Diaphorina citri psyllid: psy4166


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------25
MSMKYDAKADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKELLLGLLKRNAMDRISFEQLFAHPFLQPLAPHPLIPEPHAGSPVTLSPEDSTDDFVVIPNSADVVSTSPPRPSSLLLSPAPSQHVAIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTISIN
cccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHcccccccccccccHHHHHHHHHcccccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccHHHHHHHHHHHcccccEEEEEEEEEEccEEEEEEEEcccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccccccccccccc
****YDA*ADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKELLLGLLKRNAMDRISFEQLFAHPFLQPLAPHPLIPEPHAGSPVTLSPEDSTDDFVVIPNSAD*************LS*******AIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTIS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSMKYDAKADLYSVGTIVFQCLTGKAPFIANSPPQLKQYYEKNLVLVPKVPVGTSAELKELLLGLLKRNAMDRISFEQLFAHPFLQPLAPHPLIPEPHAGSPVTLSPEDSTDDFVVIPNSADVVSTSPPRPSSLLLSPAPSQHVAIKRITKKNLAKTQNFGKEINILKELTELHHENVVELLHCKESDQHVYLVMEFCNGGDLADYLVSKGTLSEDTIRIFLKLHQMLQLYFHDFTPWSFVILYTISIN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044464 [CC]cell partprobableGO:0005575, GO:0005623
GO:0050896 [BP]response to stimulusprobableGO:0008150
GO:0044763 [BP]single-organism cellular processprobableGO:0009987, GO:0008150, GO:0044699
GO:0016020 [CC]membraneprobableGO:0005575
GO:0050794 [BP]regulation of cellular processprobableGO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PHK, chain A
Confidence level:very confident
Coverage over the Query: 122-245
View the alignment between query and template
View the model in PyMOL
Template: 1PHK, chain A
Confidence level:very confident
Coverage over the Query: 3-89
View the alignment between query and template
View the model in PyMOL
Template: 4APC, chain A
Confidence level:probable
Coverage over the Query: 3-111
View the alignment between query and template
View the model in PyMOL