nek5 Catalytic domain of the Protein Serine/T 99.65
KOG1026|consensus 774 99.65
KOG0584|consensus 632 99.65
KOG0695|consensus 593 99.65
cd05631285 STKc_GRK4 Catalytic domain of the Protein Serine/T 99.65
cd05057 279 PTKc_EGFR_like Catalytic domain of Epidermal Growt 99.65
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.65
cd07833 288 STKc_CDKL Catalytic domain of Cyclin-Dependent pro 99.65
cd08217 265 STKc_Nek2 Catalytic domain of the Protein Serine/T 99.65
cd05583 288 STKc_MSK_N N-terminal catalytic domain of the Prot 99.65
cd05089 297 PTKc_Tie1 Catalytic domain of the Protein Tyrosine 99.65
cd05044 269 PTKc_c-ros Catalytic domain of the Protein Tyrosin 99.65
cd05100 334 PTKc_FGFR3 Catalytic domain of the Protein Tyrosin 99.65
KOG2345|consensus 302 99.65
cd05067 260 PTKc_Lck_Blk Catalytic domain of the Protein Tyros 99.65
cd05035 273 PTKc_Axl_like Catalytic Domain of Axl-like Protein 99.65
PHA03211 461 serine/threonine kinase US3; Provisional 99.65
cd06606 260 STKc_MAPKKK Catalytic domain of the Protein Serine 99.64
cd07871288 STKc_PCTAIRE3 Catalytic domain of the Serine/Threo 99.64
cd05571323 STKc_PKB Catalytic domain of the Protein Serine/Th 99.64
cd06608 275 STKc_myosinIII_like Catalytic domain of Class III 99.64
cd06639 291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.64
cd05147190 RIO1_euk RIO kinase family; eukaryotic RIO1, catal 99.64
PTZ00284 467 protein kinase; Provisional 99.64
cd05109 279 PTKc_HER2 Catalytic domain of the Protein Tyrosine 99.64
cd06636 282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.64
PLN00009 294 cyclin-dependent kinase A; Provisional 99.64
cd06644292 STKc_STK10_LOK Catalytic domain of the Protein Ser 99.64
cd07867 317 STKc_CDC2L6 Catalytic domain of Serine/Threonine K 99.64
cd08215 258 STKc_Nek Catalytic domain of the Protein Serine/Th 99.64
KOG0597|consensus 808 99.64
PHA03209 357 serine/threonine kinase US3; Provisional 99.64
cd07862290 STKc_CDK6 Catalytic domain of the Serine/Threonine 99.64
cd05056 270 PTKc_FAK Catalytic domain of the Protein Tyrosine 99.64
cd06610 267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.63
cd07874 355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.63
cd07837 295 STKc_CdkB_plant Catalytic domain of the Serine/Thr 99.63
cd06643282 STKc_SLK Catalytic domain of the Protein Serine/Th 99.63
cd06617 283 PKc_MKK3_6 Catalytic domain of the dual-specificit 99.63
cd05054 337 PTKc_VEGFR Catalytic domain of the Protein Tyrosin 99.63
cd05075 272 PTKc_Axl Catalytic domain of the Protein Tyrosine 99.63
cd07842 316 STKc_CDK8_like Catalytic domain of Cyclin-Dependen 99.63
cd05619316 STKc_nPKC_theta Catalytic domain of the Protein Se 99.63
KOG0582|consensus516 99.63
cd06612256 STKc_MST1_2 Catalytic domain of the Protein Serine 99.63
cd05045 290 PTKc_RET Catalytic domain of the Protein Tyrosine 99.63
cd06611280 STKc_SLK_like Catalytic domain of Ste20-like kinas 99.63
cd05070 260 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyros 99.63
cd06631265 STKc_YSK4 Catalytic domain of the Protein Serine/T 99.63
cd06639291 STKc_myosinIIIB Catalytic domain of the Protein Se 99.63
cd05082 256 PTKc_Csk Catalytic domain of the Protein Tyrosine 99.63
cd05620316 STKc_nPKC_delta Catalytic domain of the Protein Se 99.62
cd05590320 STKc_nPKC_eta Catalytic domain of the Protein Seri 99.62
KOG4717|consensus 864 99.62
KOG0596|consensus677 99.62
cd07860 284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.62
cd05111 279 PTK_HER3 Pseudokinase domain of the Protein Tyrosi 99.62
KOG0198|consensus313 99.62
cd05073 260 PTKc_Hck Catalytic domain of the Protein Tyrosine 99.62
cd05616323 STKc_cPKC_beta Catalytic domain of the Protein Ser 99.62
cd05050 288 PTKc_Musk Catalytic domain of the Protein Tyrosine 99.62
cd07835 283 STKc_CDK1_like Catalytic domain of Cyclin-Dependen 99.62
smart00750176 KIND kinase non-catalytic C-lobe domain. It is an 99.62
cd07865 310 STKc_CDK9 Catalytic domain of the Serine/Threonine 99.62
cd05570318 STKc_PKC Catalytic domain of the Protein Serine/Th 99.62
cd07875 364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.62
KOG0986|consensus591 99.62
cd07838 287 STKc_CDK4_6_like Catalytic domain of Cyclin-Depend 99.62
cd08530 256 STKc_CNK2-like Catalytic domain of the Protein Ser 99.62
cd06655296 STKc_PAK2 Catalytic domain of the Protein Serine/T 99.61
cd07855 334 STKc_ERK5 Catalytic domain of the Serine/Threonine 99.61
cd07859338 STKc_TDY_MAPK_plant Catalytic domain of the Serine 99.61
cd05608280 STKc_GRK1 Catalytic domain of the Protein Serine/T 99.61
cd05069 260 PTKc_Yes Catalytic domain of the Protein Tyrosine 99.61
cd07845 309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.61
cd07840 287 STKc_CDK9_like Catalytic domain of Cyclin-Dependen 99.61
KOG1094|consensus 807 99.61
cd05610669 STKc_MASTL Catalytic domain of the Protein Serine/ 99.61
KOG0579|consensus 1187 99.61
KOG0667|consensus586 99.61
cd05585312 STKc_YPK1_like Catalytic domain of Yeast Protein K 99.61
cd07858 337 STKc_TEY_MAPK_plant Catalytic domain of the Serine 99.61
cd05083 254 PTKc_Chk Catalytic domain of the Protein Tyrosine 99.61
PTZ00426340 cAMP-dependent protein kinase catalytic subunit; P 99.61
KOG0614|consensus 732 99.61
cd06635 317 STKc_TAO1 Catalytic domain of the Protein Serine/T 99.61
cd05633279 STKc_GRK3 Catalytic domain of the Protein Serine/T 99.61
cd07854 342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.61
cd06608275 STKc_myosinIII_like Catalytic domain of Class III 99.61
cd06648285 STKc_PAK_II Catalytic domain of the Protein Serine 99.61
cd05587324 STKc_cPKC Catalytic domain of the Protein Serine/T 99.61
KOG0583|consensus370 99.61
cd06607 307 STKc_TAO Catalytic domain of the Protein Serine/Th 99.61
cd05591321 STKc_nPKC_epsilon Catalytic domain of the Protein 99.61
cd07863288 STKc_CDK4 Catalytic domain of the Serine/Threonine 99.61
cd05058 262 PTKc_Met_Ron Catalytic domain of the Protein Tyros 99.61
cd05589324 STKc_PKN Catalytic domain of the Protein Serine/Th 99.6
cd07831 282 STKc_MOK Catalytic domain of the Serine/Threonine 99.6
cd07880 343 STKc_p38gamma_MAPK12 Catalytic domain of the Serin 99.6
cd06649331 PKc_MEK2 Catalytic domain of the dual-specificity 99.6
cd07875364 STKc_JNK1 Catalytic domain of the Serine/Threonine 99.6
cd05110 303 PTKc_HER4 Catalytic domain of the Protein Tyrosine 99.6
KOG0197|consensus468 99.6
KOG1152|consensus772 99.6
KOG0696|consensus 683 99.6
cd05091 283 PTKc_Ror2 Catalytic domain of the Protein Tyrosine 99.6
cd06609274 STKc_MST3_like Catalytic domain of Mammalian Ste20 99.6
cd07869303 STKc_PFTAIRE1 Catalytic domain of the Serine/Threo 99.6
KOG0599|consensus411 99.6
cd06633 313 STKc_TAO3 Catalytic domain of the Protein Serine/T 99.6
cd07850 353 STKc_JNK Catalytic domain of the Serine/Threonine 99.6
KOG0666|consensus 438 99.6
cd08227327 PK_STRAD_alpha Pseudokinase domain of STE20-relate 99.6
cd06637272 STKc_TNIK Catalytic domain of the Protein Serine/T 99.6
cd05626381 STKc_LATS2 Catalytic domain of the Protein Serine/ 99.59
KOG0612|consensus 1317 99.59
cd05605285 STKc_GRK4_like Catalytic domain of G protein-coupl 99.59
KOG0659|consensus318 99.59
cd05611260 STKc_Rim15_like Catalytic domain of fungal Rim15-l 99.59
cd05595323 STKc_PKB_beta Catalytic domain of the Protein Seri 99.59
cd07873301 STKc_PCTAIRE1 Catalytic domain of the Serine/Threo 99.59
cd05592316 STKc_nPKC_theta_delta Catalytic domain of the Prot 99.59
cd07872309 STKc_PCTAIRE2 Catalytic domain of the Serine/Threo 99.59
cd05573350 STKc_ROCK_NDR_like Catalytic domain of ROCK- and N 99.59
cd05574316 STKc_phototropin_like Catalytic domain of Phototro 99.59
cd06636282 STKc_MAP4K4_6 Catalytic domain of the Protein Seri 99.59
cd05593328 STKc_PKB_gamma Catalytic domain of the Protein Ser 99.59
cd07834 330 STKc_MAPK Catalytic domain of the Serine/Threonine 99.59
cd07864 302 STKc_CDK12 Catalytic domain of the Serine/Threonin 99.59
PLN00034353 mitogen-activated protein kinase kinase; Provision 99.59
KOG0576|consensus 829 99.59
PHA02988283 hypothetical protein; Provisional 99.59
cd06624268 STKc_ASK Catalytic domain of the Protein Serine/Th 99.59
cd07856 328 STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre 99.59
KOG0587|consensus 953 99.59
cd06654296 STKc_PAK1 Catalytic domain of the Protein Serine/T 99.58
cd07853372 STKc_NLK Catalytic domain of the Serine/Threonine 99.58
cd07831282 STKc_MOK Catalytic domain of the Serine/Threonine 99.58
cd06625263 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase 99.58
cd08528 269 STKc_Nek10 Catalytic domain of the Protein Serine/ 99.58
cd05606278 STKc_beta_ARK Catalytic domain of the Protein Seri 99.58
KOG0983|consensus391 99.58
cd05625382 STKc_LATS1 Catalytic domain of the Protein Serine/ 99.58
cd05609305 STKc_MAST Catalytic domain of the Protein Serine/T 99.58
KOG0579|consensus 1187 99.58
KOG0585|consensus576 99.58
cd07876359 STKc_JNK2 Catalytic domain of the Serine/Threonine 99.58
KOG0032|consensus382 99.58
cd08223257 STKc_Nek4 Catalytic domain of the Protein Serine/T 99.58
cd06658292 STKc_PAK5 Catalytic domain of the Protein Serine/T 99.58
KOG0671|consensus 415 99.58
cd06610267 STKc_OSR1_SPAK Catalytic domain of the Protein Ser 99.58
cd05584323 STKc_p70S6K Catalytic domain of the Protein Serine 99.58
cd06628267 STKc_MAPKKK_Byr2_like Catalytic domain of fungal B 99.58
cd05118 283 STKc_CMGC Catalytic domain of CMGC family Serine/T 99.57
cd06659297 STKc_PAK6 Catalytic domain of the Protein Serine/T 99.57
KOG0580|consensus281 99.57
cd07854342 STKc_MAPK4_6 Catalytic domain of the Serine/Threon 99.57
cd05615323 STKc_cPKC_alpha Catalytic domain of the Protein Se 99.57
KOG0593|consensus396 99.57
PHA03390267 pk1 serine/threonine-protein kinase 1; Provisional 99.57
KOG0614|consensus732 99.57
cd07857 332 STKc_MPK1 Catalytic domain of the Serine/Threonine 99.57
PHA03207392 serine/threonine kinase US3; Provisional 99.57
cd07852 337 STKc_MAPK15 Catalytic domain of the Serine/Threoni 99.57
PHA03212391 serine/threonine kinase US3; Provisional 99.57
cd06656297 STKc_PAK3 Catalytic domain of the Protein Serine/T 99.57
cd06622286 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS 99.57
cd05588329 STKc_aPKC Catalytic domain of the Protein Serine/T 99.57
cd05630285 STKc_GRK6 Catalytic domain of the Protein Serine/T 99.57
cd05618329 STKc_aPKC_iota Catalytic domain of the Protein Ser 99.57
cd07868317 STKc_CDK8 Catalytic domain of the Serine/Threonine 99.57
cd05607277 STKc_GRK7 Catalytic domain of the Protein Serine/T 99.57
cd06616288 PKc_MKK4 Catalytic domain of the dual-specificity 99.57
cd05600333 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- 99.57
cd07849 336 STKc_ERK1_2_like Catalytic domain of Extracellular 99.57
cd07830 283 STKc_MAK_like Catalytic domain of Male germ cell-A 99.57
cd07829 282 STKc_CDK_like Catalytic domain of Cyclin-Dependent 99.57
cd06638286 STKc_myosinIIIA Catalytic domain of the Protein Se 99.56
cd05594325 STKc_PKB_alpha Catalytic domain of the Protein Ser 99.56
KOG0671|consensus415 99.56
cd07845309 STKc_CDK10 Catalytic domain of the Serine/Threonin 99.56
cd05572262 STKc_cGK_PKG Catalytic domain of the Protein Serin 99.56
KOG0193|consensus 678 99.56
KOG1095|consensus 1025 99.56
cd05599364 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Rel 99.56
cd05601330 STKc_CRIK Catalytic domain of the Protein Serine/T 99.56
cd05628363 STKc_NDR1 Catalytic domain of the Protein Serine/T 99.56
cd07878343 STKc_p38beta_MAPK11 Catalytic domain of the Serine 99.56
cd07874355 STKc_JNK3 Catalytic domain of the Serine/Threonine 99.56
cd06651266 STKc_MEKK3 Catalytic domain of the Protein Serine/ 99.56
cd08218256 STKc_Nek1 Catalytic domain of the Protein Serine/T 99.56
cd07860284 STKc_CDK2_3 Catalytic domain of the Serine/Threoni 99.56
KOG3653|consensus 534 99.56
>KOG0595|consensus Back     alignment and domain information
Probab=99.96  E-value=1.2e-28  Score=194.08  Aligned_cols=120  Identities=39%  Similarity=0.607  Sum_probs=111.7

Q ss_pred             cccCCCCcceeeccCCCCCCeeEEEEeecccccc--hhcHHHHHHHHHHhhhcCCCCeeeeeEeEEeCCeEEEEEeccCC
Q psy4166         123 VVSTSPPRPSSLLLSPAPSQHVAIKRITKKNLAK--TQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNG  200 (249)
Q Consensus       123 ~~~~g~~~~~~~~~~~~~~~~vavK~~~~~~~~~--~~~~~~e~~~~~~~~~~~h~niv~l~~~~~~~~~~~lv~e~~~~  200 (249)
                      .+|.|.++.||.+.+..++..||||++.+.....  .+....|+.+++.++   |||||.|++++.+.+++|+|||||.|
T Consensus        17 ~iG~GsfavVykg~h~~~~~~VAIK~i~~~~l~~k~~e~L~~Ei~iLkel~---H~nIV~l~d~~~~~~~i~lVMEyC~g   93 (429)
T KOG0595|consen   17 EIGSGSFAVVYKGRHKKSGTEVAIKCIAKKKLNKKLVELLLSEIKILKELK---HPNIVRLLDCIEDDDFIYLVMEYCNG   93 (429)
T ss_pred             hccCcceEEEEEeEeccCCceEEeeeehhhccCHHHHHHHHHHHHHHHhcC---CcceeeEEEEEecCCeEEEEEEeCCC
Confidence            4899999999999999999999999998875332  355788999999888   99999999999999999999999999


Q ss_pred             CCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhh-------cCCccceeeeec
Q psy4166         201 GDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFH-------DFTPWSFVILYT  245 (249)
Q Consensus       201 g~L~~~l~~~~~~~~~~~~~~~~~i~~~l~ylh-------d~kp~nili~~~  245 (249)
                      |||.++|++++.++|..++.|+.|++.|+++||       |+||.||||+++
T Consensus        94 GDLs~yi~~~~~l~e~t~r~Fm~QLA~alq~L~~~~IiHRDLKPQNiLLs~~  145 (429)
T KOG0595|consen   94 GDLSDYIRRRGRLPEATARHFMQQLASALQFLHENNIIHRDLKPQNILLSTT  145 (429)
T ss_pred             CCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHCCeeeccCCcceEEeccC
Confidence            999999999999999999999999999999999       999999999998



