Psyllid ID: psy4215
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| 322800426 | 604 | hypothetical protein SINV_08883 [Solenop | 0.446 | 0.076 | 0.630 | 5e-12 | |
| 383854138 | 542 | PREDICTED: ubiquitin carboxyl-terminal h | 0.446 | 0.084 | 0.608 | 1e-11 | |
| 66501571 | 541 | PREDICTED: ubiquitin carboxyl-terminal h | 0.446 | 0.085 | 0.608 | 1e-11 | |
| 380013085 | 542 | PREDICTED: ubiquitin carboxyl-terminal h | 0.446 | 0.084 | 0.608 | 1e-11 | |
| 340721026 | 541 | PREDICTED: ubiquitin carboxyl-terminal h | 0.446 | 0.085 | 0.608 | 1e-11 | |
| 350404719 | 541 | PREDICTED: ubiquitin carboxyl-terminal h | 0.446 | 0.085 | 0.608 | 1e-11 | |
| 307168098 | 92 | Ubiquitin carboxyl-terminal hydrolase 3 | 0.446 | 0.5 | 0.630 | 2e-11 | |
| 332022861 | 92 | Ubiquitin carboxyl-terminal hydrolase 3 | 0.446 | 0.5 | 0.630 | 2e-11 | |
| 405972649 | 479 | Ubiquitin carboxyl-terminal hydrolase 3 | 0.533 | 0.114 | 0.581 | 2e-11 | |
| 307204808 | 550 | Ubiquitin carboxyl-terminal hydrolase 3 | 0.446 | 0.083 | 0.586 | 3e-11 |
| >gi|322800426|gb|EFZ21430.1| hypothetical protein SINV_08883 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 75.1 bits (183), Expect = 5e-12, Method: Composition-based stats.
Identities = 29/46 (63%), Positives = 37/46 (80%)
Query: 33 GVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR 78
G +GHYTA+A+H+ QW+HF+DS+V P A+ KCKPYILFYVRR
Sbjct: 551 GAGTGHYTAFAVHDGQWFHFNDSSVRPATTDAVAKCKPYILFYVRR 596
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|383854138|ref|XP_003702579.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|66501571|ref|XP_392160.2| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|380013085|ref|XP_003690600.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3-like [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|340721026|ref|XP_003398928.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350404719|ref|XP_003487196.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 3-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307168098|gb|EFN61396.1| Ubiquitin carboxyl-terminal hydrolase 3 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332022861|gb|EGI63134.1| Ubiquitin carboxyl-terminal hydrolase 3 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|405972649|gb|EKC37407.1| Ubiquitin carboxyl-terminal hydrolase 3 [Crassostrea gigas] | Back alignment and taxonomy information |
|---|
| >gi|307204808|gb|EFN83366.1| Ubiquitin carboxyl-terminal hydrolase 3 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 103 | ||||||
| UNIPROTKB|I3LJX6 | 137 | LOC100624494 "Uncharacterized | 0.446 | 0.335 | 0.630 | 2.8e-11 | |
| UNIPROTKB|D4A4F6 | 483 | D4A4F6 "Ubiquitin carboxyl-ter | 0.446 | 0.095 | 0.630 | 6.5e-11 | |
| MGI|MGI:2152450 | 520 | Usp3 "ubiquitin specific pepti | 0.446 | 0.088 | 0.630 | 7.4e-11 | |
| RGD|1308852 | 520 | Usp3 "ubiquitin specific pepti | 0.446 | 0.088 | 0.630 | 7.4e-11 | |
| UNIPROTKB|D4A4F5 | 521 | D4A4F5 "Ubiquitin carboxyl-ter | 0.446 | 0.088 | 0.630 | 7.5e-11 | |
| UNIPROTKB|H0YM72 | 106 | USP3 "Ubiquitin carboxyl-termi | 0.427 | 0.415 | 0.636 | 9.4e-11 | |
| UNIPROTKB|B4DWJ6 | 271 | USP3 "Ubiquitin carboxyl-termi | 0.427 | 0.162 | 0.636 | 1.9e-10 | |
| UNIPROTKB|E2QZQ0 | 520 | USP3 "Ubiquitin carboxyl-termi | 0.446 | 0.088 | 0.630 | 2.6e-10 | |
| UNIPROTKB|F1NQJ6 | 521 | USP3 "Ubiquitin carboxyl-termi | 0.446 | 0.088 | 0.630 | 2.6e-10 | |
| UNIPROTKB|F1N0I6 | 521 | USP3 "Ubiquitin carboxyl-termi | 0.446 | 0.088 | 0.630 | 2.6e-10 |
