Diaphorina citri psyllid: psy4215


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MADGDKRRYTYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVPEVTKKLSDVTSSMVPTRIPTQST
ccccccccccccccccccccEEEEEEEEcccccccccCEEEEEEcccEEEEEcccccCECccccccccccEEEEEEEEccccccccccccccccccccccccc
MADGDKRRYTYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVP***********************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADGDKRRYTYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVPEVTKKLSDVTSSMVPTRIPTQST

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin carboxyl-terminal hydrolase 3 Hydrolase that deubiquitinates monoubiquitinated target proteins such as histone H2A and H2B. Required for proper progression through S phase and subsequent mitotic entry. May regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. Associates with the chromatin.confidentQ9Y6I4
Ubiquitin carboxyl-terminal hydrolase 3 Hydrolase that deubiquitinates monoubiquitinated target proteins such as histone H2A and H2B. Required for proper progression through S phase and subsequent mitotic entry. May regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. Associates with the chromatin.confidentQ91W36

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006281 [BP]DNA repairprobableGO:0090304, GO:0034641, GO:0006807, GO:0044699, GO:0006139, GO:0051716, GO:0044260, GO:0071704, GO:1901360, GO:0009987, GO:0006725, GO:0006974, GO:0006950, GO:0044763, GO:0008152, GO:0046483, GO:0044238, GO:0050896, GO:0044237, GO:0043170, GO:0033554, GO:0006259, GO:0008150
GO:0004843 [MF]ubiquitin-specific protease activityprobableGO:0016787, GO:0019783, GO:0003824, GO:0070011, GO:0003674, GO:0008233, GO:0008234
GO:0031647 [BP]regulation of protein stabilityprobableGO:0019222, GO:0060255, GO:0010608, GO:0050789, GO:0065007, GO:0008150, GO:0065008, GO:0010468
GO:0000278 [BP]mitotic cell cycleprobableGO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0007049
GO:0004221 [MF]ubiquitin thiolesterase activityprobableGO:0016787, GO:0003674, GO:0016790, GO:0016788, GO:0003824
GO:0000790 [CC]nuclear chromatinprobableGO:0031974, GO:0043229, GO:0043228, GO:0000785, GO:0000228, GO:0043227, GO:0043226, GO:0044446, GO:0031981, GO:0005634, GO:0044454, GO:0005694, GO:0043231, GO:0043232, GO:0043233, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0070013, GO:0044428, GO:0044424, GO:0044427, GO:0044422
GO:0042393 [MF]histone bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0016578 [BP]histone deubiquitinationprobableGO:0044699, GO:0044267, GO:0044260, GO:0006325, GO:0071840, GO:0070647, GO:0070646, GO:0016043, GO:0071704, GO:0016570, GO:0016579, GO:0009987, GO:0006464, GO:0043412, GO:0036211, GO:0044763, GO:0008152, GO:0006996, GO:0044238, GO:0051276, GO:0019538, GO:0044237, GO:0043170, GO:0008150, GO:0016568, GO:0016569
GO:0005737 [CC]cytoplasmprobableGO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Y6E, chain A
Confidence level:very confident
Coverage over the Query: 17-80
View the alignment between query and template
View the model in PyMOL