>KOG0603|consensus Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>KOG0611|consensus Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>KOG0600|consensus Back     alignment and domain information
>KOG0661|consensus Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>KOG0607|consensus Back     alignment and domain information
>KOG0604|consensus Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>KOG0605|consensus Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>cd05629 STKc_NDR_like_fungal Catalytic domain of Fungal Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05598 STKc_LATS Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0663|consensus Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>KOG1187|consensus Back     alignment and domain information
>KOG0586|consensus Back     alignment and domain information
>KOG0192|consensus Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd05627 STKc_NDR2 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 2 Back     alignment and domain information
>KOG0610|consensus Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd05586 STKc_Sck1_like Catalytic domain of Suppressor of loss of cAMP-dependent protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd05617 STKc_aPKC_zeta Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C zeta Back     alignment and domain information
>cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd05582 STKc_RSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, 90 kDa ribosomal protein S6 kinase Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>cd05575 STKc_SGK Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>KOG0574|consensus Back     alignment and domain information
>cd05597 STKc_DMPK_like Catalytic domain of Myotonic Dystrophy protein kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0594|consensus Back     alignment and domain information
>KOG0591|consensus Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>KOG0589|consensus Back     alignment and domain information
>cd05603 STKc_SGK2 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 2 Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>PTZ00267 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd05604 STKc_SGK3 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 3 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd06650 PKc_MEK1 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 1 Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd05602 STKc_SGK1 Catalytic domain of the Protein Serine/Threonine Kinase, Serum- and Glucocorticoid-induced Kinase 1 Back     alignment and domain information
>cd05624 STKc_MRCK_beta Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase beta Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>KOG4721|consensus Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 Back     alignment and domain information
>KOG1989|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>KOG4250|consensus Back     alignment and domain information
>cd05084 PTKc_Fes Catalytic domain of the Protein Tyrosine Kinase, Fes Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>KOG0658|consensus Back     alignment and domain information
>cd05623 STKc_MRCK_alpha Catalytic domain of the Protein Serine/Threonine Kinase, DMPK-related cell division control protein 42 binding kinase alpha Back     alignment and domain information
>KOG4236|consensus Back     alignment and domain information
>cd05614 STKc_MSK2_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 2 Back     alignment and domain information
>cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG0598|consensus Back     alignment and domain information
>cd05076 PTK_Tyk2_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd06615 PKc_MEK Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>KOG0033|consensus Back     alignment and domain information
>cd05064 PTKc_EphR_A10 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A10 Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0592|consensus Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>KOG0694|consensus Back     alignment and domain information
>KOG0690|consensus Back     alignment and domain information
>KOG1035|consensus Back     alignment and domain information
>cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0616|consensus Back     alignment and domain information
>cd05580 STKc_PKA Catalytic domain of the Protein Serine/Threonine Kinase, cAMP-dependent protein kinase Back     alignment and domain information
>cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 Back     alignment and domain information
>cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05096 PTKc_DDR1 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 1 Back     alignment and domain information
>cd05577 STKc_GRK Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase Back     alignment and domain information
>KOG0581|consensus Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor Back     alignment and domain information
>KOG0194|consensus Back     alignment and domain information
>cd06630 STKc_MEKK1 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 1 Back     alignment and domain information
>PF00069 Pkinase: Protein kinase domain Protein kinase; unclassified specificity Back     alignment and domain information
>KOG0578|consensus Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd05078 PTK_Jak2_Jak3_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd05046 PTK_CCK4 Pseudokinase domain of the Protein Tyrosine Kinase, Colon Carcinoma Kinase 4 Back     alignment and domain information
>cd05576 STKc_RPK118_like Catalytic domain of the Protein Serine/Threonine Kinases, RPK118 and similar proteins Back     alignment and domain information
>cd08226 PK_STRAD_beta Pseudokinase domain of STE20-related kinase adapter protein beta Back     alignment and domain information
>KOG1151|consensus Back     alignment and domain information
>cd06613 STKc_MAP4K3_like Catalytic domain of Mitogen-activated protein kinase kinase kinase kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06629 STKc_MAPKKK_Bck1_like Catalytic domain of fungal Bck1-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG0588|consensus Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>KOG0575|consensus Back     alignment and domain information
>cd05081 PTKc_Jak2_Jak3_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases 2 and 3 Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd05578 STKc_Yank1 Catalytic domain of the Protein Serine/Threonine Kinase, Yank1 Back     alignment and domain information
>cd05077 PTK_Jak1_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd05632 STKc_GRK5 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 5 Back     alignment and domain information
>cd08221 STKc_Nek9 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 9 Back     alignment and domain information
>cd08219 STKc_Nek3 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 3 Back     alignment and domain information
>KOG0608|consensus Back     alignment and domain information
>KOG1290|consensus Back     alignment and domain information
>cd06620 PKc_MAPKK_Byr1_like Catalytic domain of fungal Byr1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05059 PTKc_Tec_like Catalytic domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>KOG0662|consensus Back     alignment and domain information
>PRK10345 hypothetical protein; Provisional Back     alignment and domain information
>PRK13184 pknD serine/threonine-protein kinase; Reviewed Back     alignment and domain information
>cd07847 STKc_CDKL1_4 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 1 and 4 Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05037 PTK_Jak_rpt1 Pseudokinase (repeat 1) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd08228 STKc_Nek6 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 6 Back     alignment and domain information
>cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>cd05087 PTKc_Aatyk1_Aatyk3 Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases 1 and 3 Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>cd05088 PTKc_Tie2 Catalytic domain of the Protein Tyrosine Kinase, Tie2 Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05042 PTKc_Aatyk Catalytic domain of the Protein Tyrosine Kinases, Apoptosis-associated tyrosine kinases Back     alignment and domain information
>KOG0660|consensus Back     alignment and domain information
>cd05579 STKc_MAST_like Catalytic domain of Microtubule-associated serine/threonine kinase-like proteins Back     alignment and domain information
>cd00192 PTKc Catalytic domain of Protein Tyrosine Kinases Back     alignment and domain information
>cd05114 PTKc_Tec_Rlk Catalytic domain of the Protein Tyrosine Kinases, Tyrosine kinase expressed in hepatocellular carcinoma and Resting lymphocyte kinase Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>cd06652 STKc_MEKK2 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 2 Back     alignment and domain information
>KOG0615|consensus Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd06640 STKc_MST4 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 4 Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd05039 PTKc_Csk_like Catalytic domain of C-terminal Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05093 PTKc_TrkB Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase B Back     alignment and domain information
>cd06632 STKc_MEKK1_plant Catalytic domain of the Protein Serine/Threonine Kinase, Plant MAP/ERK kinase kinase 1 Back     alignment and domain information
>KOG0577|consensus Back     alignment and domain information
>cd05052 PTKc_Abl Catalytic domain of the Protein Tyrosine Kinase, Abelson kinase Back     alignment and domain information
>cd08529 STKc_FA2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii FA2 and similar domains Back     alignment and domain information
>cd05066 PTKc_EphR_A Catalytic domain of the Protein Tyrosine Kinases, Class EphA Ephrin Receptors Back     alignment and domain information
>cd05148 PTKc_Srm_Brk Catalytic domain of the Protein Tyrosine Kinases, Srm and Brk Back     alignment and domain information
>cd07841 STKc_CDK7 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 7 Back     alignment and domain information
>cd08229 STKc_Nek7 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 7 Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd06641 STKc_MST3 Catalytic domain of the Protein Serine/Threonine Kinase, Mammalian Ste20-like protein kinase 3 Back     alignment and domain information
>cd06917 STKc_NAK1_like Catalytic domain of Fungal Nak1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05079 PTKc_Jak1_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Janus kinase 1 Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05113 PTKc_Btk_Bmx Catalytic domain of the Protein Tyrosine Kinases, Bruton's tyrosine kinase and Bone marrow kinase on the X chromosome Back     alignment and domain information
>cd05065 PTKc_EphR_B Catalytic domain of the Protein Tyrosine Kinases, Class EphB Ephrin Receptors Back     alignment and domain information
>cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors Back     alignment and domain information
>cd06642 STKc_STK25-YSK1 Catalytic domain of the Protein Serine/Threonine Kinase, STK25 or Yeast Sps1/Ste20-related kinase 1 Back     alignment and domain information
>cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase Back     alignment and domain information
>cd05072 PTKc_Lyn Catalytic domain of the Protein Tyrosine Kinase, Lyn Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05048 PTKc_Ror Catalytic Domain of the Protein Tyrosine Kinases, Receptor tyrosine kinase-like Orphan Receptors Back     alignment and domain information
>cd05049 PTKc_Trk Catalytic domain of the Protein Tyrosine Kinases, Tropomyosin Related Kinases Back     alignment and domain information
>cd05115 PTKc_Zap-70 Catalytic domain of the Protein Tyrosine Kinase, Zeta-chain-associated protein of 70kDa Back     alignment and domain information
>cd05036 PTKc_ALK_LTK Catalytic domain of the Protein Tyrosine Kinases, Anaplastic Lymphoma Kinase and Leukocyte Tyrosine Kinase Back     alignment and domain information
>cd08224 STKc_Nek6_Nek7 Catalytic domain of the Protein Serine/Threonine Kinases, Never In Mitosis gene A-related kinase 6 and 7 Back     alignment and domain information
>cd05116 PTKc_Syk Catalytic domain of the Protein Tyrosine Kinase, Spleen tyrosine kinase Back     alignment and domain information
>smart00219 TyrKc Tyrosine kinase, catalytic domain Back     alignment and domain information
>cd06619 PKc_MKK5 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 5 Back     alignment and domain information
>cd08216 PK_STRAD Pseudokinase domain of STE20-related kinase adapter protein Back     alignment and domain information
>cd07844 STKc_PCTAIRE_like Catalytic domain of PCTAIRE-like Serine/Threonine Kinases Back     alignment and domain information
>cd05092 PTKc_TrkA Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase A Back     alignment and domain information
>cd05090 PTKc_Ror1 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 1 Back     alignment and domain information
>cd05033 PTKc_EphR Catalytic domain of Ephrin Receptor Protein Tyrosine Kinases Back     alignment and domain information
>cd05080 PTKc_Tyk2_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinase, Tyrosine kinase 2 Back     alignment and domain information
>KOG0603|consensus Back     alignment and domain information
>cd05613 STKc_MSK1_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase 1 Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05060 PTKc_Syk_like Catalytic domain of Spleen Tyrosine Kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07861 STKc_CDK1_euk Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 1 from higher eukaryotes-like Back     alignment and domain information
>cd06626 STKc_MEKK4 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 4 Back     alignment and domain information
>cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 Back     alignment and domain information
>cd05047 PTKc_Tie Catalytic domain of Tie Protein Tyrosine Kinases Back     alignment and domain information
>cd05068 PTKc_Frk_like Catalytic domain of Fyn-related kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase Back     alignment and domain information
>cd05041 PTKc_Fes_like Catalytic domain of Fes-like Protein Tyrosine Kinases Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd07836 STKc_Pho85 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Pho85 Back     alignment and domain information
>cd05086 PTKc_Aatyk2 Catalytic domain of the Protein Tyrosine Kinase, Apoptosis-associated tyrosine kinase 2 Back     alignment and domain information
>cd05063 PTKc_EphR_A2 Catalytic domain of the Protein Tyrosine Kinase, Ephrin Receptor A2 Back     alignment and domain information
>cd05094 PTKc_TrkC Catalytic domain of the Protein Tyrosine Kinase, Tropomyosin Related Kinase C Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05051 PTKc_DDR Catalytic domain of the Protein Tyrosine Kinases, Discoidin Domain Receptors Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>PF07714 Pkinase_Tyr: Protein tyrosine kinase Protein kinase; unclassified specificity Back     alignment and domain information
>cd08220 STKc_Nek8 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 8 Back     alignment and domain information
>cd07832 STKc_CCRK Catalytic domain of the Serine/Threonine Kinase, Cell Cycle-Related Kinase Back     alignment and domain information
>cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 Back     alignment and domain information
>cd06627 STKc_Cdc7_like Catalytic domain of Cell division control protein 7-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd05612 STKc_PRKX_like Catalytic domain of PRKX-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07846 STKc_CDKL2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase Like 2 and 3 Back     alignment and domain information
>cd06623 PKc_MAPKK_plant_like Catalytic domain of Plant dual-specificity MAP kinase kinases and similar proteins Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00283 serine/threonine protein kinase; Provisional Back     alignment and domain information
>KOG0590|consensus Back     alignment and domain information
>cd05062 PTKc_IGF-1R Catalytic domain of the Protein Tyrosine Kinase, Insulin-like Growth Factor-1 Receptor Back     alignment and domain information
>cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 Back     alignment and domain information
>cd05040 PTKc_Ack_like Catalytic domain of the Protein Tyrosine Kinase, Activated Cdc42-associated kinase Back     alignment and domain information
>cd05095 PTKc_DDR2 Catalytic domain of the Protein Tyrosine Kinase, Discoidin Domain Receptor 2 Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd05085 PTKc_Fer Catalytic domain of the Protein Tyrosine Kinase, Fer Back     alignment and domain information
>cd05038 PTKc_Jak_rpt2 Catalytic (repeat 2) domain of the Protein Tyrosine Kinases, Janus kinases Back     alignment and domain information
>cd05097 PTKc_DDR_like Catalytic domain of Discoidin Domain Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05123 STKc_AGC Catalytic domain of AGC family Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06653 STKc_MEKK3_like_1 Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>PTZ00024 cyclin-dependent protein kinase; Provisional Back     alignment and domain information
>cd07848 STKc_CDKL5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase Like 5 Back     alignment and domain information
>cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd07843 STKc_CDC2L1 Catalytic domain of the Serine/Threonine Kinase, Cell Division Cycle 2-like 1 Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>cd07870 STKc_PFTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-2 kinase Back     alignment and domain information
>KOG4645|consensus Back     alignment and domain information
>cd05061 PTKc_InsR Catalytic domain of the Protein Tyrosine Kinase, Insulin Receptor Back     alignment and domain information
>cd05112 PTKc_Itk Catalytic domain of the Protein Tyrosine Kinase, Interleukin-2-inducible T-cell Kinase Back     alignment and domain information
>cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 Back     alignment and domain information
>cd05034 PTKc_Src_like Catalytic domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 Back     alignment and domain information
>cd05581 STKc_PDK1 Catalytic domain of the Protein Serine/Threonine Kinase, Phosphoinositide-dependent kinase 1 Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>KOG4279|consensus Back     alignment and domain information
>cd06621 PKc_MAPKK_Pek1_like Catalytic domain of fungal Pek1-like dual-specificity MAP kinase kinases Back     alignment and domain information
>PTZ00263 protein kinase A catalytic subunit; Provisional Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>PTZ00036 glycogen synthase kinase; Provisional Back     alignment and domain information
>cd05032 PTKc_InsR_like Catalytic domain of Insulin Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>cd05071 PTKc_Src Catalytic domain of the Protein Tyrosine Kinase, Src Back     alignment and domain information
>cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors Back     alignment and domain information
>cd07839 STKc_CDK5 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 5 Back     alignment and domain information
>cd06605 PKc_MAPKK Catalytic domain of the dual-specificity Protein Kinase, Mitogen-Activated Protein Kinase Kinase Back     alignment and domain information
>KOG0201|consensus Back     alignment and domain information
>cd05122 PKc_STE Catalytic domain of STE family Protein Kinases Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd08225 STKc_Nek5 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 5 Back     alignment and domain information
>KOG1026|consensus Back     alignment and domain information
>KOG0584|consensus Back     alignment and domain information
>KOG0695|consensus Back     alignment and domain information
>cd05631 STKc_GRK4 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 4 Back     alignment and domain information
>cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>cd07833 STKc_CDKL Catalytic domain of Cyclin-Dependent protein Kinase Like Serine/Threonine Kinases Back     alignment and domain information
>cd08217 STKc_Nek2 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 2 Back     alignment and domain information
>cd05583 STKc_MSK_N N-terminal catalytic domain of the Protein Serine/Threonine Kinase, Mitogen and stress-activated kinase Back     alignment and domain information
>cd05089 PTKc_Tie1 Catalytic domain of the Protein Tyrosine Kinase, Tie1 Back     alignment and domain information
>cd05044 PTKc_c-ros Catalytic domain of the Protein Tyrosine Kinase, C-ros Back     alignment and domain information
>cd05100 PTKc_FGFR3 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 3 Back     alignment and domain information
>KOG2345|consensus Back     alignment and domain information
>cd05067 PTKc_Lck_Blk Catalytic domain of the Protein Tyrosine Kinases, Lymphocyte-specific kinase and Blk Back     alignment and domain information
>cd05035 PTKc_Axl_like Catalytic Domain of Axl-like Protein Tyrosine Kinases Back     alignment and domain information
>PHA03211 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06606 STKc_MAPKKK Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Kinase Kinase Back     alignment and domain information
>cd07871 STKc_PCTAIRE3 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-3 kinase Back     alignment and domain information
>cd05571 STKc_PKB Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05147 RIO1_euk RIO kinase family; eukaryotic RIO1, catalytic domain Back     alignment and domain information
>PTZ00284 protein kinase; Provisional Back     alignment and domain information
>cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>PLN00009 cyclin-dependent kinase A; Provisional Back     alignment and domain information
>cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase Back     alignment and domain information
>cd07867 STKc_CDC2L6 Catalytic domain of Serine/Threonine Kinase, Cell Division Cycle 2-like 6 Back     alignment and domain information
>cd08215 STKc_Nek Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase Back     alignment and domain information
>KOG0597|consensus Back     alignment and domain information
>PHA03209 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07862 STKc_CDK6 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 6 Back     alignment and domain information
>cd05056 PTKc_FAK Catalytic domain of the Protein Tyrosine Kinase, Focal Adhesion Kinase Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd07837 STKc_CdkB_plant Catalytic domain of the Serine/Threonine Kinase, Plant B-type Cyclin-Dependent protein Kinase Back     alignment and domain information
>cd06643 STKc_SLK Catalytic domain of the Protein Serine/Threonine Kinase, Ste20-like kinase Back     alignment and domain information
>cd06617 PKc_MKK3_6 Catalytic domain of the dual-specificity Protein Kinases, MAP kinase kinases 3 and 6 Back     alignment and domain information
>cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors Back     alignment and domain information
>cd05075 PTKc_Axl Catalytic domain of the Protein Tyrosine Kinase, Axl Back     alignment and domain information
>cd07842 STKc_CDK8_like Catalytic domain of Cyclin-Dependent protein Kinase 8-like Serine/Threonine Kinases Back     alignment and domain information
>cd05619 STKc_nPKC_theta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C theta Back     alignment and domain information
>KOG0582|consensus Back     alignment and domain information
>cd06612 STKc_MST1_2 Catalytic domain of the Protein Serine/Threonine Kinases, Mammalian Ste20-like protein kinase 1 and 2 Back     alignment and domain information
>cd05045 PTKc_RET Catalytic domain of the Protein Tyrosine Kinase, REarranged during Transfection protein Back     alignment and domain information
>cd06611 STKc_SLK_like Catalytic domain of Ste20-like kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05070 PTKc_Fyn_Yrk Catalytic domain of the Protein Tyrosine Kinases, Fyn and Yrk Back     alignment and domain information
>cd06631 STKc_YSK4 Catalytic domain of the Protein Serine/Threonine Kinase, Yeast Sps1/Ste20-related kinase 4 Back     alignment and domain information
>cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin Back     alignment and domain information
>cd05082 PTKc_Csk Catalytic domain of the Protein Tyrosine Kinase, C-terminal Src kinase Back     alignment and domain information
>cd05620 STKc_nPKC_delta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C delta Back     alignment and domain information
>cd05590 STKc_nPKC_eta Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C eta Back     alignment and domain information
>KOG4717|consensus Back     alignment and domain information
>KOG0596|consensus Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 Back     alignment and domain information
>KOG0198|consensus Back     alignment and domain information
>cd05073 PTKc_Hck Catalytic domain of the Protein Tyrosine Kinase, Hematopoietic cell kinase Back     alignment and domain information
>cd05616 STKc_cPKC_beta Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C beta Back     alignment and domain information
>cd05050 PTKc_Musk Catalytic domain of the Protein Tyrosine Kinase, Muscle-specific kinase Back     alignment and domain information
>cd07835 STKc_CDK1_like Catalytic domain of Cyclin-Dependent protein Kinase 1-like Serine/Threonine Kinases Back     alignment and domain information
>smart00750 KIND kinase non-catalytic C-lobe domain Back     alignment and domain information
>cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 Back     alignment and domain information
>cd05570 STKc_PKC Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase C Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>KOG0986|consensus Back     alignment and domain information
>cd07838 STKc_CDK4_6_like Catalytic domain of Cyclin-Dependent protein Kinase 4 and 6-like Serine/Threonine Kinases Back     alignment and domain information
>cd08530 STKc_CNK2-like Catalytic domain of the Protein Serine/Threonine Kinase, Chlamydomonas reinhardtii CNK2, and similar domains Back     alignment and domain information
>cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 Back     alignment and domain information
>cd07855 STKc_ERK5 Catalytic domain of the Serine/Threonine Kinase, Extracellular signal-Regulated Kinase 5 Back     alignment and domain information
>cd07859 STKc_TDY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TDY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05608 STKc_GRK1 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 1 Back     alignment and domain information
>cd05069 PTKc_Yes Catalytic domain of the Protein Tyrosine Kinase, Yes Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd07840 STKc_CDK9_like Catalytic domain of Cyclin-Dependent protein Kinase 9-like Serine/Threonine Kinases Back     alignment and domain information
>KOG1094|consensus Back     alignment and domain information
>cd05610 STKc_MASTL Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine-like kinase Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>KOG0667|consensus Back     alignment and domain information
>cd05585 STKc_YPK1_like Catalytic domain of Yeast Protein Kinase 1-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07858 STKc_TEY_MAPK_plant Catalytic domain of the Serine/Threonine Kinases, TEY Mitogen-Activated Protein Kinases from Plants Back     alignment and domain information
>cd05083 PTKc_Chk Catalytic domain of the Protein Tyrosine Kinase, Csk homologous kinase Back     alignment and domain information
>PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 Back     alignment and domain information
>cd05633 STKc_GRK3 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 3 Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd06608 STKc_myosinIII_like Catalytic domain of Class III myosin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase Back     alignment and domain information
>cd05587 STKc_cPKC Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C Back     alignment and domain information
>KOG0583|consensus Back     alignment and domain information
>cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins Back     alignment and domain information
>cd05591 STKc_nPKC_epsilon Catalytic domain of the Protein Serine/Threonine Kinase, Novel Protein Kinase C epsilon Back     alignment and domain information
>cd07863 STKc_CDK4 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 4 Back     alignment and domain information
>cd05058 PTKc_Met_Ron Catalytic domain of the Protein Tyrosine Kinases, Met and Ron Back     alignment and domain information
>cd05589 STKc_PKN Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase N Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd06649 PKc_MEK2 Catalytic domain of the dual-specificity Protein Kinase, MAP/ERK Kinase 2 Back     alignment and domain information
>cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 Back     alignment and domain information
>cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG1152|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>cd05091 PTKc_Ror2 Catalytic domain of the Protein Tyrosine Kinase, Receptor tyrosine kinase-like Orphan Receptor 2 Back     alignment and domain information
>cd06609 STKc_MST3_like Catalytic domain of Mammalian Ste20-like protein kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07869 STKc_PFTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PFTAIRE-1 kinase Back     alignment and domain information
>KOG0599|consensus Back     alignment and domain information
>cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 Back     alignment and domain information
>cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase Back     alignment and domain information
>KOG0666|consensus Back     alignment and domain information
>cd08227 PK_STRAD_alpha Pseudokinase domain of STE20-related kinase adapter protein alpha Back     alignment and domain information
>cd06637 STKc_TNIK Catalytic domain of the Protein Serine/Threonine Kinase, Traf2- and Nck-interacting kinase Back     alignment and domain information
>cd05626 STKc_LATS2 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 2 Back     alignment and domain information
>KOG0612|consensus Back     alignment and domain information
>cd05605 STKc_GRK4_like Catalytic domain of G protein-coupled Receptor Kinase 4-like Protein Serine/Threonine Kinases Back     alignment and domain information
>KOG0659|consensus Back     alignment and domain information
>cd05611 STKc_Rim15_like Catalytic domain of fungal Rim15-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05595 STKc_PKB_beta Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B beta Back     alignment and domain information
>cd07873 STKc_PCTAIRE1 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-1 kinase Back     alignment and domain information
>cd05592 STKc_nPKC_theta_delta Catalytic domain of the Protein Serine/Threonine Kinases, Novel Protein Kinase C theta and delta Back     alignment and domain information
>cd07872 STKc_PCTAIRE2 Catalytic domain of the Serine/Threonine Kinase, PCTAIRE-2 kinase Back     alignment and domain information
>cd05573 STKc_ROCK_NDR_like Catalytic domain of ROCK- and NDR kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05574 STKc_phototropin_like Catalytic domain of Phototropin-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 Back     alignment and domain information
>cd05593 STKc_PKB_gamma Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B gamma Back     alignment and domain information
>cd07834 STKc_MAPK Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 Back     alignment and domain information
>PLN00034 mitogen-activated protein kinase kinase; Provisional Back     alignment and domain information
>KOG0576|consensus Back     alignment and domain information
>PHA02988 hypothetical protein; Provisional Back     alignment and domain information
>cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase Back     alignment and domain information
>cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 Back     alignment and domain information
>KOG0587|consensus Back     alignment and domain information
>cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 Back     alignment and domain information
>cd07853 STKc_NLK Catalytic domain of the Serine/Threonine Kinase, Nemo-Like Kinase Back     alignment and domain information
>cd07831 STKc_MOK Catalytic domain of the Serine/Threonine Kinase, MAPK/MAK/MRK Overlapping Kinase Back     alignment and domain information
>cd06625 STKc_MEKK3_like Catalytic domain of MAP/ERK kinase kinase 3-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd08528 STKc_Nek10 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 10 Back     alignment and domain information
>cd05606 STKc_beta_ARK Catalytic domain of the Protein Serine/Threonine Kinase, beta-adrenergic receptor kinase Back     alignment and domain information
>KOG0983|consensus Back     alignment and domain information
>cd05625 STKc_LATS1 Catalytic domain of the Protein Serine/Threonine Kinase, Large Tumor Suppressor 1 Back     alignment and domain information
>cd05609 STKc_MAST Catalytic domain of the Protein Serine/Threonine Kinase, Microtubule-associated serine/threonine kinase Back     alignment and domain information
>KOG0579|consensus Back     alignment and domain information
>KOG0585|consensus Back     alignment and domain information
>cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 Back     alignment and domain information
>KOG0032|consensus Back     alignment and domain information
>cd08223 STKc_Nek4 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 4 Back     alignment and domain information
>cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd06610 STKc_OSR1_SPAK Catalytic domain of the Protein Serine/Threonine Kinases, Oxidative stress response kinase and Ste20-related proline alanine-rich kinase Back     alignment and domain information
>cd05584 STKc_p70S6K Catalytic domain of the Protein Serine/Threonine Kinase, 70 kDa ribosomal protein S6 kinase Back     alignment and domain information
>cd06628 STKc_MAPKKK_Byr2_like Catalytic domain of fungal Byr2-like MAP Kinase Kinase Kinases Back     alignment and domain information
>cd05118 STKc_CMGC Catalytic domain of CMGC family Serine/Threonine Kinases Back     alignment and domain information
>cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 Back     alignment and domain information
>KOG0580|consensus Back     alignment and domain information
>cd07854 STKc_MAPK4_6 Catalytic domain of the Serine/Threonine Kinases, Mitogen-Activated Protein Kinases 4 and 6 Back     alignment and domain information
>cd05615 STKc_cPKC_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Classical Protein Kinase C alpha Back     alignment and domain information
>KOG0593|consensus Back     alignment and domain information
>PHA03390 pk1 serine/threonine-protein kinase 1; Provisional Back     alignment and domain information
>KOG0614|consensus Back     alignment and domain information
>cd07857 STKc_MPK1 Catalytic domain of the Serine/Threonine Kinase, Fungal Mitogen-Activated Protein Kinase MPK1 Back     alignment and domain information
>PHA03207 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 Back     alignment and domain information
>PHA03212 serine/threonine kinase US3; Provisional Back     alignment and domain information
>cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 Back     alignment and domain information
>cd06622 PKc_MAPKK_PBS2_like Catalytic domain of fungal PBS2-like dual-specificity MAP kinase kinases Back     alignment and domain information
>cd05588 STKc_aPKC Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C Back     alignment and domain information
>cd05630 STKc_GRK6 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 6 Back     alignment and domain information
>cd05618 STKc_aPKC_iota Catalytic domain of the Protein Serine/Threonine Kinase, Atypical Protein Kinase C iota Back     alignment and domain information
>cd07868 STKc_CDK8 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 8 Back     alignment and domain information
>cd05607 STKc_GRK7 Catalytic domain of the Protein Serine/Threonine Kinase, G protein-coupled Receptor Kinase 7 Back     alignment and domain information
>cd06616 PKc_MKK4 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 4 Back     alignment and domain information
>cd05600 STKc_Sid2p_Dbf2p Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd07849 STKc_ERK1_2_like Catalytic domain of Extracellular signal-Regulated Kinase 1 and 2-like Serine/Threonine Kinases Back     alignment and domain information
>cd07830 STKc_MAK_like Catalytic domain of Male germ cell-Associated Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd07829 STKc_CDK_like Catalytic domain of Cyclin-Dependent protein Kinase-like Serine/Threonine Kinases Back     alignment and domain information
>cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin Back     alignment and domain information
>cd05594 STKc_PKB_alpha Catalytic domain of the Protein Serine/Threonine Kinase, Protein Kinase B alpha Back     alignment and domain information
>KOG0671|consensus Back     alignment and domain information
>cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 Back     alignment and domain information
>cd05572 STKc_cGK_PKG Catalytic domain of the Protein Serine/Threonine Kinase, cGMP-dependent protein kinase Back     alignment and domain information
>KOG0193|consensus Back     alignment and domain information
>KOG1095|consensus Back     alignment and domain information
>cd05599 STKc_NDR_like Catalytic domain of Nuclear Dbf2-Related kinase-like Protein Serine/Threonine Kinases Back     alignment and domain information
>cd05601 STKc_CRIK Catalytic domain of the Protein Serine/Threonine Kinase, Citron Rho-interacting kinase Back     alignment and domain information
>cd05628 STKc_NDR1 Catalytic domain of the Protein Serine/Threonine Kinase, Nuclear Dbf2-Related kinase 1 Back     alignment and domain information
>cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase Back     alignment and domain information
>cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 Back     alignment and domain information
>cd06651 STKc_MEKK3 Catalytic domain of the Protein Serine/Threonine Kinase, MAP/ERK kinase kinase 3 Back     alignment and domain information
>cd08218 STKc_Nek1 Catalytic domain of the Protein Serine/Threonine Kinase, Never In Mitosis gene A-related kinase 1 Back     alignment and domain information
>cd07860 STKc_CDK2_3 Catalytic domain of the Serine/Threonine Kinases, Cyclin-Dependent protein Kinase 2 and 3 Back     alignment and domain information
>KOG3653|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
2qnj_A 328 Kinase And Ubiquitin-Associated Domains Of Mark3PAR 5e-08
3fe3_A 328 Crystal Structure Of The Kinase Mark3PAR-1: T211a-S 5e-08
1zmw_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-08
2r0i_A 327 Crystal Structure Of A Kinase Mark2PAR-1 Mutant Len 5e-08
2hak_A 328 Catalytic And Ubiqutin-Associated Domains Of Mark1P 5e-08
1zmu_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 5e-08
3iec_A 319 Helicobacter Pylori Caga Inhibits Par1MARK FAMILY K 6e-08
1a06_A 332 Calmodulin-Dependent Protein Kinase From Rat Length 6e-08
1zmv_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 9e-08
2wzj_A 327 Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82 9e-08
4fg7_A 293 Crystal Structure Of Human Calcium/calmodulin-depen 2e-07
4fg8_A 315 Crystal Structure Of Human Calcium/calmodulin-depen 2e-07
4fg9_A 320 Crystal Structure Of Human Calcium/calmodulin-depen 2e-07
3zgw_A 347 Crystal Structure Of Maternal Embryonic Leucine Zip 3e-07
2jc6_A 334 Crystal Structure Of Human Calmodulin-Dependent Pro 2e-06
3f3z_A 277 Crystal Structure Of Cryptosporidium Parvum Calcium 2e-06
2qg5_A 294 Cryptosporidium Parvum Calcium Dependent Protein Ki 2e-06
1y8g_A 327 Catalytic And Ubiqutin-Associated Domains Of Mark2P 2e-06
1yrp_A 278 Catalytic Domain Of Human Zip Kinase Phosphorylated 6e-06
3bhy_A 283 Crystal Structure Of Human Death Associated Protein 7e-06
2xuu_A 334 Crystal Structure Of A Dap-Kinase 1 Mutant Length = 7e-06
2w4k_A 302 X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 7e-06
2x0g_A 334 X-ray Structure Of A Dap-kinase Calmodulin Complex 7e-06
2yak_A 285 Structure Of Death-Associated Protein Kinase 1 (Dap 7e-06
3gu4_A 295 Crystal Structure Of Dapkq23v-Amppnp Length = 295 8e-06
1p4f_A 293 Death Associated Protein Kinase Catalytic Domain Wi 8e-06
2xzs_A 312 Death Associated Protein Kinase 1 Residues 1-312 Le 8e-06
1ig1_A 294 1.8a X-Ray Structure Of Ternary Complex Of A Cataly 8e-06
2w4j_A 277 X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 8e-06
3f5u_A 295 Crystal Structure Of The Death Associated Protein K 8e-06
3dfc_B 295 Crystal Structure Of A Glycine-Rich Loop Mutant Of 8e-06
1wvw_A 278 Crystal Structures Of Kinase Domain Of Dap Kinase I 9e-06
3cok_A 278 Crystal Structure Of Plk4 Kinase Length = 278 9e-06
2y0a_A 326 Structure Of Dapk1 Construct Residues 1-304 Length 1e-05
2j90_A 304 Crystal Structure Of Human Zip Kinase In Complex Wi 1e-05
2jam_A 304 Crystal Structure Of Human Calmodulin-Dependent Pro 1e-05
3gu8_A 295 Crystal Structure Of Dapkl93g With N6-Cyclopentylad 2e-05
1zws_A 288 Crystal Structure Of The Catalytic Domain Of Human 3e-05
1wmk_A 321 Human Death-Associated Kinase Drp-1, Mutant S308d D 4e-05
2a2a_A 321 High-resolution Crystallographic Analysis Of The Au 4e-05
2a27_A 321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 4e-05
1z9x_A 321 Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal 4e-05
3mn3_A 271 An Inhibited Conformation For The Protein Kinase Do 6e-05
2fh9_A 274 Structure And Dimerization Of The Kinase Domain Fro 6e-05
3dxn_A 287 Crystal Structure Of The Calcium-dependent Kinase F 6e-05
3hyh_A 275 Crystal Structure Of The Protein Kinase Domain Of Y 6e-05
3dae_A 283 Crystal Structure Of Phosphorylated Snf1 Kinase Dom 7e-05
4eqm_A 294 Structural Analysis Of Staphylococcus Aureus Serine 1e-04
3hzt_A 467 Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme4 2e-04
2y94_A 476 Structure Of An Active Form Of Mammalian Ampk Lengt 2e-04
2x4f_A 373 The Crystal Structure Of The Human Myosin Light Cha 3e-04
2ya9_A 361 Crystal Structure Of The Autoinhibited Form Of Mous 4e-04
1rjb_A 344 Crystal Structure Of Flt3 Length = 344 5e-04
3hko_A 345 Crystal Structure Of A Cdpk Kinase Domain From Cryp 5e-04
3ma6_A 298 Crystal Structure Of Kinase Domain Of Tgcdpk1 In Pr 6e-04
3uc3_A 361 The Crystal Structure Of Snf1-Related Kinase 2.3 Le 6e-04
2w5a_A 279 Human Nek2 Kinase Adp-Bound Length = 279 6e-04
2jav_A 279 Human Kinase With Pyrrole-Indolinone Ligand Length 6e-04
3d7t_A 269 Structural Basis For The Recognition Of C-Src By It 7e-04
3i79_A 484 Calcium-Dependent Protein Kinase 1 From Toxoplasma 7e-04
2phk_A 277 The Crystal Structure Of A Phosphorylase Kinase Pep 8e-04
1ql6_A 298 The Catalytic Mechanism Of Phosphorylase Kinase Pro 8e-04
4a4x_A 279 Nek2-Ede Bound To Cct248662 Length = 279 8e-04
3d7u_A 263 Structural Basis For The Recognition Of C-Src By It 8e-04
1phk_A 298 Two Structures Of The Catalytic Domain Of Phosphory 8e-04
3is5_A 285 Crystal Structure Of Cdpk Kinase Domain From Toxopl 8e-04
1byg_A 278 Kinase Domain Of Human C-Terminal Src Kinase (Csk) 8e-04
3ku2_A 507 Crystal Structure Of Inactivated Form Of Cdpk1 From 8e-04
1k9a_A 450 Crystal Structure Analysis Of Full-Length Carboxyl- 8e-04
3hx4_A 508 Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tg 8e-04
>pdb|2QNJ|A Chain A, Kinase And Ubiquitin-Associated Domains Of Mark3PAR-1 Length = 328 Back     alignment and structure