| UNIPROTKB|I3LJX6 LOC100624494 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 155 (59.6 bits), Expect = 2.8e-11, P = 2.8e-11
Identities = 29/46 (63%), Positives = 33/46 (71%)
Query: 33 GVHSGHYTAYAIHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR 78
GV SGHYTAYA HE +W+HF+DSTV D + K K YILFYV R
Sbjct: 83 GVGSGHYTAYATHEGRWFHFNDSTVTLTDEDTVVKAKAYILFYVER 128
|
|
| UNIPROTKB|D4A4F6 D4A4F6 "Ubiquitin carboxyl-terminal hydrolase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2152450 Usp3 "ubiquitin specific peptidase 3" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308852 Usp3 "ubiquitin specific peptidase 3" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A4F5 D4A4F5 "Ubiquitin carboxyl-terminal hydrolase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YM72 USP3 "Ubiquitin carboxyl-terminal hydrolase 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|B4DWJ6 USP3 "Ubiquitin carboxyl-terminal hydrolase 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QZQ0 USP3 "Ubiquitin carboxyl-terminal hydrolase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NQJ6 USP3 "Ubiquitin carboxyl-terminal hydrolase" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N0I6 USP3 "Ubiquitin carboxyl-terminal hydrolase" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| cd02257 | 255 | cd02257, Peptidase_C19, Peptidase C19 contains ubi | 2e-10 | |
| cd02674 | 230 | cd02674, Peptidase_C19R, A subfamily of peptidase | 1e-09 | |
| cd02660 | 328 | cd02660, Peptidase_C19D, A subfamily of Peptidase | 4e-09 | |
| pfam00443 | 313 | pfam00443, UCH, Ubiquitin carboxyl-terminal hydrol | 2e-08 | |
| cd02661 | 304 | cd02661, Peptidase_C19E, A subfamily of Peptidase | 7e-08 | |
| COG5560 | 823 | COG5560, UBP12, Ubiquitin C-terminal hydrolase [Po | 8e-07 | |
| cd02667 | 279 | cd02667, Peptidase_C19K, A subfamily of Peptidase | 1e-05 | |
| COG5533 | 415 | COG5533, UBP5, Ubiquitin C-terminal hydrolase [Pos | 2e-05 | |
| cd02668 | 324 | cd02668, Peptidase_C19L, A subfamily of Peptidase | 5e-04 | |
| cd02658 | 311 | cd02658, Peptidase_C19B, A subfamily of Peptidase | 0.002 | |
| cd02670 | 241 | cd02670, Peptidase_C19N, A subfamily of Peptidase | 0.002 | |
| cd02659 | 334 | cd02659, peptidase_C19C, A subfamily of Peptidase | 0.003 |
| >gnl|CDD|239072 cd02257, Peptidase_C19, Peptidase C19 contains ubiquitinyl hydrolases | Back alignment and domain information |
|---|
Score = 55.2 bits (133), Expect = 2e-10
Identities = 16/50 (32%), Positives = 20/50 (40%), Gaps = 7/50 (14%)
Query: 34 VHSGHYTAYAIHEA--QWWHFDDSTVMPVDI-----PALKKCKPYILFYV 76
SGHY AY + +W+ F+D V V YILFY
Sbjct: 206 ADSGHYVAYVKDPSDGKWYKFNDDKVTEVSEEEVLEFGSLSSSAYILFYE 255
|
They are intracellular peptidases that remove ubiquitin molecules from polyubiquinated peptides by cleavage of isopeptide bonds. They hydrolyse bonds involving the carboxyl group of the C-terminal Gly residue of ubiquitin The purpose of the de-ubiquitination is thought to be editing of the ubiquitin conjugates, which could rescue them from degradation, as well as recycling of the ubiquitin. The ubiquitin/proteasome system is responsible for most protein turnover in the mammalian cell, and with over 50 members, family C19 is one of the largest families of peptidases in the human genome. Length = 255 |
| >gnl|CDD|239139 cd02674, Peptidase_C19R, A subfamily of peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239125 cd02660, Peptidase_C19D, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|215922 pfam00443, UCH, Ubiquitin carboxyl-terminal hydrolase | Back alignment and domain information |
