Diaphorina citri psyllid: psy4226


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVSYLTND
cEEEEEEccccHHHHHHHHcccEEEEEEEEccccccccccccccccccccccccEEEEEEcHHHHHHHHHHHHHHHEEEEHHHHHHHHHHHHHHcccHHHHHHHHccccEEEcccccccccccccccccccccccccEEEEEccccccccccccHHHccccccccccccHHHccccccccccc
MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFV******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVSYLTND

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005789 [CC]endoplasmic reticulum membraneprobableGO:0005737, GO:0005575, GO:0005783, GO:0044432, GO:0016020, GO:0044464, GO:0043229, GO:0005623, GO:0043231, GO:0044446, GO:0042175, GO:0044444, GO:0012505, GO:0044424, GO:0044425, GO:0005622, GO:0043227, GO:0043226, GO:0044422, GO:0031090
GO:0042036 [BP]negative regulation of cytokine biosynthetic processprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0042035, GO:0050789, GO:0051248, GO:0010605, GO:0019222, GO:0051246, GO:0065007, GO:0048519, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0051239, GO:0001817, GO:0010556, GO:0010558, GO:0048523
GO:0004842 [MF]ubiquitin-protein ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0005770 [CC]late endosomeprobableGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0051865 [BP]protein autoubiquitinationprobableGO:0071704, GO:0044267, GO:0044238, GO:0044260, GO:0032446, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0016567, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 97-172
View the alignment between query and template
View the model in PyMOL