Iteration: 1

Score = 54.7 bits (130), Expect = 5e-08, Method: Compositional matrix adjust. Identities = 31/80 (38%), Positives = 49/80 (61%), Gaps = 5/80 (6%) Query: 142 QHVAIKRITKKNLAKT--QNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCN 199 + VAIK I K L T Q +E+ I+K L +H N+V+L E+++ +YL+ME+ + Sbjct: 38 REVAIKIIDKTQLNPTSLQKLFREVRIMKIL---NHPNIVKLFEVIETEKTLYLIMEYAS 94 Query: 200 GGDLADYLVSKGTLSEDTIR 219 GG++ DYLV+ G + E R Sbjct: 95 GGEVFDYLVAHGRMKEKEAR 114
>pdb|3FE3|A Chain A, Crystal Structure Of The Kinase Mark3PAR-1: T211a-S215a Double Mutant Length = 328 Back     alignment and structure
>pdb|1ZMW|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: T208aS212A INACTIVE DOUBLE MUTANT Length = 327 Back     alignment and structure
>pdb|2R0I|A Chain A, Crystal Structure Of A Kinase Mark2PAR-1 Mutant Length = 327 Back     alignment and structure
>pdb|2HAK|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark1PAR-1 Length = 328 Back     alignment and structure
>pdb|1ZMU|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Wild Type Length = 327 Back     alignment and structure
>pdb|3IEC|A Chain A, Helicobacter Pylori Caga Inhibits Par1MARK FAMILY KINASES BY Mimicking Host Substrates Length = 319 Back     alignment and structure
>pdb|1A06|A Chain A, Calmodulin-Dependent Protein Kinase From Rat Length = 332 Back     alignment and structure
>pdb|1ZMV|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: K82r Mutant Length = 327 Back     alignment and structure
>pdb|2WZJ|A Chain A, Catalytic And Uba Domain Of Kinase Mark2(PAR-1) K82r, T208e Double Mutant Length = 327 Back     alignment and structure
>pdb|4FG7|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-293 In Complex With Atp Length = 293 Back     alignment and structure
>pdb|4FG8|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-315 In Complex With Atp Length = 315 Back     alignment and structure
>pdb|4FG9|A Chain A, Crystal Structure Of Human Calcium/calmodulin-dependent Protein Kinase I 1-320 In Complex With Atp Length = 320 Back     alignment and structure
>pdb|2JC6|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase 1d Length = 334 Back     alignment and structure
>pdb|3F3Z|A Chain A, Crystal Structure Of Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 In Presence Of Indirubin E804 Length = 277 Back     alignment and structure
>pdb|2QG5|A Chain A, Cryptosporidium Parvum Calcium Dependent Protein Kinase Cgd7_1840 Length = 294 Back     alignment and structure
>pdb|1Y8G|A Chain A, Catalytic And Ubiqutin-Associated Domains Of Mark2PAR-1: Inactive Double Mutant With Selenomethionine Length = 327 Back     alignment and structure
>pdb|1YRP|A Chain A, Catalytic Domain Of Human Zip Kinase Phosphorylated At Thr265 Length = 278 Back     alignment and structure
>pdb|3BHY|A Chain A, Crystal Structure Of Human Death Associated Protein Kinase 3 (Dapk3) In Complex With A Beta-Carboline Ligand Length = 283 Back     alignment and structure
>pdb|2XUU|A Chain A, Crystal Structure Of A Dap-Kinase 1 Mutant Length = 334 Back     alignment and structure
>pdb|2W4K|A Chain A, X-Ray Structure Of A Dap-Kinase 2-302 Length = 302 Back     alignment and structure
>pdb|2X0G|A Chain A, X-ray Structure Of A Dap-kinase Calmodulin Complex Length = 334 Back     alignment and structure
>pdb|2YAK|A Chain A, Structure Of Death-Associated Protein Kinase 1 (Dapk1) In Complex With A Ruthenium Octasporine Ligand (Osv) Length = 285 Back     alignment and structure
>pdb|3GU4|A Chain A, Crystal Structure Of Dapkq23v-Amppnp Length = 295 Back     alignment and structure
>pdb|1P4F|A Chain A, Death Associated Protein Kinase Catalytic Domain With Bound Inhibitor Fragment Length = 293 Back     alignment and structure
>pdb|2XZS|A Chain A, Death Associated Protein Kinase 1 Residues 1-312 Length = 312 Back     alignment and structure
>pdb|1IG1|A Chain A, 1.8a X-Ray Structure Of Ternary Complex Of A Catalytic Domain Of Death-Associated Protein Kinase With Atp Analogue And Mn. Length = 294 Back     alignment and structure
>pdb|2W4J|A Chain A, X-Ray Structure Of A Dap-Kinase 2-277 Length = 277 Back     alignment and structure
>pdb|3F5U|A Chain A, Crystal Structure Of The Death Associated Protein Kinase In Complex With Amppnp And Mg2+ Length = 295 Back     alignment and structure
>pdb|3DFC|B Chain B, Crystal Structure Of A Glycine-Rich Loop Mutant Of The Death Associated Protein Kinase Catalytic Domain With Amppnp Length = 295 Back     alignment and structure
>pdb|1WVW|A Chain A, Crystal Structures Of Kinase Domain Of Dap Kinase In Complex With Small Molecular Inhibitors Length = 278 Back     alignment and structure
>pdb|3COK|A Chain A, Crystal Structure Of Plk4 Kinase Length = 278 Back     alignment and structure
>pdb|2Y0A|A Chain A, Structure Of Dapk1 Construct Residues 1-304 Length = 326 Back     alignment and structure
>pdb|2J90|A Chain A, Crystal Structure Of Human Zip Kinase In Complex With A Tetracyclic Pyridone Inhibitor (pyridone 6) Length = 304 Back     alignment and structure
>pdb|2JAM|A Chain A, Crystal Structure Of Human Calmodulin-Dependent Protein Kinase I G Length = 304 Back     alignment and structure
>pdb|3GU8|A Chain A, Crystal Structure Of Dapkl93g With N6-Cyclopentyladenosine Length = 295 Back     alignment and structure
>pdb|1ZWS|A Chain A, Crystal Structure Of The Catalytic Domain Of Human Drp-1 Kinase Length = 288 Back     alignment and structure
>pdb|1WMK|A Chain A, Human Death-Associated Kinase Drp-1, Mutant S308d D40 Length = 321 Back     alignment and structure
>pdb|2A2A|A Chain A, High-resolution Crystallographic Analysis Of The Autoinhibited Conformation Of A Human Death-associated Protein Kinase Length = 321 Back     alignment and structure
>pdb|2A27|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 8 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|1Z9X|A Chain A, Human Drp-1 Kinase, W305s S308a D40 Mutant, Crystal Form With 3 Monomers In The Asymmetric Unit Length = 321 Back     alignment and structure
>pdb|3MN3|A Chain A, An Inhibited Conformation For The Protein Kinase Domain Of The Saccharomyces Cerevisiae Ampk Homolog Snf1 Length = 271 Back     alignment and structure
>pdb|2FH9|A Chain A, Structure And Dimerization Of The Kinase Domain From Yeast Snf1 Length = 274 Back     alignment and structure
>pdb|3DXN|A Chain A, Crystal Structure Of The Calcium-dependent Kinase From Toxoplasma Gondii, 541.m00134, Kinase Domain Length = 287 Back     alignment and structure
>pdb|3HYH|A Chain A, Crystal Structure Of The Protein Kinase Domain Of Yeast Amp-Activated Protein Kinase Snf1 Length = 275 Back     alignment and structure
>pdb|3DAE|A Chain A, Crystal Structure Of Phosphorylated Snf1 Kinase Domain Length = 283 Back     alignment and structure
>pdb|4EQM|A Chain A, Structural Analysis Of Staphylococcus Aureus SerineTHREONINE KINASE Pknb Length = 294 Back     alignment and structure
>pdb|3HZT|A Chain A, Crystal Structure Of Toxoplasma Gondii Cdpk3, Tgme49_105860 Length = 467 Back     alignment and structure
>pdb|2Y94|A Chain A, Structure Of An Active Form Of Mammalian Ampk Length = 476 Back     alignment and structure
>pdb|2X4F|A Chain A, The Crystal Structure Of The Human Myosin Light Chain Kinase Loc340156. Length = 373 Back     alignment and structure
>pdb|2YA9|A Chain A, Crystal Structure Of The Autoinhibited Form Of Mouse Dapk2 Length = 361 Back     alignment and structure
>pdb|1RJB|A Chain A, Crystal Structure Of Flt3 Length = 344 Back     alignment and structure
>pdb|3HKO|A Chain A, Crystal Structure Of A Cdpk Kinase Domain From Cryptosporidium Parvum, Cgd7_40 Length = 345 Back     alignment and structure
>pdb|3MA6|A Chain A, Crystal Structure Of Kinase Domain Of Tgcdpk1 In Presence Of 3brb-Pp1 Length = 298 Back     alignment and structure
>pdb|3UC3|A Chain A, The Crystal Structure Of Snf1-Related Kinase 2.3 Length = 361 Back     alignment and structure
>pdb|2W5A|A Chain A, Human Nek2 Kinase Adp-Bound Length = 279 Back     alignment and structure
>pdb|2JAV|A Chain A, Human Kinase With Pyrrole-Indolinone Ligand Length = 279 Back     alignment and structure
>pdb|3D7T|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 269 Back     alignment and structure
>pdb|3I79|A Chain A, Calcium-Dependent Protein Kinase 1 From Toxoplasma Gondii (Tgcdpk1) Length = 484 Back     alignment and structure
>pdb|2PHK|A Chain A, The Crystal Structure Of A Phosphorylase Kinase Peptide Substrate Complex: Kinase Substrate Recognition Length = 277 Back     alignment and structure
>pdb|1QL6|A Chain A, The Catalytic Mechanism Of Phosphorylase Kinase Probed By Mutational Studies Length = 298 Back     alignment and structure
>pdb|4A4X|A Chain A, Nek2-Ede Bound To Cct248662 Length = 279 Back     alignment and structure
>pdb|3D7U|A Chain A, Structural Basis For The Recognition Of C-Src By Its Inactivator Csk Length = 263 Back     alignment and structure
>pdb|1PHK|A Chain A, Two Structures Of The Catalytic Domain Of Phosphorylase, Kinase: An Active Protein Kinase Complexed With Nucleotide, Substrate-Analogue And Product Length = 298 Back     alignment and structure
>pdb|3IS5|A Chain A, Crystal Structure Of Cdpk Kinase Domain From Toxoplasma Gondii, Tgme49_018720 Length = 285 Back     alignment and structure
>pdb|1BYG|A Chain A, Kinase Domain Of Human C-Terminal Src Kinase (Csk) In Complex With Inhibitor Staurosporine Length = 278 Back     alignment and structure
>pdb|3KU2|A Chain A, Crystal Structure Of Inactivated Form Of Cdpk1 From Toxoplasma Gondii, Tgme49.101440 Length = 507 Back     alignment and structure
>pdb|1K9A|A Chain A, Crystal Structure Analysis Of Full-Length Carboxyl-Terminal Src Kinase At 2.5 A Resolution Length = 450 Back     alignment and structure
>pdb|3HX4|A Chain A, Crystal Structure Of Cdpk1 Of Toxoplasma Gondii, Tgme49_101440, In Presence Of Calcium Length = 508 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query249
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 9e-24
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 4e-19
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 2e-23
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 8e-18
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 2e-22
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 1e-17
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 3e-22
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 2e-14
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 5e-21
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 2e-11
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 7e-20
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 1e-10
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 2e-19
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 6e-07
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 2e-19
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 3e-10
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 2e-19
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 2e-10
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 2e-19
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 3e-04
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 4e-19
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 6e-05
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 8e-19
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 2e-04
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 4e-18
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 2e-04
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 4e-18
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 3e-06
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 5e-18
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 2e-08
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 6e-18
3lij_A494 Calcium/calmodulin dependent protein kinase with A 2e-08
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 7e-18
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 1e-04
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 9e-18
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 1e-05
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 9e-18
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 8e-09
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 1e-17
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 7e-07
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 2e-17
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 4e-10
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 3e-17
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 4e-09
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 3e-17
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 6e-06
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 4e-17
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 3e-07
3bhy_A 283 Death-associated protein kinase 3; death associate 4e-17
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 4e-17
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 3e-10
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 4e-17
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 8e-11
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 4e-17
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 3e-06
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 5e-17
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 2e-05
4apc_A350 Serine/threonine-protein kinase NEK1; transferase; 7e-17
4apc_A 350 Serine/threonine-protein kinase NEK1; transferase; 5e-15
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 7e-17
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 9e-04
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 7e-17
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 4e-07
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 8e-17
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 1e-16
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 4e-09
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 1e-16
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 7e-09
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 1e-16
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 7e-04
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 1e-16
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 5e-05
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-16
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 1e-08
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 1e-16
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 6e-04
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 2e-16
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 2e-16
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 4e-06
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 2e-16
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 2e-16
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 4e-16
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 2e-08
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 4e-16
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 2e-08
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 4e-16
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 6e-08
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 1e-15
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 1e-15
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 1e-15
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 1e-10
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 1e-15
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 1e-07
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-15
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 2e-08
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 2e-15
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 8e-06
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 3e-15
2eue_A275 Carbon catabolite derepressing protein kinase; kin 3e-08
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 4e-15
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 1e-13
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 5e-15
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 1e-13
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 5e-15
3dls_A335 PAS domain-containing serine/threonine-protein KI; 2e-07
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 5e-15
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 4e-09
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 1e-14
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 2e-14
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 2e-07
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 5e-14
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 1e-08
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 5e-14
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 1e-10
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 6e-14
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 2e-13
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 6e-14
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 2e-12
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 7e-14
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 4e-09
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 7e-14
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 1e-13
2a19_B 284 Interferon-induced, double-stranded RNA-activated 1e-13
2a19_B284 Interferon-induced, double-stranded RNA-activated 2e-09
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 2e-13
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 9e-06
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 4e-13
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 3e-08
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 5e-13
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 4e-09
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 5e-13
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 1e-09
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 9e-13
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 1e-12
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 2e-08
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 3e-12
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 4e-06
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 6e-12
3e7e_A365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 4e-04
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 7e-12
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 5e-04
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 9e-12
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 4e-04
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 1e-11
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 5e-05
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 2e-11
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-11
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 2e-06
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 3e-11
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 8e-06
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 4e-11
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 2e-04
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 5e-11
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 6e-11
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 6e-11
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 8e-08
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 6e-11
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 6e-11
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 9e-11
3o0g_A 292 Cell division protein kinase 5; kinase activator c 1e-10
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 1e-10
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 1e-10
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 1e-10
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 1e-10
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 3e-04
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 1e-10
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 1e-10
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 2e-05
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 1e-10
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 1e-10
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 2e-10
3niz_A 311 Rhodanese family protein; structural genomics, str 2e-10
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 3e-10
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 3e-10
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 9e-04
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 3e-10
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 4e-10
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 4e-10
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 4e-10
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 4e-10
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 5e-10
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 5e-10
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 5e-10
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 6e-10
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 6e-10
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 6e-10
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 7e-10
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 4e-04
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 7e-10
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 8e-10
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 8e-10
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 1e-09
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 1e-09
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 1e-09
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 1e-09
4aoj_A 329 High affinity nerve growth factor receptor; transf 1e-09
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 1e-09
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 1e-09
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 1e-09
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 2e-05
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 1e-09
3rp9_A 458 Mitogen-activated protein kinase; structural genom 1e-09
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 1e-09
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 2e-09
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 4e-04
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 2e-09
3v5q_A 297 NT-3 growth factor receptor; kinase domain, kinase 2e-09
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 2e-09
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 2e-09
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 1e-05
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 3e-09
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 3e-09
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 4e-09
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 5e-09
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 5e-09
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 7e-09
1uu3_A310 HPDK1, 3-phosphoinositide dependent protein kinase 7e-09
1uu3_A 310 HPDK1, 3-phosphoinositide dependent protein kinase 4e-08
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 8e-09
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 9e-09
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 6e-06
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 9e-09
3pls_A 298 Macrophage-stimulating protein receptor; protein k 9e-09
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-08
3zzw_A 289 Tyrosine-protein kinase transmembrane receptor RO; 1e-08
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 1e-08
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 1e-08
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 1e-08
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 1e-08
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 2e-08
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 2e-08
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 2e-08
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 2e-08
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 2e-08
3uqc_A286 Probable conserved transmembrane protein; structur 3e-08
3uqc_A 286 Probable conserved transmembrane protein; structur 2e-04
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 3e-08
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 4e-08
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 5e-08
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 5e-08
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 1e-04
3q4u_A 301 Activin receptor type-1; structural genomics conso 5e-08
3pvu_A695 Beta-adrenergic receptor kinase 1; transferase, se 6e-08
3pvu_A 695 Beta-adrenergic receptor kinase 1; transferase, se 7e-08
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 6e-08
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 7e-08
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 5e-04
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 9e-08
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 9e-08
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 1e-07
3ork_A311 Serine/threonine protein kinase; structural genomi 1e-07
3ork_A 311 Serine/threonine protein kinase; structural genomi 7e-05
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 2e-07
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 2e-07
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 2e-07
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 2e-05
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 2e-07
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 2e-07
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 3e-06
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 2e-07
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 2e-07
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 2e-07
2dyl_A 318 Dual specificity mitogen-activated protein kinase 2e-07
2dyl_A318 Dual specificity mitogen-activated protein kinase 2e-05
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 4e-07
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 4e-07
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 4e-07
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 7e-07
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 4e-07
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 8e-06
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 5e-07
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 1e-05
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 5e-07
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 4e-05
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 5e-07
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 6e-07
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 2e-05
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 6e-07
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 7e-07
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 1e-04
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 7e-07
3soc_A 322 Activin receptor type-2A; structural genomics cons 9e-07
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 1e-06
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 1e-06
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 2e-05
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 1e-06
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 1e-04
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 2e-06
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 4e-06
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 2e-06
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 9e-04
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 2e-06
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 2e-06
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 1e-05
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 2e-06
3g51_A325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 2e-06
3g51_A 325 Ribosomal protein S6 kinase alpha-3; N-terminal ki 4e-06
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 2e-06
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 4e-06
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 2e-06
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 2e-06
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 2e-06
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 2e-06
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 1e-05
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 3e-06
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 3e-06
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 1e-04
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 4e-06
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 5e-06
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 1e-05
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 1e-05
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 1e-05
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 1e-05
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 4e-05
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 1e-05
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 6e-05
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 2e-05
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 3e-05
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 2e-05
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 1e-04
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 2e-05
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 4e-05
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 2e-05
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 6e-05
3aln_A 327 Dual specificity mitogen-activated protein kinase; 3e-05
3aln_A327 Dual specificity mitogen-activated protein kinase; 6e-05
3fme_A 290 Dual specificity mitogen-activated protein kinase; 3e-05
3fme_A290 Dual specificity mitogen-activated protein kinase; 7e-05
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 3e-05
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 4e-05
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 7e-05
3an0_A 340 Dual specificity mitogen-activated protein kinase; 5e-05
3an0_A340 Dual specificity mitogen-activated protein kinase; 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-04
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 8e-04
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
 Score = 96.7 bits (241), Expect = 9e-24
 Identities = 25/97 (25%), Positives = 45/97 (46%), Gaps = 8/97 (8%)

Query: 142 QHVAIKRITKKNLAK--TQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCN 199
           Q  AIK +  +        ++  EI  L +L + H + ++ L   + +DQ++Y+VME C 
Sbjct: 34  QIYAIKYVNLEEADNQTLDSYRNEIAYLNKL-QQHSDKIIRLYDYEITDQYIYMVME-CG 91

Query: 200 GGDLADYLVSKGTLSEDTIRIFLKLHQMLQ--LYFHD 234
             DL  +L  K ++     + + K   ML+     H 
Sbjct: 92  NIDLNSWLKKKKSIDPWERKSYWK--NMLEAVHTIHQ 126