|---|
| >gnl|CDD|239126 cd02661, Peptidase_C19E, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|227847 COG5560, UBP12, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239132 cd02667, Peptidase_C19K, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|227820 COG5533, UBP5, Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >gnl|CDD|239133 cd02668, Peptidase_C19L, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239123 cd02658, Peptidase_C19B, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239135 cd02670, Peptidase_C19N, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >gnl|CDD|239124 cd02659, peptidase_C19C, A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| KOG1865|consensus | 545 | 99.82 | ||
| cd02667 | 279 | Peptidase_C19K A subfamily of Peptidase C19. Pepti | 99.8 | |
| cd02663 | 300 | Peptidase_C19G A subfamily of Peptidase C19. Pepti | 99.8 | |
| cd02673 | 245 | Peptidase_C19Q A subfamily of Peptidase C19. Pepti | 99.79 | |
| cd02664 | 327 | Peptidase_C19H A subfamily of Peptidase C19. Pepti | 99.79 | |
| cd02657 | 305 | Peptidase_C19A A subfamily of Peptidase C19. Pepti | 99.78 | |
| cd02658 | 311 | Peptidase_C19B A subfamily of Peptidase C19. Pepti | 99.78 | |
| cd02662 | 240 | Peptidase_C19F A subfamily of Peptidase C19. Pepti | 99.78 | |
| cd02659 | 334 | peptidase_C19C A subfamily of Peptidase C19. Pepti | 99.77 | |
| cd02661 | 304 | Peptidase_C19E A subfamily of Peptidase C19. Pepti | 99.77 | |
| PF00443 | 269 | UCH: Ubiquitin carboxyl-terminal hydrolase; InterP | 99.76 | |
| cd02660 | 328 | Peptidase_C19D A subfamily of Peptidase C19. Pepti | 99.76 | |
| cd02665 | 228 | Peptidase_C19I A subfamily of Peptidase C19. Pepti | 99.75 | |
| cd02674 | 230 | Peptidase_C19R A subfamily of peptidase C19. Pepti | 99.75 | |
| cd02668 | 324 | Peptidase_C19L A subfamily of Peptidase C19. Pepti | 99.75 | |
| cd02669 | 440 | Peptidase_C19M A subfamily of Peptidase C19. Pepti | 99.74 | |
| cd02670 | 241 | Peptidase_C19N A subfamily of Peptidase C19. Pepti | 99.74 | |
| cd02257 | 255 | Peptidase_C19 Peptidase C19 contains ubiquitinyl h | 99.72 | |
| KOG1867|consensus | 492 | 99.71 | ||
| cd02671 | 332 | Peptidase_C19O A subfamily of Peptidase C19. Pepti | 99.7 | |
| COG5560 | 823 | UBP12 Ubiquitin C-terminal hydrolase [Posttranslat | 99.69 | |
| KOG1868|consensus | 653 | 99.67 | ||
| cd02672 | 268 | Peptidase_C19P A subfamily of Peptidase C19. Pepti | 99.66 | |
| KOG1870|consensus | 842 | 99.61 | ||
| cd02666 | 343 | Peptidase_C19J A subfamily of Peptidase C19. Pepti | 99.58 | |
| COG5533 | 415 | UBP5 Ubiquitin C-terminal hydrolase [Posttranslati | 99.57 | |
| KOG1866|consensus | 944 | 99.55 | ||
| COG5077 | 1089 | Ubiquitin carboxyl-terminal hydrolase [Posttransla | 99.46 | |
| KOG0944|consensus | 763 | 99.44 | ||
| KOG1864|consensus | 587 | 99.42 | ||
| KOG4598|consensus | 1203 | 99.35 | ||
| KOG1873|consensus | 877 | 99.35 | ||
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 99.22 | |
| KOG1872|consensus | 473 | 99.2 | ||
| PF13423 | 295 | UCH_1: Ubiquitin carboxyl-terminal hydrolase | 98.73 | |
| KOG1871|consensus | 420 | 98.66 | ||
| KOG1863|consensus | 1093 | 98.55 | ||
| KOG1275|consensus | 1118 | 97.74 | ||
| KOG2026|consensus | 442 | 96.78 | ||
| PF15499 | 275 | Peptidase_C98: Ubiquitin-specific peptidase-like, | 93.62 | |
| PF05408 | 193 | Peptidase_C28: Foot-and-mouth virus L-proteinase; | 91.89 | |
| PF01473 | 19 | CW_binding_1: Putative cell wall binding repeat; I | 80.87 |
| >KOG1865|consensus | Back alignment and domain information |
