Psyllid ID: psy4215


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MADGDKRRYTYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVPEVTKKLSDVTSSMVPTRIPTQST
ccccccccccccccccccccEEEEEEEEcccccccccEEEEEEEcccEEEEEcccccEEEccccccccccEEEEEEEEccccccccccccccccccccccccc
ccccccccEEEcccccccccccHcHEEEEEEEccccccEEEEEEEccEEEEEcccccccccHHHHHHccEEEEEEEEEccccccccccccccccccccccccc
madgdkrrytyvNDTKNKRQFRFDNLLKastigvhsghYTAYAIHEaqwwhfddstvmpvdipalkkckpyILFYVRRVPEvtkklsdvtssmvptriptqst
madgdkrrytyvndtknkrqfrfdNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRvpevtkklsdvtssmvptriptqst
MADGDKRRYTYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVPEVTKKLSDVTSSMVPTRIPTQST
*********TYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVPEVT********************
MADGDKRRYTY*****NK*QFRFDNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYV***************************
MADGDKRRYTYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVPEVTKKLSDVTSSMVPTRIPTQST
***GDKRRYTYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVP***********************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADGDKRRYTYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVPEVTKKLSDVTSSMVPTRIPTQST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query103 2.2.26 [Sep-21-2011]
Q91W36520 Ubiquitin carboxyl-termin yes N/A 0.446 0.088 0.630 2e-11
Q9Y6I4520 Ubiquitin carboxyl-termin yes N/A 0.427 0.084 0.636 3e-10
Q99K46921 Ubiquitin carboxyl-termin no N/A 0.669 0.074 0.356 1e-05
Q93Y01910 Ubiquitin carboxyl-termin yes N/A 0.543 0.061 0.396 3e-05
Q9ZSB5923 Ubiquitin carboxyl-termin no N/A 0.543 0.060 0.379 3e-05
P51784963 Ubiquitin carboxyl-termin no N/A 0.504 0.053 0.375 0.0003
Q6P9L4685 Ubiquitin carboxyl-termin no N/A 0.543 0.081 0.413 0.0005
A5PMR2 897 Ubiquitin carboxyl-termin no N/A 0.543 0.062 0.379 0.0005
Q9MAQ3892 Putative ubiquitin carbox no N/A 0.388 0.044 0.476 0.0007
Q9C585871 Ubiquitin carboxyl-termin no N/A 0.708 0.083 0.313 0.0009
>sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 Back     alignment and function desciption
 Score = 68.2 bits (165), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 34/46 (73%)

Query: 33  GVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR 78
           GV SGHYTAYA+HE +W+HF+DSTV   D   + K K YILFYV R
Sbjct: 466 GVGSGHYTAYAVHEGRWFHFNDSTVTVTDEETVGKAKAYILFYVER 511