>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Length = 343 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Length = 313 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Length = 390 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Length = 319 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Length = 396 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Length = 294 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Length = 277 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Length = 676 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Length = 335 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Length = 304 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Length = 284 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Length = 362 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Length = 444 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Length = 287 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Length = 486 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Length = 494 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Length = 365 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Length = 298 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Length = 484 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Length = 419 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Length = 276 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Length = 328 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Length = 325 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Length = 316 Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Length = 283 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Length = 278 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Length = 432 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Length = 276 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Length = 322 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>4apc_A Serine/threonine-protein kinase NEK1; transferase; 2.10A {Homo sapiens} Length = 350 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Length = 321 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Length = 434 Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Length = 573 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Length = 323 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Length = 476 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Length = 373 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Length = 351 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Length = 504 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Length = 387 Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Length = 327 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Length = 317 Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Length = 361 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Length = 312 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Length = 289 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Length = 285 Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Length = 349 Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Length = 321 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Length = 303 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Length = 361 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Length = 336 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Length = 342 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 3lau_A* 2wtv_A* ... Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Length = 279 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Length = 335 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Length = 336 Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Length = 413 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Length = 320 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Length = 295 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Length = 345 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Length = 284 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Length = 311 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Length = 310 Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Length = 377 Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Length = 371 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Length = 284 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Length = 337 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Length = 348 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 3fpq_A Length = 290 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Length = 305 Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Length = 302 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Length = 299 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Length = 365 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Length = 321 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Length = 297 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Length = 307 Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Length = 329 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Length = 336 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Length = 400 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Length = 303 Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Length = 311 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Length = 316 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Length = 298 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Length = 327 Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Length = 308 Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Length = 292 Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Length = 299 Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Length = 326 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} Length = 271 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Length = 309 Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Length = 288 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Length = 384 Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Length = 346 Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} Length = 331 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} PDB: 2qkr_A* Length = 311 Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Length = 278 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Length = 389 Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} PDB: 3kmw_A* 3rep_A* Length = 271 Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Length = 310 Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Length = 288 Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Length = 394 Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Length = 314 Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Length = 334 Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Length = 348 Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Length = 324 Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Length = 370 Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Length = 322 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} PDB: 3sxr_A* Length = 268 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Length = 287 Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 3q32_A* 3rvg_A* 3tjc_A* 3tjd_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* 3io7_A* 3kck_A* 3jy9_A* Length = 295 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Length = 333 Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Length = 313 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Length = 326 Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Length = 377 Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Length = 344 Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Length = 420 Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Length = 329 Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Length = 382 Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Length = 317 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Length = 319 Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Length = 267 Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Length = 458 Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Length = 314 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Length = 303 Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 3eyg_A* 3eyh_A* Length = 302 Back     alignment and structure
>3v5q_A NT-3 growth factor receptor; kinase domain, kinase, phosphorylation, transferase-transfer inhibitor complex; HET: 0F4; 2.20A {Homo sapiens} Length = 297 Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Length = 279 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} PDB: 3c4c_A* 3c4d_A* 3idp_A* 3ii5_A* 3d4q_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 2fb8_A* 4dbn_A* 1uwj_A* 1uwh_A* 3q96_A* Length = 289 Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Length = 283 Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Length = 343 Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 3pjc_A* 1yvj_A* Length = 327 Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Length = 405 Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Length = 327 Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 3q6w_A* 3r7o_A* 3q6u_A* 3cth_A* 3ce3_A* 3ctj_A* ... Length = 298 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>1uu3_A HPDK1, 3-phosphoinositide dependent protein kinase-1; PKB, inhibitor, LY333531, diabetes, cancer, transferase, serine/threonine-protein kinase; HET: SEP LY4; 1.7A {Homo sapiens} SCOP: d.144.1.7 PDB: 1okz_A* 1oky_A* 1uu7_A* 1uu8_A* 2biy_A* 3rwp_A* 2xch_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* ... Length = 310 Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Length = 323 Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Length = 326 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} Length = 298 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>3zzw_A Tyrosine-protein kinase transmembrane receptor RO; transferase, neurotrophic tyrosine kinase, receptor-related NTRKR2; 2.90A {Homo sapiens} Length = 289 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Length = 336 Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Length = 367 Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Length = 373 Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vid_A* 3hng_A* Length = 359 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Length = 360 Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* Length = 318 Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Length = 313 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Length = 286 Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Length = 432 Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Length = 289 Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3mb7_A* 3mb6_A* 3owj_A* 3owk_A* ... Length = 330 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Length = 410 Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Length = 301 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3pvu_A Beta-adrenergic receptor kinase 1; transferase, serine/threonine-protein kinase, ATP-binding, I membrane; HET: QRW; 2.48A {Bos taurus} PDB: 3psc_A* 3pvw_A* 1omw_A 1ym7_A 2bcj_A* 3cik_A 3krw_A* 3krx_A* 1bak_A Length = 695 Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Length = 325 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} Length = 362 Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Length = 342 Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Length = 291 Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Length = 281 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Length = 311 Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* Length = 351 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Length = 576 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Length = 681 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Length = 350 Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* Length = 360 Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Length = 281 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Length = 373 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Length = 318 Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 333 Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} Length = 337 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Length = 294 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Length = 412 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Length = 309 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Length = 332 Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Length = 388 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Length = 353 Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Length = 291 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3o71_A 3r63_A 3c9w_A* 2y9q_A* 3sa0_A* 1wzy_A* 2e14_A* 1tvo_A* 2ojg_A* 2oji_A* ... Length = 364 Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Length = 287 Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 2qlu_A* Length = 322 Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Length = 656 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Length = 543 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Length = 373 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Length = 318 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Length = 353 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Length = 367 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Length = 327 Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Length = 327 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>3g51_A Ribosomal protein S6 kinase alpha-3; N-terminal kinase domain of P90 ribosomal S6 kinase 2, ATP- binding, nucleotide-binding, phosphoprotein; HET: ANP; 1.80A {Mus musculus} PDB: 2z7q_A* 2z7r_A* 2z7s_A* Length = 325 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Length = 437 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Length = 613 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Length = 371 Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Length = 325 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Length = 355 Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Length = 464 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Length = 320 Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Length = 367 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Length = 446 Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* 2jiu_A* ... Length = 327 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Length = 674 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Length = 353 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Length = 337 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Length = 353 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Length = 345 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Length = 327 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Length = 290 Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Length = 383 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Length = 396 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
4aw0_A 311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.95
4fih_A 346 Serine/threonine-protein kinase PAK 4; kinase doma 99.95
4fie_A 423 Serine/threonine-protein kinase PAK 4; kinase doma 99.95
4b9d_A 350 Serine/threonine-protein kinase NEK1; transferase, 99.95
4g3f_A 336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.94
3hyh_A 275 Carbon catabolite-derepressing protein kinase; kin 99.94
3fpq_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.94
3ubd_A 304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.93
4asz_A 299 BDNF/NT-3 growth factors receptor; transferase, TR 99.93
3v5w_A 689 G-protein coupled receptor kinase 2; inhibitor com 99.92
4aoj_A 329 High affinity nerve growth factor receptor; transf 99.92
4g31_A 299 Eukaryotic translation initiation factor 2-alpha; 99.92
4gt4_A 308 Tyrosine-protein kinase transmembrane receptor RO; 99.91
3uto_A 573 Twitchin; kinase, muscle sarcomere, transferase; H 99.91
4b99_A 398 Mitogen-activated protein kinase 7; transferase, i 99.91
3omv_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.9
4f9c_A 361 Cell division cycle 7-related protein kinase; Ser/ 99.89
4ase_A 353 Vascular endothelial growth factor receptor 2; tra 99.88
3hmm_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.88
3uc3_A 361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.87
3zgw_A 347 Maternal embryonic leucine zipper kinase; transfer 99.87
3fe3_A 328 MAP/microtubule affinity-regulating kinase 3; seri 99.87
3txo_A 353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.86
1o6l_A 337 RAC-beta serine/threonine protein kinase; protein 99.86
2yab_A 361 Death-associated protein kinase 2; apoptosis, tran 99.86
4dc2_A 396 Protein kinase C IOTA type; kinase, substrate, cel 99.86
3fxz_A 297 Serine/threonine-protein kinase PAK 1; transferase 99.86
4fih_A346 Serine/threonine-protein kinase PAK 4; kinase doma 99.86
2ac3_A 316 MAP kinase-interacting serine/threonine kinase 2; 99.86
1rdq_E 350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.86
3kn6_A 325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.86
1xjd_A 345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.86
4fr4_A 384 YANK1, serine/threonine-protein kinase 32A; struct 99.85
1fot_A 318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.85
4aw0_A311 HPDK1, 3-phosphoinositide-dependent protein kinase 99.85
3a8x_A 345 Protein kinase C IOTA type; transferase; HET: TPO; 99.85
2y0a_A 326 Death-associated protein kinase 1; transferase, ca 99.85
2qr7_A 342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.85
3v8s_A 410 RHO-associated protein kinase 1; dimerization, myo 99.85
4aw2_A 437 Serine/threonine-protein kinase MRCK alpha; transf 99.85
2bdw_A 362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.85
3soa_A 444 Calcium/calmodulin-dependent protein kinase type a 99.85
2r5t_A 373 Serine/threonine-protein kinase SGK1; AGC protein 99.85
2vd5_A 412 DMPK protein; serine/threonine-protein kinase, kin 99.85
3ubd_A304 Ribosomal protein S6 kinase alpha-3; kinase-inhibi 99.84
1tki_A 321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.84
4eqm_A 294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.84
3s95_A 310 LIMK-1, LIM domain kinase 1; structural genomics, 99.84
4fie_A423 Serine/threonine-protein kinase PAK 4; kinase doma 99.84
3c0i_A 351 Peripheral plasma membrane protein CASK; neurexin, 99.84
3gni_B 389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.84
1kob_A 387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.84
2i0e_A 353 Protein kinase C-beta II; serine/threonine protein 99.84
3fpq_A290 Serine/threonine-protein kinase WNK1; protein seri 99.84
2x4f_A 373 Myosin light chain kinase family member 4; LUNG, b 99.84
3tki_A 323 Serine/threonine-protein kinase CHK1; cell checkpo 99.83
3uqc_A 286 Probable conserved transmembrane protein; structur 99.83
3f3z_A 277 Calcium/calmodulin-dependent protein kinase with d 99.83
2y94_A 476 5'-AMP-activated protein kinase catalytic subunit; 99.83
3q5i_A 504 Protein kinase; CDPK, malaria, phosphotransferase, 99.83
3mwu_A 486 Calmodulin-domain protein kinase 1; serine/threoni 99.83
2c30_A 321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.83
3lij_A 494 Calcium/calmodulin dependent protein kinase with A 99.83
2jam_A 304 Calcium/calmodulin-dependent protein kinase type 1 99.83
2w4o_A 349 Calcium/calmodulin-dependent protein kinase type I 99.82
4b9d_A350 Serine/threonine-protein kinase NEK1; transferase, 99.82
4euu_A 319 Serine/threonine-protein kinase TBK1; ATP binding, 99.82
3a62_A 327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.82
3h4j_B 336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.82
2a2a_A 321 Death-associated protein kinase 2; autoinhibition, 99.82
1x8b_A 289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.82
1phk_A 298 Phosphorylase kinase; glycogen metabolism, transfe 99.82
2acx_A 576 G protein-coupled receptor kinase 6; GRK, G transf 99.82
4ejn_A 446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.82
4g3f_A336 NF-kappa-beta-inducing kinase; non-RD kinase, prot 99.82
4fvq_A 289 Tyrosine-protein kinase JAK2; janus protein kinase 99.82
3c4z_A 543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.82
3hyh_A275 Carbon catabolite-derepressing protein kinase; kin 99.82
3nyv_A 484 Calmodulin-domain protein kinase 1; serine/threoni 99.81
3e7e_A 365 HBUB1, BUB1A, mitotic checkpoint serine/threonine- 99.81
3gbz_A 329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.81
3kk8_A 284 Calcium/calmodulin dependent protein kinase II; AT 99.81
3bhy_A 283 Death-associated protein kinase 3; death associate 99.81
3ork_A 311 Serine/threonine protein kinase; structural genomi 99.81
3qd2_B 332 Eukaryotic translation initiation factor 2-alpha; 99.81
3is5_A 285 Calcium-dependent protein kinase; CDPK, structural 99.81
3o0g_A 292 Cell division protein kinase 5; kinase activator c 99.81
1nxk_A 400 MAP kinase-activated protein kinase 2; MK2, phosph 99.81
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.81
2izr_A 330 Casein kinase I isoform gamma-3; serine/threonine- 99.81
3ugc_A 295 Tyrosine-protein kinase JAK2; small molecule inhib 99.81
3rp9_A 458 Mitogen-activated protein kinase; structural genom 99.81
4eut_A 396 Serine/threonine-protein kinase TBK1; ATP binding, 99.81
3l9p_A 367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.81
2eue_A 275 Carbon catabolite derepressing protein kinase; kin 99.8
3i6u_A 419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.8
3dls_A 335 PAS domain-containing serine/threonine-protein KI; 99.8
3kul_A 325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.8
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 99.8
2owb_A 335 Serine/threonine-protein kinase PLK1; catalytic do 99.8
1vzo_A 355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.8
2rku_A 294 Serine/threonine-protein kinase PLK1; structure of 99.8
4agu_A 311 Cyclin-dependent kinase-like 1; transferase, phosp 99.8
3cbl_A 377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.8
2j7t_A 302 Serine/threonine-protein kinase 10; transferase, A 99.8
2psq_A 370 Fibroblast growth factor receptor 2; kinase domain 99.8
2h6d_A 276 5'-AMP-activated protein kinase catalytic subunit 99.8
3fdn_A 279 Serine/threonine-protein kinase 6; aurora kinase i 99.8
2pmi_A 317 Negative RE, cyclin-dependent protein kinase PHO85 99.8
2y7j_A 365 Phosphorylase B kinase gamma catalytic chain, test 99.8
2buj_A 317 Serine/threonine-protein kinase 16; transferase, A 99.8
4aaa_A 331 Cyclin-dependent kinase-like 2; transferase, phosp 99.8
3eqc_A 360 Dual specificity mitogen-activated protein kinase; 99.8
2zv2_A 298 Calcium/calmodulin-dependent protein kinase kinas; 99.8
3g33_A 308 Cell division protein kinase 4; Ser/Thr protein ki 99.8
4hcu_A 269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.8
2qol_A 373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.8
3cok_A 278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.8
4e5w_A 302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.8
3vhe_A 359 Vascular endothelial growth factor receptor 2; kin 99.79
2vgo_A 284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.79
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.79
4b99_A398 Mitogen-activated protein kinase 7; transferase, i 99.79
3gen_A 283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.79
3n9x_A 432 Phosphotransferase; malaria kinase, structural gen 99.79
2ycf_A 322 Serine/threonine-protein kinase CHK2; transferase, 99.79
3m2w_A 299 MAP kinase-activated protein kinase 2; small molec 99.79
2yex_A 276 Serine/threonine-protein kinase CHK1; transferase, 99.79
2h34_A 309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.79
3lxl_A 327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.79
2clq_A 295 Mitogen-activated protein kinase kinase kinase 5; 99.79
3kfa_A 288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.79
3v5w_A689 G-protein coupled receptor kinase 2; inhibitor com 99.79
3lm5_A 327 Serine/threonine-protein kinase 17B; STK17B, serin 99.79
1luf_A 343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.79
2wei_A 287 Calmodulin-domain protein kinase 1, putative; nucl 99.79