|---|
Probab=99.82 E-value=3.2e-20 Score=149.20 Aligned_cols=70 Identities=30% Similarity=0.612 Sum_probs=65.4
Q ss_pred eeeeeCCC-CCcceEEeEEEEEeeCCCCCceEEEEEEc-CCeEEEEcCCeeeEeCcccccCCCcEEEEEEec
Q psy4215 9 YTYVNDTK-NKRQFRFDNLLKASTIGVHSGHYTAYAIH-EAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR 78 (103)
Q Consensus 9 ~~~~~~~~-~~~~Y~L~avv~H~G~~~~~GHY~~~~~~-~~~W~~~dD~~V~~~~~~~v~~~~aYiLfY~r~ 78 (103)
=|||+.+. ....|.|+|||+|.|....+|||++|||. +|.||+|||+.|+.++.+.|.+.+||||||.|+
T Consensus 339 ~PyMS~~~e~s~~Y~LYavlVH~g~~~~~GHY~cYvks~~g~Wy~~DDS~V~~~~~~~VLsq~AYmLfY~R~ 410 (545)
T KOG1865|consen 339 QPYMSQPNEGSTVYKLYAVLVHLGTSCHSGHYFCYVKSQNGQWYKMDDSEVTQSSIESVLSQQAYILFYARK 410 (545)
T ss_pred cccccCCCCCCceEEEEEEEEeccccccCCceEEEEEcCCCceEEccCceeeeccccceecccceEEEEEee
Confidence 47888666 46889999999999988999999999999 889999999999999999999999999999997
|
|
| >cd02667 Peptidase_C19K A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02663 Peptidase_C19G A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02673 Peptidase_C19Q A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02664 Peptidase_C19H A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02657 Peptidase_C19A A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02658 Peptidase_C19B A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02662 Peptidase_C19F A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02659 peptidase_C19C A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02661 Peptidase_C19E A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >PF00443 UCH: Ubiquitin carboxyl-terminal hydrolase; InterPro: IPR001394 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >cd02660 Peptidase_C19D A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02665 Peptidase_C19I A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02674 Peptidase_C19R A subfamily of peptidase C19 | Back alignment and domain information |
|---|
| >cd02668 Peptidase_C19L A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02669 Peptidase_C19M A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02670 Peptidase_C19N A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >cd02257 Peptidase_C19 Peptidase C19 contains ubiquitinyl hydrolases | Back alignment and domain information |
|---|
| >KOG1867|consensus | Back alignment and domain information |
|---|
| >cd02671 Peptidase_C19O A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >COG5560 UBP12 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1868|consensus | Back alignment and domain information |
|---|
| >cd02672 Peptidase_C19P A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >KOG1870|consensus | Back alignment and domain information |
|---|
| >cd02666 Peptidase_C19J A subfamily of Peptidase C19 | Back alignment and domain information |
|---|
| >COG5533 UBP5 Ubiquitin C-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1866|consensus | Back alignment and domain information |
|---|
| >COG5077 Ubiquitin carboxyl-terminal hydrolase [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0944|consensus | Back alignment and domain information |
|---|
| >KOG1864|consensus | Back alignment and domain information |
|---|
| >KOG4598|consensus | Back alignment and domain information |
|---|
| >KOG1873|consensus | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1872|consensus | Back alignment and domain information |
|---|
| >PF13423 UCH_1: Ubiquitin carboxyl-terminal hydrolase | Back alignment and domain information |
|---|