Hydrolase that deubiquitinates monoubiquitinated target proteins such as histone H2A and H2B. Required for proper progression through S phase and subsequent mitotic entry. May regulate the DNA damage response (DDR) checkpoint through deubiquitination of H2A at DNA damage sites. Associates with the chromatin.
Mus musculus (taxid: 10090)
EC: 3EC: .EC: 4EC: .EC: 1EC: 9EC: .EC: 1EC: 2
>sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 Back     alignment and function description
>sp|Q99K46|UBP11_MOUSE Ubiquitin carboxyl-terminal hydrolase 11 OS=Mus musculus GN=Usp11 PE=2 SV=4 Back     alignment and function description
>sp|Q93Y01|UBP9_ARATH Ubiquitin carboxyl-terminal hydrolase 9 OS=Arabidopsis thaliana GN=UBP9 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZSB5|UBP10_ARATH Ubiquitin carboxyl-terminal hydrolase 10 OS=Arabidopsis thaliana GN=UBP10 PE=2 SV=2 Back     alignment and function description
>sp|P51784|UBP11_HUMAN Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens GN=USP11 PE=1 SV=3 Back     alignment and function description
>sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 Back     alignment and function description
>sp|A5PMR2|UBP33_DANRE Ubiquitin carboxyl-terminal hydrolase 33 OS=Danio rerio GN=usp33 PE=2 SV=1 Back     alignment and function description
>sp|Q9MAQ3|UBP11_ARATH Putative ubiquitin carboxyl-terminal hydrolase 11 OS=Arabidopsis thaliana GN=UBP11 PE=3 SV=2 Back     alignment and function description
>sp|Q9C585|UBP8_ARATH Ubiquitin carboxyl-terminal hydrolase 8 OS=Arabidopsis thaliana GN=UBP8 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
322800426 604 hypothetical protein SINV_08883 [Solenop 0.446 0.076 0.630 5e-12
383854138 542 PREDICTED: ubiquitin carboxyl-terminal h 0.446 0.084 0.608 1e-11
66501571 541 PREDICTED: ubiquitin carboxyl-terminal h 0.446 0.085 0.608 1e-11
380013085 542 PREDICTED: ubiquitin carboxyl-terminal h 0.446 0.084 0.608 1e-11
340721026 541 PREDICTED: ubiquitin carboxyl-terminal h 0.446 0.085 0.608 1e-11
350404719 541 PREDICTED: ubiquitin carboxyl-terminal h 0.446 0.085 0.608 1e-11
30716809892 Ubiquitin carboxyl-terminal hydrolase 3 0.446 0.5 0.630 2e-11
33202286192 Ubiquitin carboxyl-terminal hydrolase 3 0.446 0.5 0.630 2e-11
405972649 479 Ubiquitin carboxyl-terminal hydrolase 3 0.533 0.114 0.581 2e-11
307204808 550 Ubiquitin carboxyl-terminal hydrolase 3 0.446 0.083 0.586 3e-11
>gi|322800426|gb|EFZ21430.1| hypothetical protein SINV_08883 [Solenopsis invicta] Back     alignment and taxonomy information
 Score = 75.1 bits (183), Expect = 5e-12,   Method: Composition-based stats.
 Identities = 29/46 (63%), Positives = 37/46 (80%)

Query: 33  GVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR 78
           G  +GHYTA+A+H+ QW+HF+DS+V P    A+ KCKPYILFYVRR
Sbjct: 551 GAGTGHYTAFAVHDGQWFHFNDSSVRPATTDAVAKCKPYILFYVRR 596




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383854138|ref|XP_003702579.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|66501571|ref|XP_392160.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380013085|ref|XP_003690600.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3-like [Apis florea] Back     alignment and taxonomy information
>gi|340721026|ref|XP_003398928.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350404719|ref|XP_003487196.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307168098|gb|EFN61396.1| Ubiquitin carboxyl-terminal hydrolase 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332022861|gb|EGI63134.1| Ubiquitin carboxyl-terminal hydrolase 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|405972649|gb|EKC37407.1| Ubiquitin carboxyl-terminal hydrolase 3 [Crassostrea gigas] Back     alignment and taxonomy information
>gi|307204808|gb|EFN83366.1| Ubiquitin carboxyl-terminal hydrolase 3 [Harpegnathos saltator] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query103
UNIPROTKB|I3LJX6137 LOC100624494 "Uncharacterized 0.446 0.335 0.630 2.8e-11
UNIPROTKB|D4A4F6483 D4A4F6 "Ubiquitin carboxyl-ter 0.446 0.095 0.630 6.5e-11
MGI|MGI:2152450520 Usp3 "ubiquitin specific pepti 0.446 0.088 0.630 7.4e-11
RGD|1308852520 Usp3 "ubiquitin specific pepti 0.446 0.088 0.630 7.4e-11
UNIPROTKB|D4A4F5521 D4A4F5 "Ubiquitin carboxyl-ter 0.446 0.088 0.630 7.5e-11
UNIPROTKB|H0YM72106 USP3 "Ubiquitin carboxyl-termi 0.427 0.415 0.636 9.4e-11
UNIPROTKB|B4DWJ6271 USP3 "Ubiquitin carboxyl-termi 0.427 0.162 0.636 1.9e-10
UNIPROTKB|E2QZQ0520 USP3 "Ubiquitin carboxyl-termi 0.446 0.088 0.630 2.6e-10
UNIPROTKB|F1NQJ6521 USP3 "Ubiquitin carboxyl-termi 0.446 0.088 0.630 2.6e-10
UNIPROTKB|F1N0I6521 USP3 "Ubiquitin carboxyl-termi 0.446 0.088 0.630 2.6e-10
UNIPROTKB|I3LJX6 LOC100624494 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
 Score = 155 (59.6 bits), Expect = 2.8e-11, P = 2.8e-11
 Identities = 29/46 (63%), Positives = 33/46 (71%)

Query:    33 GVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR 78
             GV SGHYTAYA HE +W+HF+DSTV   D   + K K YILFYV R
Sbjct:    83 GVGSGHYTAYATHEGRWFHFNDSTVTLTDEDTVVKAKAYILFYVER 128




GO:0006511 "ubiquitin-dependent protein catabolic process" evidence=IEA
GO:0004221 "ubiquitin thiolesterase activity" evidence=IEA
UNIPROTKB|D4A4F6 D4A4F6 "Ubiquitin carboxyl-terminal hydrolase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:2152450 Usp3 "ubiquitin specific peptidase 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308852 Usp3 "ubiquitin specific peptidase 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|D4A4F5 D4A4F5 "Ubiquitin carboxyl-terminal hydrolase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H0YM72 USP3 "Ubiquitin carboxyl-terminal hydrolase 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B4DWJ6 USP3 "Ubiquitin carboxyl-terminal hydrolase 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZQ0 USP3 "Ubiquitin carboxyl-terminal hydrolase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NQJ6 USP3 "Ubiquitin carboxyl-terminal hydrolase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1N0I6 USP3 "Ubiquitin carboxyl-terminal hydrolase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q91W36UBP3_MOUSE3, ., 4, ., 1, 9, ., 1, 20.63040.44660.0884yesN/A
Q9Y6I4UBP3_HUMAN3, ., 4, ., 1, 9, ., 1, 20.63630.42710.0846yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
cd02257255 cd02257, Peptidase_C19, Peptidase C19 contains ubi 2e-10
cd02674230 cd02674, Peptidase_C19R, A subfamily of peptidase 1e-09
cd02660328 cd02660, Peptidase_C19D, A subfamily of Peptidase 4e-09
pfam00443313 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrol 2e-08
cd02661304 cd02661, Peptidase_C19E, A subfamily of Peptidase 7e-08
COG5560823 COG5560, UBP12, Ubiquitin C-terminal hydrolase [Po 8e-07
cd02667279 cd02667, Peptidase_C19K, A subfamily of Peptidase 1e-05
COG5533415 COG5533, UBP5, Ubiquitin C-terminal hydrolase [Pos 2e-05
cd02668324 cd02668, Peptidase_C19L, A subfamily of Peptidase 5e-04
cd02658311 cd02658, Peptidase_C19B, A subfamily of Peptidase 0.002
cd02670241 cd02670, Peptidase_C19N, A subfamily of Peptidase 0.002
cd02659334 cd02659, peptidase_C19C, A subfamily of Peptidase 0.003
>gnl|CDD|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases Back     alignment and domain information
 Score = 55.2 bits (133), Expect = 2e-10
 Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 7/50 (14%)

Query: 34  VHSGHYTAYAIHEA--QWWHFDDSTVMPVDI-----PALKKCKPYILFYV 76
             SGHY AY    +  +W+ F+D  V  V               YILFY 
Sbjct: 206 ADSGHYVAYVKDPSDGKWYKFNDDKVTEVSEEEVLEFGSLSSSAYILFYE 255


They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome. Length = 255

>gnl|CDD|239139 cd02674, Peptidase_C19R, A subfamily of peptidase C19 Back     alignment and domain information
>gnl|CDD|239125 cd02660, Peptidase_C19D, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|215922 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrolase Back     alignment and domain information
>gnl|CDD|239126 cd02661, Peptidase_C19E, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|227847 COG5560, UBP12, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239132 cd02667, Peptidase_C19K, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|227820 COG5533, UBP5, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239133 cd02668, Peptidase_C19L, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|239123 cd02658, Peptidase_C19B, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|239135 cd02670, Peptidase_C19N, A subfamily of Peptidase C19 Back     alignment and domain information
>gnl|CDD|239124 cd02659, peptidase_C19C, A subfamily of Peptidase C19 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 103
KOG1865|consensus 545 99.82
cd02667279 Peptidase_C19K A subfamily of Peptidase C19. Pepti 99.8
cd02663300 Peptidase_C19G A subfamily of Peptidase C19. Pepti 99.8
cd02673245 Peptidase_C19Q A subfamily of Peptidase C19. Pepti 99.79
cd02664327 Peptidase_C19H A subfamily of Peptidase C19. Pepti 99.79
cd02657305 Peptidase_C19A A subfamily of Peptidase C19. Pepti 99.78
cd02658311 Peptidase_C19B A subfamily of Peptidase C19. Pepti 99.78
cd02662240 Peptidase_C19F A subfamily of Peptidase C19. Pepti 99.78
cd02659334 peptidase_C19C A subfamily of Peptidase C19. Pepti 99.77
cd02661304 Peptidase_C19E A subfamily of Peptidase C19. Pepti 99.77
PF00443269 UCH: Ubiquitin carboxyl-terminal hydrolase; InterP 99.76
cd02660328 Peptidase_C19D A subfamily of Peptidase C19. Pepti 99.76
cd02665228 Peptidase_C19I A subfamily of Peptidase C19. Pepti 99.75
cd02674230 Peptidase_C19R A subfamily of peptidase C19. Pepti 99.75
cd02668324 Peptidase_C19L A subfamily of Peptidase C19. Pepti 99.75
cd02669440 Peptidase_C19M A subfamily of Peptidase C19. Pepti 99.74
cd02670241 Peptidase_C19N A subfamily of Peptidase C19. Pepti 99.74
cd02257255 Peptidase_C19 Peptidase C19 contains ubiquitinyl h 99.72
KOG1867|consensus492 99.71
cd02671332 Peptidase_C19O A subfamily of Peptidase C19. Pepti 99.7
COG5560823 UBP12 Ubiquitin C-terminal hydrolase [Posttranslat 99.69
KOG1868|consensus653 99.67
cd02672268 Peptidase_C19P A subfamily of Peptidase C19. Pepti 99.66
KOG1870|consensus842 99.61
cd02666343 Peptidase_C19J A subfamily of Peptidase C19. Pepti 99.58
COG5533415 UBP5 Ubiquitin C-terminal hydrolase [Posttranslati 99.57
KOG1866|consensus 944 99.55
COG5077 1089 Ubiquitin carboxyl-terminal hydrolase [Posttransla 99.46
KOG0944|consensus763 99.44
KOG1864|consensus587 99.42
KOG4598|consensus 1203 99.35
KOG1873|consensus877 99.35
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 99.22
KOG1872|consensus473 99.2
PF13423295 UCH_1: Ubiquitin carboxyl-terminal hydrolase 98.73
KOG1871|consensus420 98.66
KOG1863|consensus 1093 98.55
KOG1275|consensus 1118 97.74
KOG2026|consensus442 96.78
PF15499275 Peptidase_C98: Ubiquitin-specific peptidase-like, 93.62
PF05408193 Peptidase_C28: Foot-and-mouth virus L-proteinase; 91.89
PF0147319 CW_binding_1: Putative cell wall binding repeat; I 80.87
>KOG1865|consensus Back     alignment and domain information
Probab=99.82  E-value=3.2e-20  Score=149.20  Aligned_cols=70  Identities=30%  Similarity=0.612  Sum_probs=65.4

Q ss_pred             eeeeeCCC-CCcceEEeEEEEEeeCCCCCceEEEEEEc-CCeEEEEcCCeeeEeCcccccCCCcEEEEEEec
Q psy4215           9 YTYVNDTK-NKRQFRFDNLLKASTIGVHSGHYTAYAIH-EAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR   78 (103)
Q Consensus         9 ~~~~~~~~-~~~~Y~L~avv~H~G~~~~~GHY~~~~~~-~~~W~~~dD~~V~~~~~~~v~~~~aYiLfY~r~   78 (103)
                      =|||+.+. ....|.|+|||+|.|....+|||++|||. +|.||+|||+.|+.++.+.|.+.+||||||.|+
T Consensus       339 ~PyMS~~~e~s~~Y~LYavlVH~g~~~~~GHY~cYvks~~g~Wy~~DDS~V~~~~~~~VLsq~AYmLfY~R~  410 (545)
T KOG1865|consen  339 QPYMSQPNEGSTVYKLYAVLVHLGTSCHSGHYFCYVKSQNGQWYKMDDSEVTQSSIESVLSQQAYILFYARK  410 (545)
T ss_pred             cccccCCCCCCceEEEEEEEEeccccccCCceEEEEEcCCCceEEccCceeeeccccceecccceEEEEEee
Confidence            47888666 46889999999999988999999999999 889999999999999999999999999999997



>cd02667 Peptidase_C19K A subfamily of Peptidase C19 Back     alignment and domain information
>cd02663 Peptidase_C19G A subfamily of Peptidase C19 Back     alignment and domain information
>cd02673 Peptidase_C19Q A subfamily of Peptidase C19 Back     alignment and domain information
>cd02664 Peptidase_C19H A subfamily of Peptidase C19 Back     alignment and domain information
>cd02657 Peptidase_C19A A subfamily of Peptidase C19 Back     alignment and domain information
>cd02658 Peptidase_C19B A subfamily of Peptidase C19 Back     alignment and domain information
>cd02662 Peptidase_C19F A subfamily of Peptidase C19 Back     alignment and domain information
>cd02659 peptidase_C19C A subfamily of Peptidase C19 Back     alignment and domain information
>cd02661 Peptidase_C19E A subfamily of Peptidase C19 Back     alignment and domain information
>PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>cd02660 Peptidase_C19D A subfamily of Peptidase C19 Back     alignment and domain information
>cd02665 Peptidase_C19I A subfamily of Peptidase C19 Back     alignment and domain information
>cd02674 Peptidase_C19R A subfamily of peptidase C19 Back     alignment and domain information
>cd02668 Peptidase_C19L A subfamily of Peptidase C19 Back     alignment and domain information
>cd02669 Peptidase_C19M A subfamily of Peptidase C19 Back     alignment and domain information
>cd02670 Peptidase_C19N A subfamily of Peptidase C19 Back     alignment and domain information
>cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases Back     alignment and domain information
>KOG1867|consensus Back     alignment and domain information
>cd02671 Peptidase_C19O A subfamily of Peptidase C19 Back     alignment and domain information
>COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1868|consensus Back     alignment and domain information
>cd02672 Peptidase_C19P A subfamily of Peptidase C19 Back     alignment and domain information
>KOG1870|consensus Back     alignment and domain information
>cd02666 Peptidase_C19J A subfamily of Peptidase C19 Back     alignment and domain information
>COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1866|consensus Back     alignment and domain information
>COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0944|consensus Back     alignment and domain information
>KOG1864|consensus Back     alignment and domain information
>KOG4598|consensus Back     alignment and domain information
>KOG1873|consensus Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1872|consensus Back     alignment and domain information
>PF13423 UCH_1: Ubiquitin carboxyl-terminal hydrolase Back     alignment and domain information
>KOG1871|consensus Back     alignment and domain information
>KOG1863|consensus Back     alignment and domain information
>KOG1275|consensus Back     alignment and domain information
>KOG2026|consensus Back     alignment and domain information
>PF15499 Peptidase_C98: Ubiquitin-specific peptidase-like, SUMO isopeptidase Back     alignment and domain information
>PF05408 Peptidase_C28: Foot-and-mouth virus L-proteinase; InterPro: IPR008739 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PF01473 CW_binding_1: Putative cell wall binding repeat; InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
2y6e_A367 Ubiquitin Specific Protease 4 Is Inhibited By Its U 9e-04
>pdb|2Y6E|A Chain A, Ubiquitin Specific Protease 4 Is Inhibited By Its Ubiquitin- Like Domain Length = 367 Back     alignment and structure