1t4h_A 290 Serine/threonine-protein kinase WNK1; protein seri 99.79
3sxs_A 268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.78
3tt0_A 382 Basic fibroblast growth factor receptor 1; kinase 99.78
4fl3_A 635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.78
2a19_B 284 Interferon-induced, double-stranded RNA-activated 99.78
3hko_A 345 Calcium/calmodulin-dependent protein kinase with d 99.78
3p86_A 309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.78
3com_A 314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.78
2wqm_A 310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.78
3byv_A 377 Rhoptry kinase; malaria, transferase, structural g 99.78
3llt_A 360 Serine/threonine kinase-1, pflammer; lammer kinase 99.78
3p1a_A 311 MYT1 kinase, membrane-associated tyrosine- and thr 99.78
2vuw_A 336 Serine/threonine-protein kinase haspin; cell cycle 99.78
3a7i_A 303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.78
4f9c_A361 Cell division cycle 7-related protein kinase; Ser/ 99.78
2ivs_A 314 Proto-oncogene tyrosine-protein kinase receptor RE 99.78
1t46_A 313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.78
2qkw_B 321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.78
3uto_A573 Twitchin; kinase, muscle sarcomere, transferase; H 99.78
1rjb_A 344 FL cytokine receptor; kinase, structure, autoinhib 99.78
2w1i_A 326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.78
2iwi_A 312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.78
1xbb_A 291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.77
3dbq_A 343 Dual specificity protein kinase TTK; MPS1 structur 99.77
2zmd_A 390 Dual specificity protein kinase TTK; MPS1, T686A, 99.77
3lxp_A 318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.77
1ob3_A 288 PFPK5, cell division control protein 2 homolog; tr 99.77
2yfx_A 327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.77
2pvf_A 334 Fibroblast growth factor receptor 2; kinase domain 99.77
3niz_A 311 Rhodanese family protein; structural genomics, str 99.77
1csn_A 298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.77
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.77
3oz6_A 388 Mitogen-activated protein kinase 1, serine/threon 99.77
2vwi_A 303 Serine/threonine-protein kinase OSR1; STE kinase, 99.77
1fvr_A 327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.77
1u5q_A 348 Serine/threonine protein kinase TAO2; transferase; 99.77
3kmu_A 271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.77
3t9t_A 267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.76
1cm8_A 367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.76
2i1m_A 333 Macrophage colony-stimulating factor 1 receptor; k 99.76
2x7f_A 326 TRAF2 and NCK-interacting protein kinase; serine/t 99.76
3soc_A 322 Activin receptor type-2A; structural genomics cons 99.76
1zy4_A 303 Serine/threonine-protein kinase GCN2; translation 99.76
4f0f_A 287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.76
3nsz_A 330 CK II alpha, casein kinase II subunit alpha; inhib 99.76
3qup_A 323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.76
2i6l_A 320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.76
3mtl_A 324 Cell division protein kinase 16; pctaire1, indirub 99.76
1mqb_A 333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.76
2xir_A 316 Vascular endothelial growth factor receptor 2; ang 99.75
3eb0_A 383 Putative uncharacterized protein; kinase cryptospo 99.75
3mi9_A 351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.75
2w5a_A 279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.75
3fhr_A 336 MAP kinase-activated protein kinase 3; kinase-inhi 99.75
3uim_A 326 Brassinosteroid insensitive 1-associated receptor; 99.75
3op5_A 364 Serine/threonine-protein kinase VRK1; adenosine tr 99.75
3ttj_A 464 Mitogen-activated protein kinase 10; JNK3, protein 99.75
2v62_A 345 Serine/threonine-protein kinase VRK2; transferase, 99.75
1mp8_A 281 Focal adhesion kinase 1; tyrosine protein kinase, 99.75
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.75
1u59_A 287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.75
3dtc_A 271 Mitogen-activated protein kinase kinase kinase 9; 99.75
3ll6_A 337 Cyclin G-associated kinase; transferase, protein k 99.75
2r3i_A 299 Cell division protein kinase 2; serine/threonine-p 99.75
2ozo_A 613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.75
2nru_A 307 Interleukin-1 receptor-associated kinase 4; inhibi 99.75
3kvw_A 429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.74
3poz_A 327 Epidermal growth factor receptor; kinase domain, a 99.74
2pml_X 348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.74
3kex_A 325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.74
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.74
1ua2_A 346 CAK, cell division protein kinase 7; cell cycle, p 99.74
3a99_A 320 Proto-oncogene serine/threonine-protein kinase PI; 99.74
3cc6_A 281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.74
3rgf_A 405 Cyclin-dependent kinase 8; protein kinase complex, 99.74
1p4o_A 322 Insulin-like growth factor I receptor protein; IGF 99.73
1blx_A 326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.73
2wtk_C 305 Serine/threonine-protein kinase 11; transferase-me 99.73
4asz_A299 BDNF/NT-3 growth factors receptor; transferase, TR 99.73
3qyz_A 364 Mitogen-activated protein kinase 1; transferase, s 99.73
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.73
1wak_A 397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.73
3fme_A 290 Dual specificity mitogen-activated protein kinase; 99.73
2fst_X 367 Mitogen-activated protein kinase 14; active mutant 99.73
3pls_A 298 Macrophage-stimulating protein receptor; protein k 99.73
2xrw_A 371 Mitogen-activated protein kinase 8; transcription, 99.73
3brb_A 313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.73
4gt4_A308 Tyrosine-protein kinase transmembrane receptor RO; 99.73
3q4u_A 301 Activin receptor type-1; structural genomics conso 99.73
4aoj_A329 High affinity nerve growth factor receptor; transf 99.73
2jii_A 352 Serine/threonine-protein kinase VRK3 molecule: VA 99.73
1qpc_A 279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.73
3an0_A 340 Dual specificity mitogen-activated protein kinase; 99.72
3f66_A 298 Hepatocyte growth factor receptor; C-Met, protein 99.72
3lb7_A 307 RAF proto-oncogene serine/threonine-protein kinas; 99.72
3cek_A 313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.72
1z57_A 339 Dual specificity protein kinase CLK1; protein tyro 99.72
3fxz_A297 Serine/threonine-protein kinase PAK 1; transferase 99.72
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.72
3lzb_A 327 Epidermal growth factor receptor; epidermal growth 99.72
3sv0_A 483 Casein kinase I-like; typical kinase domain fold, 99.72
3omv_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.72
3gxj_A 303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.72
2yab_A361 Death-associated protein kinase 2; apoptosis, tran 99.71
1j1b_A 420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.71
1b6c_B 342 TGF-B superfamily receptor type I; complex (isomer 99.71
2b9h_A 353 MAP kinase FUS3, mitogen-activated protein kinase 99.71
3gbz_A329 Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- 99.71
3q60_A 371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.71
3lm5_A327 Serine/threonine-protein kinase 17B; STK17B, serin 99.71
4hgt_A 296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.71
1o6l_A337 RAC-beta serine/threonine protein kinase; protein 99.71
3c1x_A 373 Hepatocyte growth factor receptor; receptor tyrosi 99.71
2pzi_A 681 Probable serine/threonine-protein kinase PKNG; ATP 99.7
3pg1_A 362 Mitogen-activated protein kinase, putative (MAP K 99.7
3fe3_A328 MAP/microtubule affinity-regulating kinase 3; seri 99.7
2eva_A 307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.7
3uzp_A 296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.7
3oz6_A388 Mitogen-activated protein kinase 1, serine/threon 99.7
1byg_A 278 CSK, protein (C-terminal SRC kinase); protein kina 99.7
3mdy_A 337 Bone morphogenetic protein receptor type-1B; compl 99.7
3e3p_A 360 Protein kinase, putative glycogen synthase kinase; 99.7
2vd5_A412 DMPK protein; serine/threonine-protein kinase, kin 99.7
4ase_A353 Vascular endothelial growth factor receptor 2; tra 99.7
1xjd_A345 Protein kinase C, theta type; PKC-theta, ATP, AMP, 99.7
3niz_A311 Rhodanese family protein; structural genomics, str 99.7
4exu_A 371 Mitogen-activated protein kinase 13; P38 kinase, t 99.7
2i0e_A353 Protein kinase C-beta II; serine/threonine protein 99.7
3g33_A308 Cell division protein kinase 4; Ser/Thr protein ki 99.7
1u46_A 291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.69
3is5_A285 Calcium-dependent protein kinase; CDPK, structural 99.69
2j0j_A 656 Focal adhesion kinase 1; cell migration, FERM, tra 99.69
3og7_A 289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.69
4e7w_A394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.69
4fr4_A384 YANK1, serine/threonine-protein kinase 32A; struct 99.69
1rdq_E350 PKA C-alpha, CAMP-dependent protein kinase, alpha- 99.69
2y4i_B 319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.69
1fot_A318 TPK1 delta, CAMP-dependent protein kinase type 1; 99.69
3p23_A 432 Serine/threonine-protein kinase/endoribonuclease; 99.69
3txo_A353 PKC-L, NPKC-ETA, protein kinase C ETA type; phosph 99.69
4aw2_A437 Serine/threonine-protein kinase MRCK alpha; transf 99.69
2rio_A 434 Serine/threonine-protein kinase/endoribonuclease I 99.69
3mtl_A324 Cell division protein kinase 16; pctaire1, indirub 99.69
2vx3_A 382 Dual specificity tyrosine-phosphorylation- regula 99.69
4g31_A299 Eukaryotic translation initiation factor 2-alpha; 99.68
3aln_A 327 Dual specificity mitogen-activated protein kinase; 99.68
2j7t_A302 Serine/threonine-protein kinase 10; transferase, A 99.68
3kvw_A429 DYRK2, dual specificity tyrosine-phosphorylation-r 99.68
2y0a_A326 Death-associated protein kinase 1; transferase, ca 99.68
2c30_A321 Serine/threonine-protein kinase PAK 6; CRIB domain 99.68
1q8y_A 373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.68
3zgw_A347 Maternal embryonic leucine zipper kinase; transfer 99.68
3v8s_A410 RHO-associated protein kinase 1; dimerization, myo 99.68
2pmi_A317 Negative RE, cyclin-dependent protein kinase PHO85 99.68
3soa_A444 Calcium/calmodulin-dependent protein kinase type a 99.68
4dc2_A396 Protein kinase C IOTA type; kinase, substrate, cel 99.68
3coi_A 353 Mitogen-activated protein kinase 13; P38D, P38delt 99.68
1ob3_A288 PFPK5, cell division control protein 2 homolog; tr 99.68
2dyl_A 318 Dual specificity mitogen-activated protein kinase 99.68
2eu9_A 355 Dual specificity protein kinase CLK3; kinase domai 99.68
1kob_A387 Twitchin; kinase, intrasteric regulation; 2.30A {A 99.67
2vx3_A382 Dual specificity tyrosine-phosphorylation- regula 99.67
4e7w_A 394 Glycogen synthase kinase 3; GSK3, PTyr195, transfe 99.67
1j1b_A420 Glycogen synthase kinase-3 beta; complex, TAU, AMP 99.67
4ejn_A446 RAC-alpha serine/threonine-protein kinase; AKT1, a 99.67
1cm8_A367 Phosphorylated MAP kinase P38-gamma; phosphorylati 99.67
2r5t_A373 Serine/threonine-protein kinase SGK1; AGC protein 99.66
2b9h_A353 MAP kinase FUS3, mitogen-activated protein kinase 99.66
3e3p_A360 Protein kinase, putative glycogen synthase kinase; 99.66
3a62_A327 Ribosomal protein S6 kinase beta-1; kinase domain, 99.66
2ac3_A316 MAP kinase-interacting serine/threonine kinase 2; 99.66
2w4o_A349 Calcium/calmodulin-dependent protein kinase type I 99.66
2wtk_C305 Serine/threonine-protein kinase 11; transferase-me 99.66
3g2f_A 336 Bone morphogenetic protein receptor type-2; kinase 99.66
3a8x_A345 Protein kinase C IOTA type; transferase; HET: TPO; 99.66
3pfq_A674 PKC-B, PKC-beta, protein kinase C beta type; phosp 99.66
1t4h_A290 Serine/threonine-protein kinase WNK1; protein seri 99.65
3rgf_A405 Cyclin-dependent kinase 8; protein kinase complex, 99.65
3c0i_A351 Peripheral plasma membrane protein CASK; neurexin, 99.65
2bdw_A362 Hypothetical protein K11E8.1D; kinase, calmodulin 99.65
3mi9_A351 Cell division protein kinase 9; P-TEFB, HIV-1, pro 99.65
2a2a_A321 Death-associated protein kinase 2; autoinhibition, 99.65
3tki_A323 Serine/threonine-protein kinase CHK1; cell checkpo 99.65
1ua2_A346 CAK, cell division protein kinase 7; cell cycle, p 99.65
3gni_B389 Strad alpha; kinase fold, pseudokinase, alpha heli 99.65
3ttj_A464 Mitogen-activated protein kinase 10; JNK3, protein 99.65
1tki_A321 Titin; serine kinase, muscle, autoinhibition; 2.00 99.65
2fst_X367 Mitogen-activated protein kinase 14; active mutant 99.65
4agu_A311 Cyclin-dependent kinase-like 1; transferase, phosp 99.65
3kk8_A284 Calcium/calmodulin dependent protein kinase II; AT 99.65
3hko_A345 Calcium/calmodulin-dependent protein kinase with d 99.64
2r3i_A299 Cell division protein kinase 2; serine/threonine-p 99.64
3llt_A360 Serine/threonine kinase-1, pflammer; lammer kinase 99.64
3fme_A290 Dual specificity mitogen-activated protein kinase; 99.64
3eb0_A383 Putative uncharacterized protein; kinase cryptospo 99.64
3coi_A353 Mitogen-activated protein kinase 13; P38D, P38delt 99.64
3o0g_A292 Cell division protein kinase 5; kinase activator c 99.64
4exu_A371 Mitogen-activated protein kinase 13; P38 kinase, t 99.64
3dbq_A343 Dual specificity protein kinase TTK; MPS1 structur 99.64
2zmd_A390 Dual specificity protein kinase TTK; MPS1, T686A, 99.64
3qyz_A364 Mitogen-activated protein kinase 1; transferase, s 99.64
1blx_A326 Cyclin-dependent kinase 6; inhibitor protein, cycl 99.64
2vgo_A284 Serine/threonine-protein kinase 12-A; nucleotide-b 99.64
2eue_A275 Carbon catabolite derepressing protein kinase; kin 99.64
2x4f_A373 Myosin light chain kinase family member 4; LUNG, b 99.64
1nxk_A400 MAP kinase-activated protein kinase 2; MK2, phosph 99.64
2i6l_A320 Mitogen-activated protein kinase 6; MAPK6, ERK3, e 99.63
2jam_A304 Calcium/calmodulin-dependent protein kinase type 1 99.63
2y7j_A365 Phosphorylase B kinase gamma catalytic chain, test 99.63
1phk_A298 Phosphorylase kinase; glycogen metabolism, transfe 99.63
3fdn_A279 Serine/threonine-protein kinase 6; aurora kinase i 99.63
2eu9_A355 Dual specificity protein kinase CLK3; kinase domai 99.63
2clq_A295 Mitogen-activated protein kinase kinase kinase 5; 99.63
3com_A314 Serine/threonine-protein kinase 4; MST1, STE20-lik 99.63
1q8y_A373 SR protein kinase; transferase; HET: ADP ADE; 2.05 99.63
3rp9_A458 Mitogen-activated protein kinase; structural genom 99.62
2zv2_A298 Calcium/calmodulin-dependent protein kinase kinas; 99.62
3kn6_A325 Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 99.62
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 99.62
2w5a_A279 Serine/threonine-protein kinase NEK2; Ser/Thr prot 99.62
1u5q_A348 Serine/threonine protein kinase TAO2; transferase; 99.62
1z57_A339 Dual specificity protein kinase CLK1; protein tyro 99.62
3c4z_A543 Rhodopsin kinase; Ser/Thr kinase, RGS homology dom 99.62
2acx_A576 G protein-coupled receptor kinase 6; GRK, G transf 99.62
2qr7_A342 Ribosomal protein S6 kinase alpha-3; kinase domain 99.62
3h4j_B336 AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin 99.62
2yex_A276 Serine/threonine-protein kinase CHK1; transferase, 99.61
3an0_A340 Dual specificity mitogen-activated protein kinase; 99.61
3nsz_A330 CK II alpha, casein kinase II subunit alpha; inhib 99.61
3lij_A494 Calcium/calmodulin dependent protein kinase with A 99.61
3cok_A278 Serine/threonine-protein kinase PLK4; POLO-like ki 99.61
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 99.61
1wak_A397 Serine/threonine-protein kinase SPRK1; SRPK, trans 99.61
3n9x_A432 Phosphotransferase; malaria kinase, structural gen 99.61
3cek_A313 Dual specificity protein kinase TTK; HMPS1, PYT, E 99.61
2vwi_A303 Serine/threonine-protein kinase OSR1; STE kinase, 99.61
2dyl_A318 Dual specificity mitogen-activated protein kinase 99.61
2x7f_A326 TRAF2 and NCK-interacting protein kinase; serine/t 99.6
2xrw_A371 Mitogen-activated protein kinase 8; transcription, 99.6
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 99.6
2wei_A287 Calmodulin-domain protein kinase 1, putative; nucl 99.6
2y94_A476 5'-AMP-activated protein kinase catalytic subunit; 99.6
3eqc_A360 Dual specificity mitogen-activated protein kinase; 99.6
3en9_A540 Glycoprotease, O-sialoglycoprotein endopeptidase/p 99.59
3pg1_A362 Mitogen-activated protein kinase, putative (MAP K 99.59
3uc3_A361 Serine/threonine-protein kinase SRK2I; SNRK2, ABA 99.59
3m2w_A299 MAP kinase-activated protein kinase 2; small molec 99.59
1vzo_A355 Ribosomal protein S6 kinase alpha 5; protein kinas 99.59
2h6d_A276 5'-AMP-activated protein kinase catalytic subunit 99.59
2rku_A294 Serine/threonine-protein kinase PLK1; structure of 99.59
3f3z_A277 Calcium/calmodulin-dependent protein kinase with d 99.59
3qup_A323 Tyrosine-protein kinase receptor TYRO3; protein ki 99.59
2ycf_A322 Serine/threonine-protein kinase CHK2; transferase, 99.59
3a7i_A303 MST3 kinase, serine/threonine kinase 24 (STE20 hom 99.59
3bhy_A283 Death-associated protein kinase 3; death associate 99.58
3p23_A432 Serine/threonine-protein kinase/endoribonuclease; 99.58
3i6u_A419 CDS1, serine/threonine-protein kinase CHK2; Ser/Th 99.58
2owb_A335 Serine/threonine-protein kinase PLK1; catalytic do 99.58
3dls_A335 PAS domain-containing serine/threonine-protein KI; 99.58
2pml_X348 PFPK7, Ser/Thr protein kinase; phosphorylati trans 99.58
3fhr_A336 MAP kinase-activated protein kinase 3; kinase-inhi 99.57
3q60_A371 ROP5B; pseudokinase, transferase; HET: ATP; 1.72A 99.57
1x8b_A289 WEE1HU, WEE1-like protein kinase; cell cycle, tran 99.57
4aaa_A331 Cyclin-dependent kinase-like 2; transferase, phosp 99.57
3p1a_A311 MYT1 kinase, membrane-associated tyrosine- and thr 99.56
3byv_A377 Rhoptry kinase; malaria, transferase, structural g 99.55
2rio_A434 Serine/threonine-protein kinase/endoribonuclease I 99.54
3p86_A309 Serine/threonine-protein kinase CTR1; ETR1, ERS1, 99.54
3ork_A311 Serine/threonine protein kinase; structural genomi 99.52
3a99_A320 Proto-oncogene serine/threonine-protein kinase PI; 99.52
3dtc_A271 Mitogen-activated protein kinase kinase kinase 9; 99.52
3aln_A327 Dual specificity mitogen-activated protein kinase; 99.52
3l9p_A367 Anaplastic lymphoma kinase; kinase domain, ATP-bin 99.52
3qd2_B332 Eukaryotic translation initiation factor 2-alpha; 99.52
2eva_A307 TAK1 kinase - TAB1 chimera fusion protein; transfe 99.51
1zar_A282 RIO2 kinase; serine kinase, winged-helix, RIO doma 99.51
4hcu_A269 Tyrosine-protein kinase ITK/TSK; transferase-trans 99.51
2psq_A370 Fibroblast growth factor receptor 2; kinase domain 99.5
3kmu_A271 ILK, integrin-linked kinase; cell adhesion, ANK re 99.5
3dzo_A413 Rhoptry kinase domain; parasitic disease, transfer 99.5
3lb7_A307 RAF proto-oncogene serine/threonine-protein kinas; 99.5
3poz_A327 Epidermal growth factor receptor; kinase domain, a 99.5
3cc6_A281 Protein tyrosine kinase 2 beta; focal adhesion kin 99.49
3lzb_A327 Epidermal growth factor receptor; epidermal growth 99.49
2iwi_A312 Serine/threonine-protein kinase PIM-2; nucleotide- 99.49
1qcf_A454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.49
3cbl_A377 C-FES, proto-oncogene tyrosine-protein kinase FES/ 99.49
1mp8_A281 Focal adhesion kinase 1; tyrosine protein kinase, 99.49
4f0f_A287 Serine/threonine-protein kinase ROCO4; LRRK2, ATP- 99.49
1u59_A287 Tyrosine-protein kinase ZAP-70; transferase; HET: 99.48
3sxs_A268 Cytoplasmic tyrosine-protein kinase BMX; transfera 99.48
2yfx_A327 Tyrosine-protein kinase receptor; nucleotide-bindi 99.48
3gen_A283 Tyrosine-protein kinase BTK; bruton'S tyrosine kin 99.48
3t9t_A267 Tyrosine-protein kinase ITK/TSK; kinase domain, al 99.48
3tt0_A382 Basic fibroblast growth factor receptor 1; kinase 99.48
3kul_A325 Ephrin type-A receptor 8; ATP-binding, kinase, nuc 99.48
1k9a_A450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.47
2ivs_A314 Proto-oncogene tyrosine-protein kinase receptor RE 99.47
1zy4_A303 Serine/threonine-protein kinase GCN2; translation 99.47
3brb_A313 Proto-oncogene tyrosine-protein kinase MER; ATP-bi 99.47
1fmk_A452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.47
1xbb_A291 Tyrosine-protein kinase SYK; gleevec, STI-571, ima 99.47
3og7_A289 AKAP9-BRAF fusion protein; proto-oncogene, V600E, 99.46
1luf_A343 Muscle-specific tyrosine kinase receptor MUSK; pho 99.46
4hgt_A296 Casein kinase I isoform delta; CK1D, inhibitor, tr 99.46
1fvr_A327 Tyrosine-protein kinase TIE-2; tyrosine kinase, tr 99.46
2h34_A309 Serine/threonine-protein kinase PKNE; apoenzyme, t 99.46
3kex_A325 Receptor tyrosine-protein kinase ERBB-3; kinase do 99.46
3uzp_A296 CKI-delta, CKID, casein kinase I isoform delta; CK 99.46
1p4o_A322 Insulin-like growth factor I receptor protein; IGF 99.45
3vhe_A359 Vascular endothelial growth factor receptor 2; kin 99.45
1byg_A278 CSK, protein (C-terminal SRC kinase); protein kina 99.45
3kfa_A288 Tyrosine-protein kinase ABL1; CML, drug resistance 99.45
1mqb_A333 Ephrin type-A receptor 2; tyrosine protein kinase, 99.45
2qol_A373 Ephrin receptor; receptor tyrosine kinase, juxtame 99.45
1qpc_A279 LCK kinase; alpha beta fold, transferase; HET: PTR 99.45
3hmm_A303 TGF-beta receptor type-1; ALK5, kinase, inhibitor, 99.44
2y4i_B319 KSR2, HKSR2, kinase suppressor of RAS 2; transfera 99.44
4euu_A319 Serine/threonine-protein kinase TBK1; ATP binding, 99.44
1rjb_A344 FL cytokine receptor; kinase, structure, autoinhib 99.44
1csn_A298 Casein kinase-1; phosphotransferase; HET: ATP; 2.0 99.44
2pvf_A334 Fibroblast growth factor receptor 2; kinase domain 99.44
1u46_A291 ACK-1, activated CDC42 kinase 1; tyrosine kinase, 99.44
3c1x_A373 Hepatocyte growth factor receptor; receptor tyrosi 99.43
3pls_A298 Macrophage-stimulating protein receptor; protein k 99.43
2ozo_A613 Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t 99.43
4fl3_A635 Tyrosine-protein kinase SYK; transferase; HET: ANP 99.43
1opk_A495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.43
2jii_A352 Serine/threonine-protein kinase VRK3 molecule: VA 99.43
2h8h_A535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.42
2xir_A316 Vascular endothelial growth factor receptor 2; ang 99.42
1t46_A313 HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom 99.41
3f66_A298 Hepatocyte growth factor receptor; C-Met, protein 99.41
2wqm_A310 Serine/threonine-protein kinase NEK7; ATP-binding, 99.41
2v62_A345 Serine/threonine-protein kinase VRK2; transferase, 99.4
2i1m_A333 Macrophage colony-stimulating factor 1 receptor; k 99.39
4eqm_A294 Protein kinase; transferase; HET: ANP; 3.00A {Stap 99.39
3ugc_A295 Tyrosine-protein kinase JAK2; small molecule inhib 99.38
2j0j_A656 Focal adhesion kinase 1; cell migration, FERM, tra 99.38
2izr_A330 Casein kinase I isoform gamma-3; serine/threonine- 99.37
4fvq_A289 Tyrosine-protein kinase JAK2; janus protein kinase 99.37
3ll6_A337 Cyclin G-associated kinase; transferase, protein k 99.36
2buj_A317 Serine/threonine-protein kinase 16; transferase, A 99.36
3uqc_A286 Probable conserved transmembrane protein; structur 99.35
3dzo_A 413 Rhoptry kinase domain; parasitic disease, transfer 99.35
3op5_A364 Serine/threonine-protein kinase VRK1; adenosine tr 99.34
3sv0_A483 Casein kinase I-like; typical kinase domain fold, 99.34
2qkw_B321 Protein kinase; three-helix bundle motif, AVRPTO-P 99.33
3lxl_A327 Tyrosine-protein kinase JAK3; TYK2, inflammation, 99.33
3s95_A310 LIMK-1, LIM domain kinase 1; structural genomics, 99.32
3qa8_A 676 MGC80376 protein; kinase ubiquitin-like domain, ph 99.32
1zth_A258 RIO1 serine protein kinase; ribosome biogenesis, r 99.32
3lxp_A318 Non-receptor tyrosine-protein kinase TYK2; JAK3, i 99.31
3soc_A322 Activin receptor type-2A; structural genomics cons 99.31
3q4u_A301 Activin receptor type-1; structural genomics conso 99.28
2a19_B284 Interferon-induced, double-stranded RNA-activated 99.27
4e5w_A302 Tyrosine-protein kinase JAK1; kinase domain, trans 99.27
2w1i_A326 JAK2; chromosomal rearrangement, nucleotide-bindin 99.26
3g2f_A336 Bone morphogenetic protein receptor type-2; kinase 99.25
3uim_A326 Brassinosteroid insensitive 1-associated receptor; 99.25
2nru_A307 Interleukin-1 receptor-associated kinase 4; inhibi 99.25
3mdy_A337 Bone morphogenetic protein receptor type-1B; compl 99.24
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 99.2
1b6c_B342 TGF-B superfamily receptor type I; complex (isomer 99.19
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
Probab=99.95  E-value=7.3e-29  Score=196.99  Aligned_cols=120  Identities=21%  Similarity=0.362  Sum_probs=109.7