| >KOG1871|consensus | Back alignment and domain information |
|---|
| >KOG1863|consensus | Back alignment and domain information |
|---|
| >KOG1275|consensus | Back alignment and domain information |
|---|
| >KOG2026|consensus | Back alignment and domain information |
|---|
| >PF15499 Peptidase_C98: Ubiquitin-specific peptidase-like, SUMO isopeptidase | Back alignment and domain information |
|---|
| >PF05408 Peptidase_C28: Foot-and-mouth virus L-proteinase; InterPro: IPR008739 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families | Back alignment and domain information |
|---|
| >PF01473 CW_binding_1: Putative cell wall binding repeat; InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 103 | ||||
| 2y6e_A | 367 | Ubiquitin Specific Protease 4 Is Inhibited By Its U | 9e-04 |
| >pdb|2Y6E|A Chain A, Ubiquitin Specific Protease 4 Is Inhibited By Its Ubiquitin- Like Domain Length = 367 | Back alignment and structure |
|
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 103 | |||
| 3mhs_A | 476 | Ubiquitin carboxyl-terminal hydrolase 8; multi-pro | 6e-15 | |
| 3nhe_A | 348 | Ubiquitin carboxyl-terminal hydrolase 2; cysteine | 1e-14 | |
| 2y6e_A | 367 | Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; | 2e-14 | |
| 3i3t_A | 355 | Ubiquitin carboxyl-terminal hydrolase 21; hydrolas | 3e-14 | |
| 2gfo_A | 396 | Ubiquitin carboxyl-terminal hydrolase 8; protease, | 4e-13 | |
| 2ayn_A | 404 | Ubiquitin carboxyl-terminal hydrolase 14; deubiqui | 1e-12 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 6e-11 | |
| 1nb8_A | 353 | Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub | 4e-08 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 1e-07 | |
| 1vjv_A | 415 | Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, | 2e-06 |
| >3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 3m99_A Length = 476 | Back alignment and structure |
|---|
Score = 67.7 bits (165), Expect = 6e-15
Identities = 18/47 (38%), Positives = 26/47 (55%), Gaps = 1/47 (2%)
Query: 33 GVHSGHYTAYA-IHEAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR 78
V+ GHY A+ I QW+ F+DS V + + K + Y+LFY R
Sbjct: 427 TVNEGHYIAFCKISGGQWFKFNDSMVSSISQEEVLKEQAYLLFYTIR 473
|
| >3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} PDB: 2hd5_A 2ibi_A Length = 348 | Back alignment and structure |
|---|
| >2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} Length = 367 | Back alignment and structure |
|---|
| >3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} PDB: 2y5b_A 3mtn_A Length = 355 | Back alignment and structure |
|---|
| >2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A Length = 396 | Back alignment and structure |
|---|
| >2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A Length = 404 | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 | Back alignment and structure |
|---|
| >1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A Length = 353 | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} Length = 522 | Back alignment and structure |
|---|
| >1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 Length = 415 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| 3nhe_A | 348 | Ubiquitin carboxyl-terminal hydrolase 2; cysteine | 99.86 | |
| 3i3t_A | 355 | Ubiquitin carboxyl-terminal hydrolase 21; hydrolas | 99.86 | |
| 2y6e_A | 367 | Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; | 99.85 | |
| 2ayn_A | 404 | Ubiquitin carboxyl-terminal hydrolase 14; deubiqui | 99.83 | |
| 1vjv_A | 415 | Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, | 99.82 | |
