Diaphorina citri psyllid: psy4206


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------
MVFGSAHRGRLNLLTNIVHAPLVNVFSRFLPLEYTDPGDGDVKYHLGAYVKYRTPHSDKLMTLTLSSNPSHLELVYPVNLGKTKAFQFLSFRVDQKN
cCECcccccHHHHHHHHccccHHHHHHcccccccccccccccccccEEccCECccccccEEEEEEEcccccccccccEEEEEEHHHHHHcccccccc
MVFGSAHRGRLNLLTNIVHAPLVNVFSRFLPLEYTDPGDGDVKYHLGAYVKYRTPHSDKLMTLTLSSNPSHLELVYPVNLGKTKAFQFLS*******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVFGSAHRGRLNLLTNIVHAPLVNVFSRFLPLEYTDPGDGDVKYHLGAYVKYRTPHSDKLMTLTLSSNPSHLELVYPVNLGKTKAFQFLSFRVDQKN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
2-oxoglutarate dehydrogenase-like, mitochondrial confidentQ5R9L8
2-oxoglutarate dehydrogenase, mitochondrial The 2-oxoglutarate dehydrogenase complex catalyzes the overall conversion of 2-oxoglutarate to succinyl-CoA and CO(2). It contains multiple copies of three enzymatic components: 2-oxoglutarate dehydrogenase (E1), dihydrolipoamide succinyltransferase (E2) and lipoamide dehydrogenase (E3).confidentO74378

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044710 [BP]single-organism metabolic processprobableGO:0008150, GO:0008152
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0046872 [MF]metal ion bindingprobableGO:0043169, GO:0003674, GO:0005488, GO:0043167

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XT6, chain A
Confidence level:very confident
Coverage over the Query: 1-29,41-91
View the alignment between query and template
View the model in PyMOL