Q ss_pred             ccccCCCCcceeeccCCCCCCeeEEEEeecccccc---hhcHHHHHHHHHHhhhcCCCCeeeeeEeEEeCCeEEEEEecc
Q psy4166         122 DVVSTSPPRPSSLLLSPAPSQHVAIKRITKKNLAK---TQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFC  198 (249)
Q Consensus       122 ~~~~~g~~~~~~~~~~~~~~~~vavK~~~~~~~~~---~~~~~~e~~~~~~~~~~~h~niv~l~~~~~~~~~~~lv~e~~  198 (249)
                      ..+|.|++|.||++.+..+++.||+|++.+....+   .+.+.+|+.+++.++   |||||+++++|.+.+.+|||||||
T Consensus        38 ~~lG~G~fg~V~~a~~~~~~~~~AiK~i~k~~~~~~~~~~~~~~E~~il~~l~---HpnIv~l~~~~~~~~~~yivmEy~  114 (311)
T 4aw0_A           38 KILGEGSFSTVVLARELATSREYAIKILEKRHIIKENKVPYVTRERDVMSRLD---HPFFVKLYFTFQDDEKLYFGLSYA  114 (311)
T ss_dssp             EEEEEETTEEEEEEEETTTCCEEEEEEEEHHHHHHTTCHHHHHHHHHHHTTCC---CTTBCCEEEEEECSSEEEEEECCC
T ss_pred             EEEecccCeEEEEEEECCCCCEEEEEEEEHHHCCCHHHHHHHHHHHHHHHhCC---CCCCCeEEEEEEeCCEEEEEEecC
Confidence            57899999999999999999999999998754322   356788999988776   999999999999999999999999