| 2gfo_A | 396 | Ubiquitin carboxyl-terminal hydrolase 8; protease, | 99.82 | |
| 1nb8_A | 353 | Ubiquitin carboxyl-terminal hydrolase 7; UBP, deub | 99.82 | |
| 3mhs_A | 476 | Ubiquitin carboxyl-terminal hydrolase 8; multi-pro | 99.8 | |
| 2f1z_A | 522 | Ubiquitin carboxyl-terminal hydrolase 7; hausp, US | 99.79 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 99.73 | |
| 2vhf_A | 374 | Ubiquitin carboxyl-terminal hydrolase CYLD; cytoki | 98.42 |
| >3nhe_A Ubiquitin carboxyl-terminal hydrolase 2; cysteine protease, substrate ENZY complex, hydrolase-protein binding complex; HET: CME; 1.26A {Homo sapiens} SCOP: d.3.1.9 PDB: 2hd5_A 3v6c_A 3v6e_A 2ibi_A | Back alignment and structure |
|---|
Probab=99.86 E-value=8.4e-22 Score=146.49 Aligned_cols=70 Identities=27% Similarity=0.600 Sum_probs=62.6
Q ss_pred eeeCCCCCcceEEeEEEEEeeCCCCCceEEEEEEc--CCeEEEEcCCeeeEeCcccccCCCcEEEEEEecCCc
Q psy4215 11 YVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIH--EAQWWHFDDSTVMPVDIPALKKCKPYILFYVRRVPE 81 (103)
Q Consensus 11 ~~~~~~~~~~Y~L~avv~H~G~~~~~GHY~~~~~~--~~~W~~~dD~~V~~~~~~~v~~~~aYiLfY~r~~~~ 81 (103)
|+........|+|+|||+|.| +.++|||++|+|. ++.|++|||+.|++++.++|...+||||||+|++.+
T Consensus 274 ~~~~~~~~~~Y~L~avv~H~G-~~~~GHY~~~~~~~~~~~W~~~nD~~V~~v~~~~v~~~~aY~LfY~r~~~~ 345 (348)
T 3nhe_A 274 FASENTNHAVYNLYAVSNHSG-TTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELASPP 345 (348)
T ss_dssp GBCTTCCCCEEEEEEEEEEEE-CSSCEEEEEEEECTTTCCEEEEETTEEEEECGGGTCCTTEEEEEEEECC--
T ss_pred hcCCCCCCCcEEEEEEEEccC-CCCCcccEEEEccCCCCcEEEEeCCCceECCHHHcCCCCceEEEEEecCCC
Confidence 445556678899999999999 7899999999998 789999999999999999999999999999999865
|
| >3i3t_A Ubiquitin carboxyl-terminal hydrolase 21; hydrolase, structural genomics consortium, SGC, activator, alternative splicing, chromatin regulator, nucleus, polymorphism, protease; 2.59A {Homo sapiens} SCOP: d.3.1.0 PDB: 2y5b_A 3mtn_A | Back alignment and structure |
|---|
| >2y6e_A Ubiquitin carboxyl-terminal hydrolase 4; HET: CME; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2ayn_A Ubiquitin carboxyl-terminal hydrolase 14; deubiquitinating enzymes, DUB, USP14, proteasome, enzyme mechanism; 3.20A {Homo sapiens} SCOP: d.3.1.9 PDB: 2ayo_A | Back alignment and structure |
|---|
| >1vjv_A Ubiquitin carboxyl-terminal hydrolase 6; YFR010W, structural genomics, JCSG, PSI, protein structure initiative; HET: MSE; 1.74A {Saccharomyces cerevisiae} SCOP: d.3.1.9 | Back alignment and structure |
|---|
| >2gfo_A Ubiquitin carboxyl-terminal hydrolase 8; protease, thiol protease, UBL conjugation pathway deubiquitinating enzyme, DUB, zinc ribbon; 2.00A {Homo sapiens} SCOP: d.3.1.9 PDB: 3n3k_A | Back alignment and structure |
|---|
| >1nb8_A Ubiquitin carboxyl-terminal hydrolase 7; UBP, deubiquitination, hausp, P53 binding; 2.30A {Homo sapiens} SCOP: d.3.1.9 PDB: 1nbf_A | Back alignment and structure |
|---|
| >3mhs_A Ubiquitin carboxyl-terminal hydrolase 8; multi-protein complex, hydrolase-transcription regulator-Pro binding complex, acetylation, cytoplasm; 1.89A {Saccharomyces cerevisiae} PDB: 3mhh_A 4fjc_A 4fk5_A 4fip_A 3m99_A | Back alignment and structure |
|---|
| >2f1z_A Ubiquitin carboxyl-terminal hydrolase 7; hausp, USP7, UBP, deubiquitinating enzyme, substrate recognition; 3.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2vhf_A Ubiquitin carboxyl-terminal hydrolase CYLD; cytokine signalling, linkage specificity, deubiquitinating enzyme, Lys63- linked, anti-oncogene; 2.8A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 103 | ||||
| d2gfoa1 | 348 | d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal h | 1e-11 | |
| d2hd5a1 | 336 | d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hy | 1e-11 | |
| d2ayna1 | 383 | d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hy | 4e-10 | |
| d1vjva_ | 397 | d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase | 4e-10 | |
| d1nbfa_ | 347 | d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase | 8e-08 |
| >d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} Length = 348 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Ubiquitin carboxyl-terminal hydrolase, UCH domain: Ubiquitin carboxyl-terminal hydrolase 8 species: Human (Homo sapiens) [TaxId: 9606]
Score = 57.0 bits (136), Expect = 1e-11
Identities = 19/47 (40%), Positives = 27/47 (57%), Gaps = 2/47 (4%)
Query: 33 GVHSGHYTAYAIHEA--QWWHFDDSTVMPVDIPALKKCKPYILFYVR 77
G+ GHYTAY + A +W+ FDD V + + ++K YILFY
Sbjct: 301 GLDGGHYTAYCKNAARQRWFKFDDHEVSDISVSSVKSSAAYILFYTS 347
|
| >d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 336 | Back information, alignment and structure |
|---|
| >d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} Length = 383 | Back information, alignment and structure |
|---|
| >d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 397 | Back information, alignment and structure |
|---|
| >d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} Length = 347 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 103 | |||
| d2hd5a1 | 336 | Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Hum | 99.87 | |
| d1vjva_ | 397 | Ubiquitin carboxyl-terminal hydrolase 6 {Baker's y | 99.86 | |
| d2gfoa1 | 348 | Ubiquitin carboxyl-terminal hydrolase 8 {Human (Ho | 99.85 | |
| d2ayna1 | 383 | Ubiquitin carboxyl-terminal hydrolase 14 {Human (H | 99.84 | |
| d1nbfa_ | 347 | Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAU | 99.83 |
| >d2hd5a1 d.3.1.9 (A:211-521) Ubiquitin carboxyl-terminal hydrolase 2, USP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Cysteine proteinases superfamily: Cysteine proteinases family: Ubiquitin carboxyl-terminal hydrolase, UCH domain: Ubiquitin carboxyl-terminal hydrolase 2, USP2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.87 E-value=2.2e-22 Score=144.63 Aligned_cols=68 Identities=26% Similarity=0.587 Sum_probs=61.9
Q ss_pred eeeeCCCCCcceEEeEEEEEeeCCCCCceEEEEEEc--CCeEEEEcCCeeeEeCcccccCCCcEEEEEEec
Q psy4215 10 TYVNDTKNKRQFRFDNLLKASTIGVHSGHYTAYAIH--EAQWWHFDDSTVMPVDIPALKKCKPYILFYVRR 78 (103)
Q Consensus 10 ~~~~~~~~~~~Y~L~avv~H~G~~~~~GHY~~~~~~--~~~W~~~dD~~V~~~~~~~v~~~~aYiLfY~r~ 78 (103)
++.....+..+|+|+|||+|.| ++++|||++|+|+ +++|++|||+.|++++.++|...+||||||+|.
T Consensus 267 ~~~~~~~~~~~Y~L~~vi~H~G-~~~~GHY~~~ik~~~~~~W~~~nD~~V~~v~~~~v~~~~aYiL~Y~r~ 336 (336)
T d2hd5a1 267 EFASENTNHAVYNLYAVSNHSG-TTMGGHYTAYCRSPGTGEWHTFNDSSVTPMSSSQVRTSDAYLLFYELA 336 (336)
T ss_dssp GGBSSSSCCCEEEEEEEEEEEE-CSSCEEEEEEEECTTTCCEEEEETTEEEEECGGGSCCTTEEEEEEEEC
T ss_pred ccccCCCCCCeEeEEEEEEEeC-CCCCceEEEEEEcCCCCeEEEEECCceeECCHHHhccCCCEEEEEEcC
Confidence 4456666778999999999999 7899999999997 679999999999999999999999999999983
|
| >d1vjva_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2gfoa1 d.3.1.9 (A:762-1109) Ubiquitin carboxyl-terminal hydrolase 8 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ayna1 d.3.1.9 (A:100-482) Ubiquitin carboxyl-terminal hydrolase 14 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nbfa_ d.3.1.9 (A:) Ubiquitin carboxyl-terminal hydrolase 7 (USP7, HAUSP) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|