Iteration: 1

Score = 38.5 bits (88), Expect = 9e-04, Method: Compositional matrix adjust. Identities = 23/57 (40%), Positives = 31/57 (54%), Gaps = 4/57 (7%) Query: 30 STIGVHSGHYTAYAIHE--AQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVPEVTK 84 +GV GHYTAYA ++ +W++FDDS V + Y+LFY RR E K Sbjct: 310 GAMGV--GHYTAYAKNKLNGKWYYFDDSNVSLASEDQIVTKAAYVLFYQRRDDEFYK 364

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query103
3mhs_A476 Ubiquitin carboxyl-terminal hydrolase 8; multi-pro 6e-15
3nhe_A348 Ubiquitin carboxyl-terminal hydrolase 2; cysteine 1e-14
2y6e_A367 Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2e-14
3i3t_A355 Ubiquitin carboxyl-terminal hydrolase 21; hydrolas 3e-14
2gfo_A396 Ubiquitin carboxyl-terminal hydrolase 8; protease, 4e-13
2ayn_A404 Ubiquitin carboxyl-terminal hydrolase 14; deubiqui 1e-12
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 6e-11
1nb8_A353 Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub 4e-08
2f1z_A522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 1e-07
1vjv_A415 Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, 2e-06
>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 3m99_A Length = 476 Back     alignment and structure
 Score = 67.7 bits (165), Expect = 6e-15
 Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)

Query: 33  GVHSGHYTAYA-IHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR 78
            V+ GHY A+  I   QW+ F+DS V  +    + K + Y+LFY  R
Sbjct: 427 TVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIR 473


>3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} PDB: 2hd5_A 2ibi_A Length = 348 Back     alignment and structure
>2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} Length = 367 Back     alignment and structure
>3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} PDB: 2y5b_A 3mtn_A Length = 355 Back     alignment and structure
>2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A Length = 396 Back     alignment and structure
>2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Length = 404 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Length = 353 Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 Back     alignment and structure
>1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 Length = 415 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
3nhe_A348 Ubiquitin carboxyl-terminal hydrolase 2; cysteine 99.86
3i3t_A355 Ubiquitin carboxyl-terminal hydrolase 21; hydrolas 99.86
2y6e_A367 Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 99.85
2ayn_A404 Ubiquitin carboxyl-terminal hydrolase 14; deubiqui 99.83
1vjv_A415 Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, 99.82
2gfo_A396 Ubiquitin carboxyl-terminal hydrolase 8; protease, 99.82
1nb8_A353 Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub 99.82
3mhs_A476 Ubiquitin carboxyl-terminal hydrolase 8; multi-pro 99.8
2f1z_A522 Ubiquitin carboxyl-terminal hydrolase 7; hausp, US 99.79
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 99.73
2vhf_A374 Ubiquitin carboxyl-terminal hydrolase CYLD; cytoki 98.42
>3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} SCOP: d.3.1.9 PDB: 2hd5_A 3v6c_A 3v6e_A 2ibi_A Back     alignment and structure
Probab=99.86  E-value=8.4e-22  Score=146.49  Aligned_cols=70  Identities=27%  Similarity=0.600  Sum_probs=62.6

Q ss_pred             eeeCCCCCcceEEeEEEEEeeCCCCCceEEEEEEc--CCeEEEEcCCeeeEeCcccccCCCcEEEEEEecCCc
Q psy4215          11 YVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIH--EAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVPE   81 (103)
Q Consensus        11 ~~~~~~~~~~Y~L~avv~H~G~~~~~GHY~~~~~~--~~~W~~~dD~~V~~~~~~~v~~~~aYiLfY~r~~~~   81 (103)
                      |+........|+|+|||+|.| +.++|||++|+|.  ++.|++|||+.|++++.++|...+||||||+|++.+
T Consensus       274 ~~~~~~~~~~Y~L~avv~H~G-~~~~GHY~~~~~~~~~~~W~~~nD~~V~~v~~~~v~~~~aY~LfY~r~~~~  345 (348)
T 3nhe_A          274 FASENTNHAVYNLYAVSNHSG-TTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPP  345 (348)
T ss_dssp             GBCTTCCCCEEEEEEEEEEEE-CSSCEEEEEEEECTTTCCEEEEETTEEEEECGGGTCCTTEEEEEEEECC--
T ss_pred             hcCCCCCCCcEEEEEEEEccC-CCCCcccEEEEccCCCCcEEEEeCCCceECCHHHcCCCCceEEEEEecCCC
Confidence            445556678899999999999 7899999999998  789999999999999999999999999999999865