Q ss_pred             CCCCHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhh-------cCCccceeeee
Q psy4166         199 NGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFH-------DFTPWSFVILY  244 (249)
Q Consensus       199 ~~g~L~~~l~~~~~~~~~~~~~~~~~i~~~l~ylh-------d~kp~nili~~  244 (249)
                      +||+|.++|.+.+.++|.+++.|+.|++.|+.|||       |+||+||||..
T Consensus       115 ~gG~L~~~i~~~~~l~e~~~~~~~~qi~~al~ylH~~~IiHRDlKPeNILl~~  167 (311)
T 4aw0_A          115 KNGELLKYIRKIGSFDETCTRFYTAEIVSALEYLHGKGIIHRDLKPENILLNE  167 (311)
T ss_dssp             TTEEHHHHHHHHSSCCHHHHHHHHHHHHHHHHHHHHTTEECSCCSGGGEEECT
T ss_pred             CCCCHHHHHHHcCCCCHHHHHHHHHHHHHHHHHHHHCCCccCCCCHHHeEEcC
Confidence            99999999999889999999999999999999999       99999999954



>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} Back     alignment and structure
>2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1o6l_A RAC-beta serine/threonine protein kinase; protein kinase, transferase, serine/threonine-protein kinase; HET: TPO ANP; 1.6A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jdo_A* 2jdr_A* 2uw9_A* 2x37_A* 2x39_A* 2xh5_A* 3d0e_A* 3e87_A* 3e88_A* 3e8d_A* 1o6k_A* 1mrv_A 1mry_A 1gzn_A 1gzk_A 1gzo_A 3qkl_A* 3ocb_A* 3ow4_A* 3qkk_A* ... Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} Back     alignment and structure
>4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* Back     alignment and structure
>1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* Back     alignment and structure
>3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* Back     alignment and structure
>3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} Back     alignment and structure
>1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>1fot_A TPK1 delta, CAMP-dependent protein kinase type 1; open conformation, transferase; HET: TPO; 2.80A {Saccharomyces cerevisiae} SCOP: d.144.1.7 Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} Back     alignment and structure
>4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3mtl_A Cell division protein kinase 16; pctaire1, indirubin, structural genomics, structural consortium, SGC, transferase; HET: FEF; 2.40A {Homo sapiens} Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>4g31_A Eukaryotic translation initiation factor 2-alpha; deletion mutant, catalytic domain, synthetic inhibitor, TRAN transferase inhibitor complex; HET: 0WH; 2.28A {Homo sapiens} PDB: 4g34_A* Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* Back     alignment and structure
>3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* Back     alignment and structure
>2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} Back     alignment and structure
>2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* Back     alignment and structure
>2pmi_A Negative RE, cyclin-dependent protein kinase PHO85; cyclin-dependent kinase, signaling protein,transfera cycle complex; HET: MES AGS; 2.90A {Saccharomyces cerevisiae} PDB: 2pk9_A* Back     alignment and structure
>3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} Back     alignment and structure
>4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>1ob3_A PFPK5, cell division control protein 2 homolog; transferase, serine/threonine-protein kinase, ATP-binding, phosphorylation, CDK; 1.9A {Plasmodium falciparum} SCOP: d.144.1.7 PDB: 1v0p_A* 1v0o_A* 1v0b_A Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 Back     alignment and structure
>2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* Back     alignment and structure
>4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} Back     alignment and structure
>1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... Back     alignment and structure
>4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* Back     alignment and structure
>1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* Back     alignment and structure
>2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* Back     alignment and structure
>3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} Back     alignment and structure
>3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* Back     alignment and structure
>2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A Back     alignment and structure
>2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} Back     alignment and structure
>2wtk_C Serine/threonine-protein kinase 11; transferase-metal-binding protein complex, transferase metal protein complex, nucleus; HET: ANP; 2.65A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A Back     alignment and structure
>3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} Back     alignment and structure
>3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A Back     alignment and structure
>2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B Back     alignment and structure
>3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* Back     alignment and structure
>2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A Back     alignment and structure
>3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* Back     alignment and structure
>1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* Back     alignment and structure
>3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* Back     alignment and structure
>1tki_A Titin; serine kinase, muscle, autoinhibition; 2.00A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... Back     alignment and structure
>4agu_A Cyclin-dependent kinase-like 1; transferase, phospho-mimetic; HET: D15; 2.40A {Homo sapiens} Back     alignment and structure
>3kk8_A Calcium/calmodulin dependent protein kinase II; ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; HET: TPO; 1.72A {Caenorhabditis elegans} PDB: 3kk9_A* 3kl8_A 2vn9_A* 3bhh_A* Back     alignment and structure
>3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} Back     alignment and structure
>2r3i_A Cell division protein kinase 2; serine/threonine-protein kinase, cell cycle, inhibition, cyclin-dependent kinase, cancer, ATP-binding; HET: SCF; 1.28A {Homo sapiens} PDB: 2r3j_A* 2r3k_A* 2r3l_A* 2r3m_A* 2r3n_A* 2r3o_A* 2r3p_A* 2r3q_A* 1jvp_P* 1buh_A 1ckp_A* 1di8_A* 1dm2_A* 1f5q_A 1fin_A* 1fq1_B* 1fvt_A* 1fvv_A* 1g5s_A* 1gih_A* ... Back     alignment and structure
>3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} Back     alignment and structure
>3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A Back     alignment and structure
>3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} Back     alignment and structure
>3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} Back     alignment and structure
>3o0g_A Cell division protein kinase 5; kinase activator complex, kinase inhibitor complex, transferase-transferase activator complex; HET: 3O0; 1.95A {Homo sapiens} SCOP: d.144.1.7 PDB: 1unh_A* 1ung_A* 1unl_A* 1h4l_A Back     alignment and structure
>4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A Back     alignment and structure
>3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} Back     alignment and structure
>2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* Back     alignment and structure
>3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... Back     alignment and structure
>1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B Back     alignment and structure
>2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... Back     alignment and structure
>2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} Back     alignment and structure
>1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C Back     alignment and structure
>2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} Back     alignment and structure
>2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A Back     alignment and structure
>2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A Back     alignment and structure
>1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* Back     alignment and structure
>3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... Back     alignment and structure
>2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* Back     alignment and structure
>2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} Back     alignment and structure
>3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} Back     alignment and structure
>1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A Back     alignment and structure
>3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} Back     alignment and structure
>2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} Back     alignment and structure
>3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>2w5a_A Serine/threonine-protein kinase NEK2; Ser/Thr protein kinase, nucleus, meiosis, mitosis, cytoplasm, metal-binding, phosphoprotein; HET: ADP; 1.55A {Homo sapiens} PDB: 2wqo_A* 2xk3_A* 2xk4_A* 2xk6_A* 2xk7_A* 2xk8_A* 2xkc_A* 2xkd_A* 2xke_A* 2xkf_A* 2xnm_A* 2xnn_A* 2xno_A* 2xnp_A* 4afe_A* 2jav_A* 2w5b_A* 2w5h_A 4a4x_A* Back     alignment and structure
>1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* Back     alignment and structure
>1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* Back     alignment and structure
>3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B Back     alignment and structure
>2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* Back     alignment and structure
>2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A Back     alignment and structure
>3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} Back     alignment and structure
>2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... Back     alignment and structure
>3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* Back     alignment and structure
>3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* Back     alignment and structure
>3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* Back     alignment and structure
>2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* Back     alignment and structure
>2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} Back     alignment and structure
>2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} Back     alignment and structure
>2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* Back     alignment and structure
>2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} Back     alignment and structure
>3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... Back     alignment and structure
>3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* Back     alignment and structure
>3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* Back     alignment and structure
>3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A Back     alignment and structure
>3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* Back     alignment and structure
>1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* Back     alignment and structure
>2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* Back     alignment and structure
>3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* Back     alignment and structure
>3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} Back     alignment and structure
>2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* Back     alignment and structure
>3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* Back     alignment and structure
>3bhy_A Death-associated protein kinase 3; death associated kinase, DAPK3, ZIP kinase, ZIPK, DAP kinase like kinase, DLK, structural genomics consortium; HET: 7CP; 1.24A {Homo sapiens} PDB: 3bqr_A* 2j90_A* 1yrp_A* 2yak_A* 2y4p_A* 3f5u_A* 1jks_A 1jkk_A* 1ig1_A* 1jkl_A 1jkt_A 3eh9_A* 3eha_A* 3f5g_A* 1p4f_A* 1wvw_A 1wvx_A* 1wvy_A* 2w4j_A* 3dgk_A ... Back     alignment and structure
>3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} Back     alignment and structure
>3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A Back     alignment and structure
>2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* Back     alignment and structure
>3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* Back     alignment and structure
>3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* Back     alignment and structure
>3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* Back     alignment and structure
>1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* Back     alignment and structure
>4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* Back     alignment and structure
>3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} Back     alignment and structure
>3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A Back     alignment and structure
>2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* Back     alignment and structure
>3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* Back     alignment and structure
>3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* Back     alignment and structure
>3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... Back     alignment and structure
>3dtc_A Mitogen-activated protein kinase kinase kinase 9; mixed-lineage kinase, MLK family, MLK1 and MLK3 subtype selective inhibitors; HET: VIN; 2.60A {Homo sapiens} SCOP: d.144.1.0 Back     alignment and structure
>3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* Back     alignment and structure
>3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} Back     alignment and structure
>3qd2_B Eukaryotic translation initiation factor 2-alpha; EIF2A kinase, phosphoryalation, gene regulation; HET: TPO; 2.81A {Mus musculus} Back     alignment and structure
>2eva_A TAK1 kinase - TAB1 chimera fusion protein; transferase/transferase activator complex; HET: ADN; 2.00A {Homo sapiens} Back     alignment and structure
>1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* Back     alignment and structure
>4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A Back     alignment and structure
>3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... Back     alignment and structure
>3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* Back     alignment and structure
>3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} Back     alignment and structure
>2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* Back     alignment and structure
>1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* Back     alignment and structure
>4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* Back     alignment and structure
>1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* Back     alignment and structure
>2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* Back     alignment and structure
>3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A Back     alignment and structure
>3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* Back     alignment and structure
>3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} Back     alignment and structure
>3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* Back     alignment and structure
>1zy4_A Serine/threonine-protein kinase GCN2; translation regulator, signal transduction, acid starvation, starvation stress response; 1.95A {Saccharomyces cerevisiae} PDB: 1zy5_A* 1zyd_A* 1zyc_A* 1zxe_A Back     alignment and structure
>3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* Back     alignment and structure
>3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... Back     alignment and structure
>1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 Back     alignment and structure
>4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A Back     alignment and structure
>1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* Back     alignment and structure
>2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* Back     alignment and structure
>3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A Back     alignment and structure
>1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... Back     alignment and structure
>3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* Back     alignment and structure
>1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* Back     alignment and structure
>3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... Back     alignment and structure
>1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... Back     alignment and structure
>1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... Back     alignment and structure
>3hmm_A TGF-beta receptor type-1; ALK5, kinase, inhibitor, quinazoline, aortic aneurysm, ATP-binding, craniosynostosis, disease mutation, disulfide bond; HET: 855; 1.70A {Homo sapiens} PDB: 1vjy_A* 3gxl_A* 3tzm_A* 2wot_A* 2wou_A* 1py5_A* 1rw8_A* Back     alignment and structure
>2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} Back     alignment and structure
>4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} Back     alignment and structure
>1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* Back     alignment and structure
>2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... Back     alignment and structure
>1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* Back     alignment and structure
>3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} Back     alignment and structure
>4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... Back     alignment and structure
>1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* Back     alignment and structure
>3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... Back     alignment and structure
>2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* Back     alignment and structure
>2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} Back     alignment and structure
>2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* Back     alignment and structure
>4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} Back     alignment and structure
>3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... Back     alignment and structure
>2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* Back     alignment and structure
>2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* Back     alignment and structure
>4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* Back     alignment and structure
>3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} Back     alignment and structure
>2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} Back     alignment and structure
>3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A Back     alignment and structure
>3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} Back     alignment and structure
>3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A Back     alignment and structure
>3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} Back     alignment and structure
>2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Back     alignment and structure
>3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* Back     alignment and structure
>3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} Back     alignment and structure
>3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* Back     alignment and structure
>1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* Back     alignment and structure
>3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* Back     alignment and structure
>3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* Back     alignment and structure
>3q4u_A Activin receptor type-1; structural genomics consortium, SGC, protein kinase, transfe; HET: LDN FLC; 1.82A {Homo sapiens} PDB: 3mtf_A* 3oom_A* 4dym_A* 3h9r_A* 3my0_A* Back     alignment and structure
>2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* Back     alignment and structure
>4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* Back     alignment and structure
>2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} Back     alignment and structure
>3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} Back     alignment and structure
>3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* Back     alignment and structure
>2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Back     alignment and structure
>3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 249
d1a06a_ 307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 1e-19
d1a06a_307 d.144.1.7 (A:) Calmodulin-dependent protein kinase 7e-15
d1koba_ 352 d.144.1.7 (A:) Twitchin, kinase domain {California 3e-18
d1koba_352 d.144.1.7 (A:) Twitchin, kinase domain {California 2e-14
d1yhwa1293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 7e-18
d1yhwa1 293 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [ 1e-16
d1s9ja_ 322 d.144.1.7 (A:) Dual specificity mitogen-activated 2e-17
d1s9ja_322 d.144.1.7 (A:) Dual specificity mitogen-activated 3e-10
d1koaa2 350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 3e-17
d1koaa2350 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {C 2e-16
d2jfla1288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 6e-17
d2jfla1 288 d.144.1.7 (A:21-308) STE20-like serine/threonine-p 1e-16
d2j4za1263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 1e-16
d2j4za1 263 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aur 3e-14
d1u5ra_ 309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 1e-16
d1u5ra_309 d.144.1.7 (A:) Serine/threonine protein kinase TAO 4e-13
d1uu3a_ 288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 2e-16
d1uu3a_288 d.144.1.7 (A:) 3-phosphoinositide dependent protei 8e-13
d1phka_ 277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 2e-16
d1phka_277 d.144.1.7 (A:) gamma-subunit of glycogen phosphory 1e-15
d1tkia_321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 4e-16
d1tkia_ 321 d.144.1.7 (A:) Titin, kinase domain {Human (Homo s 4e-14
d1nvra_ 271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 7e-16
d1nvra_271 d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 { 1e-12
d1t4ha_270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 7e-16
d1t4ha_ 270 d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sa 2e-14
d1jksa_293 d.144.1.7 (A:) Death-associated protein kinase, Da 1e-15
d1jksa_ 293 d.144.1.7 (A:) Death-associated protein kinase, Da 3e-14
d2java1269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 1e-15
d2java1 269 d.144.1.7 (A:3-271) Serine/threonine-protein kinas 3e-15
d1byga_ 262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-15
d1byga_262 d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) 2e-10
d1rjba_ 325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-15
d1rjba_325 d.144.1.7 (A:) Fl cytokine receptor {Human (Homo s 6e-07
d1omwa3 364 d.144.1.7 (A:186-549) G-protein coupled receptor k 8e-15
d1omwa3364 d.144.1.7 (A:186-549) G-protein coupled receptor k 1e-14
d1t46a_ 311 d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens 4e-14
d1xjda_ 320 d.144.1.7 (A:) Protein kinase C, theta type {Human 5e-14
d1xjda_320 d.144.1.7 (A:) Protein kinase C, theta type {Human 2e-13
d1o6ya_ 277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 6e-14
d1o6ya_277 d.144.1.7 (A:) Mycobacterial protein kinase PknB, 3e-12
d2ozaa1 335 d.144.1.7 (A:51-385) MAP kinase activated protein 8e-14
d2ozaa1335 d.144.1.7 (A:51-385) MAP kinase activated protein 3e-13
d1o6la_337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 3e-13
d1o6la_ 337 d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sap 1e-10
d1u59a_ 285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 3e-13
d1u59a_285 d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Hum 2e-09
d1vzoa_322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 4e-13
d1vzoa_ 322 d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5 9e-11
d1sm2a_ 263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 5e-13
d1sm2a_263 d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Hu 3e-09
d1xbba_ 277 d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human 8e-13
d1vjya_ 303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 9e-13
d1vjya_303 d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human 0.004
d1qpca_ 272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 1e-12
d1qpca_272 d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Hom 8e-09
d1k2pa_ 258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 1e-12
d1k2pa_258 d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Hum 2e-09
d1uwha_ 276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-12
d1uwha_276 d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) 1e-11
d1fota_316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 1e-12
d1fota_ 316 d.144.1.7 (A:) cAMP-dependent PK, catalytic subuni 4e-09
d1blxa_305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 5e-12
d1blxa_ 305 d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (H 3e-09
d1ua2a_ 299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 6e-12
d1ua2a_299 d.144.1.7 (A:) Cell division protein kinase 7, CDK 1e-10
d1opja_ 287 d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mou 7e-12
d1xwsa_273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 1e-11
d1xwsa_ 273 d.144.1.7 (A:) Proto-oncogene serine/threonine-pro 2e-11
d1fvra_ 309 d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [ 1e-11
d1u46a_ 273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 2e-11
d1u46a_273 d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Hum 9e-09
d1rdqe_350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 2e-11
d1rdqe_ 350 d.144.1.7 (E:) cAMP-dependent PK, catalytic subuni 3e-09
d1fgka_ 299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-11
d1fgka_299 d.144.1.7 (A:) Fibroblast growth factor receptor 1 3e-09
d1lufa_ 301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 3e-11
d1lufa_301 d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus n 6e-09
d1r0pa_ 311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 3e-11
d1r0pa_311 d.144.1.7 (A:) Hepatocyte growth factor receptor, 2e-08
d1ckia_ 299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 4e-11
d1ckia_299 d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus n 2e-09
d1jpaa_ 299 d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mou 5e-11
d3bqca1 328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 7e-11
d3bqca1328 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subu 2e-06
d1ob3a_ 286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 1e-10
d1ob3a_286 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmod 7e-10
d1pmea_345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-10
d1pmea_ 345 d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapien 1e-08
d1p4oa_ 308 d.144.1.7 (A:) Insulin-like growth factor 1 recept 2e-10
d1fmka3285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 2e-10
d1fmka3 285 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human 8e-09
d1cm8a_ 346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-10
d1cm8a_346 d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo s 2e-10
d1q5ka_350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 3e-10
d1q5ka_ 350 d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gs 5e-10
d1mp8a_ 273 d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Huma 3e-10
d1xkka_317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 7e-10
d1xkka_ 317 d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb- 5e-07
d1csna_ 293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 3e-09
d1csna_293 d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast 1e-07
d1mqba_ 283 d.144.1.7 (A:) epha2 receptor tyrosine kinase {Hum 3e-09
d3blha1 318 d.144.1.7 (A:8-325) Cell division protein kinase 9 3e-09
d3blha1318 d.144.1.7 (A:8-325) Cell division protein kinase 9 1e-08
d1gz8a_298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 6e-09
d1gz8a_ 298 d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (H 1e-07
d1unla_292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 6e-09
d1unla_ 292 d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (H 1e-07
d2gfsa1348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 6e-09
d2gfsa1 348 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sa 6e-06
d1ywna1 299 d.144.1.7 (A:818-1166) Vascular endothelial growth 2e-08
d1q8ya_362 d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces 6e-07
d2b1pa1 355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 8e-07
d2b1pa1355 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3 2e-06
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: Calmodulin-dependent protein kinase
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score = 83.5 bits (206), Expect = 1e-19
 Identities = 32/89 (35%), Positives = 47/89 (52%), Gaps = 6/89 (6%)

Query: 142 QHVAIKRITKKNL-AKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNG 200
           + VAIK I KK L  K  +   EI +L ++    H N+V L    ES  H+YL+M+  +G
Sbjct: 35  KLVAIKCIAKKALEGKEGSMENEIAVLHKI---KHPNIVALDDIYESGGHLYLIMQLVSG 91

Query: 201 GDLADYLVSKGTLSEDTIRIFLKLHQMLQ 229
           G+L D +V KG  +E      +   Q+L 
Sbjct: 92  GELFDRIVEKGFYTERDASRLIF--QVLD 118


>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 307 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Length = 352 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Length = 350 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 309 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 277 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Length = 321 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 271 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 270 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 325 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Length = 364 Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Length = 320 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Length = 277 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Length = 335 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 337 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Length = 322 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Length = 263 Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Length = 277 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Length = 303 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Length = 272 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 276 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 316 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Length = 305 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Length = 287 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 309 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Length = 350 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 301 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Length = 311 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 299 Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 299 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Length = 328 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Length = 286 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 308 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Length = 346 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Length = 350 Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Length = 273 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 317 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 293 Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 283 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Length = 318 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Length = 298 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Length = 292 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Length = 299 Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 362 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Length = 355 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query249
d1yhwa1 293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1nvra_ 271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.94
d2j4za1 263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.93
d1koaa2 350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.93
d1koba_ 352 Twitchin, kinase domain {California sea hare (Aply 99.93
d1tkia_ 321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.93
d2jfla1 288 STE20-like serine/threonine-protein kinase, SLK {H 99.93
d1jksa_ 293 Death-associated protein kinase, Dap {Human (Homo 99.93
d1a06a_ 307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.93
d1s9ja_ 322 Dual specificity mitogen-activated protein kinase 99.93
d1uu3a_ 288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.93
d1phka_ 277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.92
d1o6la_ 337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.92
d1t4ha_ 270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.92
d1u5ra_ 309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.92
d1omwa3 364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.92
d1opja_ 287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.92
d1xjda_ 320 Protein kinase C, theta type {Human (Homo sapiens) 99.91
d1o6ya_ 277 Mycobacterial protein kinase PknB, catalytic domai 99.91
d1fota_ 316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.91
d2ozaa1 335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.91
d2java1 269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.91
d1rdqe_ 350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.9
d1xbba_ 277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.9
d1ua2a_ 299 Cell division protein kinase 7, CDK7 {Human (Homo 99.9
d1sm2a_ 263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.89
d1u59a_ 285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.89
d1jpaa_ 299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.89
d1gz8a_ 298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.88
d1k2pa_ 258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.88
d1xwsa_ 273 Proto-oncogene serine/threonine-protein kinase Pim 99.88
d1rjba_ 325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.88
d1unla_ 292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.87
d1qpca_ 272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.87
d1uwha_ 276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1ob3a_ 286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.87
d1t46a_ 311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.86
d1fmka3 285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.86
d3bqca1 328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.86
d1vzoa_ 322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.86
d1fvra_ 309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.86
d1fgka_ 299 Fibroblast growth factor receptor 1 {Human (Homo s 99.86
d1byga_ 262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.86
d1q5ka_ 350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.86
d1cm8a_ 346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.85
d1pmea_ 345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.85
d2gfsa1 348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.85
d1mqba_ 283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.85
d1blxa_ 305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.84
d1mp8a_ 273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.84
d2b1pa1 355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.84
d1uu3a_288 3-phosphoinositide dependent protein kinase-1 Pdk1 99.84
d3blha1 318 Cell division protein kinase 9, CDK9 {Human (Homo 99.84
d1lufa_ 301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.83
d1xkka_ 317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.83
d2jfla1288 STE20-like serine/threonine-protein kinase, SLK {H 99.83
d1yhwa1293 pak1 {Human (Homo sapiens) [TaxId: 9606]} 99.83
d2j4za1263 Aurora-related kinase 1 (aurora-2) {Human (Homo sa 99.83
d2java1269 Serine/threonine-protein kinase Nek2 {Human (Homo 99.83
d1u46a_ 273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.83
d1ywna1 299 Vascular endothelial growth factor receptor 2 (kdr 99.82
d1omwa3364 G-protein coupled receptor kinase 2 {Cow (Bos taur 99.82
d1jksa_293 Death-associated protein kinase, Dap {Human (Homo 99.82
d1a06a_307 Calmodulin-dependent protein kinase {Rat (Rattus n 99.82
d1r0pa_ 311 Hepatocyte growth factor receptor, c-MET {Human (H 99.82
d1csna_ 293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.82
d1t4ha_270 Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 99.82
d1vjya_ 303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.81
d1blxa_305 Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T 99.81
d1xjda_320 Protein kinase C, theta type {Human (Homo sapiens) 99.81
d1ua2a_299 Cell division protein kinase 7, CDK7 {Human (Homo 99.81
d1p4oa_ 308 Insulin-like growth factor 1 receptor {Human (Homo 99.81
d1o6la_337 Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9 99.81
d1koba_352 Twitchin, kinase domain {California sea hare (Aply 99.81
d1koaa2350 Twitchin, kinase domain {Caenorhabditis elegans, p 99.8
d1fota_316 cAMP-dependent PK, catalytic subunit {Baker's yeas 99.8
d1ckia_ 299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.8
d1nvra_271 Cell cycle checkpoint kinase chk1 {Human (Homo sap 99.8
d1phka_277 gamma-subunit of glycogen phosphorylase kinase (Ph 99.79
d1rdqe_350 cAMP-dependent PK, catalytic subunit {Mouse (Mus m 99.79
d1vzoa_322 Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( 99.78
d1u5ra_309 Serine/threonine protein kinase TAO2 {Rat (Rattus 99.77
d1tkia_321 Titin, kinase domain {Human (Homo sapiens) [TaxId: 99.77
d1ob3a_286 Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) 99.76
d1gz8a_298 Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [T 99.76
d3blha1318 Cell division protein kinase 9, CDK9 {Human (Homo 99.75
d1s9ja_322 Dual specificity mitogen-activated protein kinase 99.75
d1xwsa_273 Proto-oncogene serine/threonine-protein kinase Pim 99.75
d1cm8a_346 MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 99.74
d1q5ka_350 Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho 99.74
d2gfsa1348 MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] 99.74
d2ozaa1335 MAP kinase activated protein kinase 2, mapkap2 {Hu 99.73
d1unla_292 Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [T 99.72
d1k2pa_258 Bruton's tyrosine kinase (Btk) {Human (Homo sapien 99.71
d1pmea_345 MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 99.7
d1mp8a_273 Focal adhesion kinase 1 (fak) {Human (Homo sapiens 99.7
d1jpaa_299 ephb2 receptor tyrosine kinase {Mouse (Mus musculu 99.69
d1uwha_276 B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1u59a_285 Tyrosine-protein kinase ZAP-70 {Human (Homo sapien 99.69
d1rjba_325 Fl cytokine receptor {Human (Homo sapiens) [TaxId: 99.68
d1sm2a_263 Tyrosine-protein kinase Itk/Tsk {Human (Homo sapie 99.68
d1xbba_277 Tyrosine-protein kinase SYK {Human (Homo sapiens) 99.68
d2b1pa1355 c-jun N-terminal kinase (jnk3s) {Human (Homo sapie 99.68
d3bqca1328 Protein kinase CK2, alpha subunit {Rattus norvegic 99.68
d1o6ya_277 Mycobacterial protein kinase PknB, catalytic domai 99.68
d1u46a_273 Activated CDC42 kinase 1, ACK1 {Human (Homo sapien 99.67
d1xkka_317 EGF receptor tyrosine kinase, Erbb-1 {Human (Homo 99.66
d1fgka_299 Fibroblast growth factor receptor 1 {Human (Homo s 99.66
d1byga_262 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.66
d1fmka3285 c-src tyrosine kinase {Human (Homo sapiens) [TaxId 99.65
d1qpca_272 Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax 99.65
d1lufa_301 Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax 99.65
d1q8ya_362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.65
d1fvra_309 Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1opja_287 Abelsone tyrosine kinase (abl) {Mouse (Mus musculu 99.62
d1mqba_283 epha2 receptor tyrosine kinase {Human (Homo sapien 99.61
d1p4oa_308 Insulin-like growth factor 1 receptor {Human (Homo 99.6
d1ywna1299 Vascular endothelial growth factor receptor 2 (kdr 99.59
d1q8ya_ 362 Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T 99.59
d1t46a_311 c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] 99.56
d1r0pa_311 Hepatocyte growth factor receptor, c-MET {Human (H 99.56
d1ckia_299 Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax 99.52
d1zara2191 Rio2 serine protein kinase C-terminal domain {Arch 99.44
d1csna_293 Casein kinase-1, CK1 {Fission yeast (Schizosacchar 99.35
d1vjya_303 Type I TGF-beta receptor R4 {Human (Homo sapiens) 99.34
d1j7la_ 263 Type IIIa 3',5"-aminoglycoside phosphotransferase 97.44
d1nd4a_ 255 Aminoglycoside 3'-phosphotransferase IIa (Kanamyci 95.45
d2pula1 392 Methylthioribose kinase MtnK {Bacillus subtilis [T 93.52
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Protein kinase-like (PK-like)
superfamily: Protein kinase-like (PK-like)
family: Protein kinases, catalytic subunit
domain: pak1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.94  E-value=1.2e-26  Score=182.08  Aligned_cols=120  Identities=19%  Similarity=0.302  Sum_probs=110.1

Q ss_pred             ccccCCCCcceeeccCCCCCCeeEEEEeecccccchhcHHHHHHHHHHhhhcCCCCeeeeeEeEEeCCeEEEEEeccCCC
Q psy4166         122 DVVSTSPPRPSSLLLSPAPSQHVAIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGG  201 (249)
Q Consensus       122 ~~~~~g~~~~~~~~~~~~~~~~vavK~~~~~~~~~~~~~~~e~~~~~~~~~~~h~niv~l~~~~~~~~~~~lv~e~~~~g  201 (249)
                      ..+|.|.+|.||++.+..+++.||+|++........+.+.+|+.+++.++   |||||+++++|.+.+.+|+|||||+||
T Consensus        26 ~~iG~G~fg~Vy~a~~~~~~~~vAvK~~~~~~~~~~~~~~~E~~il~~l~---HpnIv~~~~~~~~~~~~~ivmEy~~gg  102 (293)
T d1yhwa1          26 EKIGQGASGTVYTAMDVATGQEVAIRQMNLQQQPKKELIINEILVMRENK---NPNIVNYLDSYLVGDELWVVMEYLAGG  102 (293)
T ss_dssp             EECCCSSSCEEEEEEBTTTCCEEEEEEEEGGGCSCHHHHHHHHHHHHHCC---CTTBCCEEEEEEETTEEEEEEECCTTC
T ss_pred             EEEecCcCcEEEEEEECCCCCEEEEEEEecccChHHHHHHHHHHHHHhCC---CCCEeeEeEEEEECCEEEEEEEecCCC
Confidence            57899999999999999999999999998766555677899999999887   999999999999999999999999999


Q ss_pred             CHHHHHHhcCCCCHHHHHHHHHHHHHHHHHhh-------cCCccceeeeec
Q psy4166         202 DLADYLVSKGTLSEDTIRIFLKLHQMLQLYFH-------DFTPWSFVILYT  245 (249)
Q Consensus       202 ~L~~~l~~~~~~~~~~~~~~~~~i~~~l~ylh-------d~kp~nili~~~  245 (249)
                      +|.+++.++ .+++.+++.++.|++.|+.|||       |+||+|||+...
T Consensus       103 ~L~~~~~~~-~l~~~~~~~i~~qi~~aL~yLH~~~iiHrDiKp~NILl~~~  152 (293)
T d1yhwa1         103 SLTDVVTET-CMDEGQIAAVCRECLQALEFLHSNQVIHRDIKSDNILLGMD  152 (293)
T ss_dssp             BHHHHHHHS-CCCHHHHHHHHHHHHHHHHHHHHTTEECCCCSGGGEEECTT
T ss_pred             cHHHHhhcc-CCCHHHHHHHHHHHHHHHHHHHHCCCcccCCcHHHeEECCC
Confidence            999988765 5999999999999999999999       999999999643



>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2j4za1 d.144.1.7 (A:126-388) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2java1 d.144.1.7 (A:3-271) Serine/threonine-protein kinase Nek2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omwa3 d.144.1.7 (A:186-549) G-protein coupled receptor kinase 2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xjda_ d.144.1.7 (A:) Protein kinase C, theta type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ua2a_ d.144.1.7 (A:) Cell division protein kinase 7, CDK7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o6la_ d.144.1.7 (A:) Pkb kinase (Akt-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} Back     information, alignment and structure
>d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} Back     information, alignment and structure
>d1fota_ d.144.1.7 (A:) cAMP-dependent PK, catalytic subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nvra_ d.144.1.7 (A:) Cell cycle checkpoint kinase chk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phka_ d.144.1.7 (A:) gamma-subunit of glycogen phosphorylase kinase (Phk) {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1tkia_ d.144.1.7 (A:) Titin, kinase domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ob3a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {(Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1gz8a_ d.144.1.7 (A:) Cyclin-dependent PK, CDK2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s9ja_ d.144.1.7 (A:) Dual specificity mitogen-activated protein kinase kinase 1, Mek1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwsa_ d.144.1.7 (A:) Proto-oncogene serine/threonine-protein kinase Pim-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1unla_ d.144.1.7 (A:) Cyclin-dependent PK, CDK5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k2pa_ d.144.1.7 (A:) Bruton's tyrosine kinase (Btk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sm2a_ d.144.1.7 (A:) Tyrosine-protein kinase Itk/Tsk {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zara2 d.144.1.9 (A:91-281) Rio2 serine protein kinase C-terminal domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1csna_ d.144.1.7 (A:) Casein kinase-1, CK1 {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1vjya_ d.144.1.7 (A:) Type I TGF-beta receptor R4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j7la_ d.144.1.6 (A:) Type IIIa 3',5"-aminoglycoside phosphotransferase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nd4a_ d.144.1.6 (A:) Aminoglycoside 3'-phosphotransferase IIa (Kanamycin kinase) {Bacteria (Klebsiella pneumoniae) [TaxId: 573]} Back     information, alignment and structure
>d2pula1 d.144.1.6 (A:5-396) Methylthioribose kinase MtnK {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure