Diaphorina citri psyllid: psy4196

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------17
MSGLEESGIPGQNFLREALTSCTDPLKAIEEFQLDNGILLPSLRQMLPLLDLHGVRRLDFHNSVLEVEVTETLNLLLPSLRQMLPLLDLHGVRRLDFHNSVLEELRDKLVSHIKEIGQKEGRDRDRKLNEMLKKSFPLVRVKQLRPVVMAILRNTTHIDDKYLRVLVS
cccccccccccHHHHHHHHHccccHHHHHHHHHHHccccccccHHHHHHHHHccccHHcccccHHHHHHHHHHHHHcHHHHHHccccHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccHHHHHHHcc
********IPGQNFLREALTSCTDPLKAIEEFQLDNGILLPSLRQMLPLLDLHGVRRLDFHNSVLEVEVTETLNLLLPSLRQMLPLLDLHGVRRLDFHNSVLEELRDKLVSHIK*************LNEMLKKSFPLVRVKQLRPVVMAILRNTTHIDDKYLRVLVS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGLEESGIPGQNFLREALTSCTDPLKAIEEFQLDNGILLPSLRQMLPLLDLHGVRRLDFHNSVLEVEVTETLNLLLPSLRQMLPLLDLHGVRRLDFHNSVxxxxxxxxxxxxxxxxxxxxxDRDRKLNEMLKKSFPLVRVKQLRPVVMAILRNTTHIDDKYLRVLVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Negative elongation factor B Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II.confidentQ9Y113

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0034244 [BP]negative regulation of transcription elongation from RNA polymerase II promoterprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:0060255, GO:0006357, GO:0065007, GO:0048519, GO:0010468, GO:0034243, GO:0045934, GO:0019219, GO:0032784, GO:0009889, GO:0032785, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0032021 [CC]NELF complexprobableGO:0008023, GO:0031974, GO:0043229, GO:0043227, GO:0043226, GO:0005575, GO:0031981, GO:0005634, GO:0005654, GO:0044451, GO:0043234, GO:0032991, GO:0043231, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0070013, GO:0044428, GO:0044424, GO:0044422

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!