>3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} SCOP: d.3.1.0 PDB: 2y5b_A 3mtn_A Back     alignment and structure
>2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} Back     alignment and structure
>2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Back     alignment and structure
>1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 Back     alignment and structure
>2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A Back     alignment and structure
>1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Back     alignment and structure
>3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A Back     alignment and structure
>2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>2vhf_A Ubiquitin carboxyl-terminal hydrolase CYLD; cytokine signalling, linkage specificity, deubiquitinating enzyme, Lys63- linked, anti-oncogene; 2.8A {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 103
d2gfoa1348 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal h 1e-11
d2hd5a1336 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hy 1e-11
d2ayna1383 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hy 4e-10
d1vjva_397 d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 4e-10
d1nbfa_347 d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 8e-08
>d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Ubiquitin carboxyl-terminal hydrolase, UCH
domain: Ubiquitin carboxyl-terminal hydrolase 8
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 57.0 bits (136), Expect = 1e-11
 Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 2/47 (4%)

Query: 33  GVHSGHYTAYAIHEA--QWWHFDDSTVMPVDIPALKKCKPYILFYVR 77
           G+  GHYTAY  + A  +W+ FDD  V  + + ++K    YILFY  
Sbjct: 301 GLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTS 347


>d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 336 Back     information, alignment and structure
>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 397 Back     information, alignment and structure
>d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query103
d2hd5a1336 Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Hum 99.87
d1vjva_397 Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y 99.86
d2gfoa1348 Ubiquitin carboxyl-terminal hydrolase 8 {Human (Ho 99.85
d2ayna1383 Ubiquitin carboxyl-terminal hydrolase 14 {Human (H 99.84
d1nbfa_347 Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAU 99.83
>d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Cysteine proteinases
superfamily: Cysteine proteinases
family: Ubiquitin carboxyl-terminal hydrolase, UCH
domain: Ubiquitin carboxyl-terminal hydrolase 2, USP2
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87  E-value=2.2e-22  Score=144.63  Aligned_cols=68  Identities=26%  Similarity=0.587  Sum_probs=61.9

Q ss_pred             eeeeCCCCCcceEEeEEEEEeeCCCCCceEEEEEEc--CCeEEEEcCCeeeEeCcccccCCCcEEEEEEec
Q psy4215          10 TYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIH--EAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR   78 (103)
Q Consensus        10 ~~~~~~~~~~~Y~L~avv~H~G~~~~~GHY~~~~~~--~~~W~~~dD~~V~~~~~~~v~~~~aYiLfY~r~   78 (103)
                      ++.....+..+|+|+|||+|.| ++++|||++|+|+  +++|++|||+.|++++.++|...+||||||+|.
T Consensus       267 ~~~~~~~~~~~Y~L~~vi~H~G-~~~~GHY~~~ik~~~~~~W~~~nD~~V~~v~~~~v~~~~aYiL~Y~r~  336 (336)
T d2hd5a1         267 EFASENTNHAVYNLYAVSNHSG-TTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELA  336 (336)
T ss_dssp             GGBSSSSCCCEEEEEEEEEEEE-CSSCEEEEEEEECTTTCCEEEEETTEEEEECGGGSCCTTEEEEEEEEC
T ss_pred             ccccCCCCCCeEeEEEEEEEeC-CCCCceEEEEEEcCCCCeEEEEECCceeECCHHHhccCCCEEEEEEcC
Confidence            4456666778999999999999 7899999999997  679999999999999999999999999999983



>d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure