Psyllid ID: psy4226

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180---
MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVSYLTND
cEEEEEEccccHHHHHHHHcccEEEEEEEEccccccccccccccccccccccccEEEEEEcHHHHHHHHHHHHHHHEEEEHHHHHHHHHHHHHHcccHHHHHHHHccccEEEcccccccccccccccccccccccccEEEEEcccccccccccHHHHccccccccccccHHHccccccccccc
cEEEEEEcccHHHHHHHHHcccEEEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccEEEEEcccccccEEEEEcccccHHHHcccHHHHccccccHcHHHHHHHcccccccccc
MSAVFTYKWKGEELARLLDNGTRIIAKITIAshcnrpytninrsqspslvtatdlipisigdlpraVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSkiptkhikgedkeisgdgecCAICiefykpsdivrilpckheyhkncidpwllehrtcpmckmdilKHYGFVSYLTND
msavftykwkGEELARLLDNGTRIIAKITiashcnrpytninrsqspslVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKalskiptkhikgedkeisgdGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVSYLTND
MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVSYLTND
***VFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKG**KEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVSYL***
MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDN**********************TKHIKGEDKE*SGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDI*************
MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVSYLTND
MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFV******
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFVSYLTND
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query183 2.2.26 [Sep-21-2011]
Q06003 461 Protein goliath OS=Drosop yes N/A 0.901 0.357 0.451 5e-35
Q9ULK6 438 RING finger protein 150 O yes N/A 0.868 0.363 0.414 5e-30
Q5DTZ6 437 RING finger protein 150 O yes N/A 0.868 0.363 0.409 8e-30
Q566M8419 RING finger protein 150 O no N/A 0.879 0.384 0.387 3e-28
Q86XS8419 E3 ubiquitin-protein liga no N/A 0.890 0.389 0.411 3e-27
Q6Y290419 E3 ubiquitin-protein liga no N/A 0.890 0.389 0.405 3e-27
Q8VEM1419 E3 ubiquitin-protein liga no N/A 0.890 0.389 0.405 4e-27
Q8AWW4404 E3 ubiquitin-protein liga N/A N/A 0.448 0.202 0.646 2e-26
Q9D304428 E3 ubiquitin-protein liga no N/A 0.551 0.235 0.539 3e-26
Q8TEB7428 E3 ubiquitin-protein liga no N/A 0.551 0.235 0.529 6e-26
>sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 Back     alignment and function desciption
 Score =  147 bits (370), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 105/177 (59%), Gaps = 12/177 (6%)

Query: 1   MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISI 60
           ++AV TY+  G++L+  LD G  +   I       R  +++NR+    L  +   I + I
Sbjct: 190 IAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSV--LFVSISFIVLMI 247

Query: 61  GDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKGEDKEIS 120
             L   V L  +  +   Y Q          + R LCS  KKA+ KIPTK  K  D E  
Sbjct: 248 ISL---VWLIFYYIQRFRYMQAKDQ------QSRNLCSVTKKAIMKIPTKTGKFSD-EKD 297

Query: 121 GDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFV 177
            D +CCAICIE YKP+D +RILPCKHE+HKNCIDPWL+EHRTCPMCK+D+LK YG+V
Sbjct: 298 LDSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYV 354
Regulation of gene expression during embryonic mesoderm formation. Putative role as transcription factor.
Drosophila melanogaster (taxid: 7227)
>sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 Back     alignment and function description
>sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 Back     alignment and function description
>sp|Q566M8|RN150_DANRE RING finger protein 150 OS=Danio rerio GN=rnf150 PE=2 SV=1 Back     alignment and function description
>sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 Back     alignment and function description
>sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 Back     alignment and function description
>sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 Back     alignment and function description
>sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 Back     alignment and function description
>sp|Q9D304|RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus GN=Rnf128 PE=1 SV=1 Back     alignment and function description
>sp|Q8TEB7|RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens GN=RNF128 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
328704644 451 PREDICTED: protein goliath-like isoform 0.901 0.365 0.614 4e-56
328704642 367 PREDICTED: protein goliath-like isoform 0.901 0.449 0.614 4e-56
91081613 470 PREDICTED: similar to goliath E3 ubiquit 0.901 0.351 0.595 1e-49
242019016 348 protein goliath precursor, putative [Ped 0.885 0.465 0.537 1e-47
357602283 408 putative goliath E3 ubiquitin ligase [Da 0.896 0.401 0.536 9e-45
321459525 473 hypothetical protein DAPPUDRAFT_327936 [ 0.879 0.340 0.536 4e-44
241998604266 E3 ubiquitin ligase, putative [Ixodes sc 0.885 0.609 0.468 4e-40
157132158 500 goliath E3 ubiquitin ligase [Aedes aegyp 0.896 0.328 0.5 2e-38
195430052 779 GK21726 [Drosophila willistoni] gi|19415 0.901 0.211 0.474 9e-37
158290004 361 AGAP010356-PA [Anopheles gambiae str. PE 0.896 0.454 0.483 5e-36
>gi|328704644|ref|XP_001948021.2| PREDICTED: protein goliath-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  222 bits (566), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 137/179 (76%), Gaps = 14/179 (7%)

Query: 1   MSAVFTYKWKGEELARLLDNGTR-IIAKITIASHCNRPYTNINRSQSPSLVTATDLIPIS 59
           +SAVFTYKWKGE++AR+LD+ TR ++ KITIASHC RPY NINR         T ++ +S
Sbjct: 153 VSAVFTYKWKGEDMARMLDDMTRRVMVKITIASHCTRPYGNINR---------TSVLFVS 203

Query: 60  IGDLPRAVSLTLFQTELIFYQQYSSDNIFEIMEL-RRLCSAAKKALSKIPTKHIKGEDKE 118
           I  +   V + +    L+FY       I    +L RRLC+AAKKALSKIPTKHIK +DKE
Sbjct: 204 ISFI---VLMVISLAWLVFYYIQRFRYIHAKDQLSRRLCNAAKKALSKIPTKHIKMDDKE 260

Query: 119 ISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFV 177
           I GDG+CCA+CIE Y+PS++VRILPC+HE+HK+C+DPWLLEHRTCPMCKMDILKHYGF+
Sbjct: 261 IVGDGDCCAVCIEPYRPSEVVRILPCRHEFHKSCVDPWLLEHRTCPMCKMDILKHYGFL 319

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328704642|ref|XP_003242556.1| PREDICTED: protein goliath-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|91081613|ref|XP_966546.1| PREDICTED: similar to goliath E3 ubiquitin ligase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242019016|ref|XP_002429963.1| protein goliath precursor, putative [Pediculus humanus corporis] gi|212515014|gb|EEB17225.1| protein goliath precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|357602283|gb|EHJ63333.1| putative goliath E3 ubiquitin ligase [Danaus plexippus] Back     alignment and taxonomy information
>gi|321459525|gb|EFX70577.1| hypothetical protein DAPPUDRAFT_327936 [Daphnia pulex] Back     alignment and taxonomy information
>gi|241998604|ref|XP_002433945.1| E3 ubiquitin ligase, putative [Ixodes scapularis] gi|215495704|gb|EEC05345.1| E3 ubiquitin ligase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|157132158|ref|XP_001662491.1| goliath E3 ubiquitin ligase [Aedes aegypti] gi|108871273|gb|EAT35498.1| AAEL012337-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|195430052|ref|XP_002063071.1| GK21726 [Drosophila willistoni] gi|194159156|gb|EDW74057.1| GK21726 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|158290004|ref|XP_559104.3| AGAP010356-PA [Anopheles gambiae str. PEST] gi|157018431|gb|EAL41047.3| AGAP010356-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query183
FB|FBgn0004919 461 gol "goliath" [Drosophila mela 0.896 0.355 0.449 1.1e-34
UNIPROTKB|D6RIE5230 RNF150 "RING finger protein 15 0.825 0.656 0.428 2.7e-29
UNIPROTKB|Q9ULK6 438 RNF150 "RING finger protein 15 0.825 0.344 0.428 2.7e-29
UNIPROTKB|J9JHQ4310 RNF150 "Uncharacterized protei 0.825 0.487 0.428 3.4e-29
UNIPROTKB|J9NYE2 382 RNF150 "Uncharacterized protei 0.825 0.395 0.428 3.4e-29
UNIPROTKB|F1RRE9 269 RNF150 "Uncharacterized protei 0.825 0.561 0.428 3.4e-29
UNIPROTKB|E1C2N7 427 RNF150 "Uncharacterized protei 0.825 0.353 0.422 4.4e-29
MGI|MGI:2443860 437 Rnf150 "ring finger protein 15 0.825 0.345 0.422 4.4e-29
ZFIN|ZDB-GENE-060213-1418 rnf150a "ring finger protein 1 0.825 0.361 0.422 4.4e-29
UNIPROTKB|F1MIY9418 RNF130 "Uncharacterized protei 0.890 0.389 0.422 1.3e-27
FB|FBgn0004919 gol "goliath" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 376 (137.4 bits), Expect = 1.1e-34, P = 1.1e-34
 Identities = 80/178 (44%), Positives = 110/178 (61%)

Query:     1 MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISI 60
             ++AV TY+  G++L+  LD G  +   I       R  +++NR+    L  +   I + I
Sbjct:   190 IAAVITYQNIGQDLSLTLDKGYNVTISIIEGRRGVRTISSLNRTSV--LFVSISFIVLMI 247

Query:    61 GDLPRAVSLTLFQTELIFYQQYSSDNIFEIMELRRLCSAAKKALSKIPTKHIK-GEDKEI 119
               L   V L  +  +   Y Q + D      + R LCS  KKA+ KIPTK  K  ++K++
Sbjct:   248 ISL---VWLIFYYIQRFRYMQ-AKDQ-----QSRNLCSVTKKAIMKIPTKTGKFSDEKDL 298

Query:   120 SGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYGFV 177
               D +CCAICIE YKP+D +RILPCKHE+HKNCIDPWL+EHRTCPMCK+D+LK YG+V
Sbjct:   299 --DSDCCAICIEAYKPTDTIRILPCKHEFHKNCIDPWLIEHRTCPMCKLDVLKFYGYV 354
GO:0005634 "nucleus" evidence=NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=NAS
GO:0007498 "mesoderm development" evidence=NAS
GO:0008270 "zinc ion binding" evidence=IEA
UNIPROTKB|D6RIE5 RNF150 "RING finger protein 150" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ULK6 RNF150 "RING finger protein 150" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9JHQ4 RNF150 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9NYE2 RNF150 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1RRE9 RNF150 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1C2N7 RNF150 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:2443860 Rnf150 "ring finger protein 150" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060213-1 rnf150a "ring finger protein 150a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MIY9 RNF130 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 7e-13
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 6e-12
cd0016245 cd00162, RING, RING-finger (Really Interesting New 3e-10
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 5e-08
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 1e-07
smart0018440 smart00184, RING, Ring finger 1e-06
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-06
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 7e-05
PHA02929238 PHA02929, PHA02929, N1R/p28-like protein; Provisio 0.002
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information 
 Score = 59.7 bits (145), Expect = 7e-13
 Identities = 19/46 (41%), Positives = 30/46 (65%)

Query: 124 ECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMD 169
           + C IC++ ++P + V +LPC H +HK C+D WL    TCP+C+  
Sbjct: 1   DECPICLDEFEPGEEVVVLPCGHVFHKECLDKWLRSSNTCPLCRAP 46

Length = 46
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222944 PHA02929, PHA02929, N1R/p28-like protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 183
KOG4628|consensus348 99.96
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.72
PHA02929238 N1R/p28-like protein; Provisional 99.56
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.55
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.53
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 99.47
KOG0317|consensus293 99.42
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.33
PLN03208 193 E3 ubiquitin-protein ligase RMA2; Provisional 99.32
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.29
cd0016245 RING RING-finger (Really Interesting New Gene) dom 99.26
KOG0320|consensus187 99.26
KOG0823|consensus 230 99.24
KOG0802|consensus 543 99.23
PF1463444 zf-RING_5: zinc-RING finger domain 99.18
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.18
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 99.14
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 99.1
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.08
PHA02926242 zinc finger-like protein; Provisional 99.08
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 99.05
KOG1734|consensus328 99.01
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.94
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.92
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.81
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.77
KOG2164|consensus 513 98.76
KOG0828|consensus636 98.75
KOG4265|consensus349 98.72
KOG0287|consensus 442 98.71
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.7
KOG1493|consensus84 98.65
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.65
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.63
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.59
KOG0804|consensus 493 98.52
KOG4172|consensus62 98.48
KOG0827|consensus 465 98.48
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 98.4
KOG2177|consensus 386 98.4
KOG2930|consensus114 98.35
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.27
KOG0824|consensus 324 98.27
COG52191525 Uncharacterized conserved protein, contains RING Z 98.19
KOG1785|consensus 563 98.15
KOG0311|consensus 381 98.08
KOG1645|consensus 463 98.0
KOG0978|consensus698 97.99
KOG0825|consensus 1134 97.96
KOG4159|consensus 398 97.95
KOG1039|consensus 344 97.79
KOG1941|consensus518 97.72
KOG4445|consensus 368 97.7
KOG4692|consensus489 97.68
KOG0826|consensus357 97.63
KOG2879|consensus298 97.61
KOG1571|consensus355 97.6
COG5152259 Uncharacterized conserved protein, contains RING a 97.58
KOG0297|consensus 391 97.57
KOG1428|consensus 3738 97.51
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.48
KOG3970|consensus 299 97.41
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 97.36
COG5222427 Uncharacterized conserved protein, contains RING Z 97.31
KOG1813|consensus313 97.28
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 97.28
KOG4275|consensus350 97.27
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 97.23
PHA02825162 LAP/PHD finger-like protein; Provisional 97.17
KOG0801|consensus205 97.16
KOG2660|consensus 331 97.11
PHA02862156 5L protein; Provisional 97.02
KOG0827|consensus 465 96.93
KOG4739|consensus 233 96.9
KOG1002|consensus 791 96.8
KOG1814|consensus 445 96.58
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 96.53
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.5
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.49
PF04641260 Rtf2: Rtf2 RING-finger 96.42
KOG4185|consensus 296 96.33
PHA03096284 p28-like protein; Provisional 96.31
KOG1001|consensus 674 96.26
KOG3039|consensus303 96.01
KOG3002|consensus 299 96.0
KOG1940|consensus276 95.96
KOG1952|consensus 950 95.87
KOG1100|consensus207 95.82
PF10272358 Tmpp129: Putative transmembrane protein precursor; 95.73
KOG2114|consensus933 95.65
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 95.25
COG5175 480 MOT2 Transcriptional repressor [Transcription] 95.13
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 95.09
KOG2034|consensus911 95.06
KOG2932|consensus 389 94.81
KOG3268|consensus234 94.27
KOG0298|consensus 1394 94.15
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 94.04
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 93.66
KOG3800|consensus 300 93.55
KOG3899|consensus381 93.38
KOG0309|consensus1081 93.14
KOG1609|consensus 323 92.98
KOG3161|consensus 861 92.98
KOG4362|consensus 684 92.79
KOG3053|consensus 293 92.57
KOG1812|consensus 384 91.99
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 91.78
KOG4367|consensus 699 90.95
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 90.93
KOG2817|consensus394 90.87
KOG0802|consensus543 90.51
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 89.17
KOG1829|consensus580 88.93
PF13901202 DUF4206: Domain of unknown function (DUF4206) 86.63
KOG0269|consensus839 86.19
KOG0825|consensus 1134 85.16
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 84.94
KOG2066|consensus846 84.62
PF0289150 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR0041 83.85
KOG3039|consensus 303 81.22
>KOG4628|consensus Back     alignment and domain information 
Probab=99.96  E-value=1.2e-28  Score=201.71  Aligned_cols=158  Identities=32%  Similarity=0.529  Sum_probs=114.0

Q ss_pred             CceEEeeccchHHHHHHHhCCceEEEEEEecCCCCCCcccccCCCcceeeeeccchhhhHhHHHHHHHHHHHHHHHHHHh
Q psy4226           1 MSAVFTYKWKGEELARLLDNGTRIIAKITIASHCNRPYTNINRSQSPSLVTATDLIPISIGDLPRAVSLTLFQTELIFYQ   80 (183)
Q Consensus         1 ~~av~~~~~~g~~l~~~~~~~~~v~~~i~~~~~~~~~~~~~~~~s~~~~~~~~~~~~isf~~l~~~is~~l~~~~~~f~~   80 (183)
                      |++|||++..||.|++++..+.-..+.+..+-..                ..|+++.++++.+ ++++..+ .+++++++
T Consensus       130 i~~~~vs~~~ge~l~~~~~~~~~~~~~~~~~~~~----------------~~ws~~~~~~i~~-l~v~~il-~~~f~i~~  191 (348)
T KOG4628|consen  130 IHIVFVSVFSGELLSSYAGRTEFECLLIPLGFDT----------------SPWSILAISLISL-LTVVAIL-VTCFFIYR  191 (348)
T ss_pred             eEEEEEeeehHHHHHHhhcccceeeeeccccccC----------------CcchhhhhhhhhH-HHHHHHH-HHHHHHHH
Confidence            6799999999999999987775555554332221                2223334444444 3333333 22444443


Q ss_pred             hccchhHHHHHHHhhhHHHHHHHhhcCCCccccCCCcccCCCccccccccccccCCCceEEecCCCccccccHHHHhcCC
Q psy4226          81 QYSSDNIFEIMELRRLCSAAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEH  160 (183)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~~~i~~l~~~~~~~~~~~~~~~~~~C~ICle~~~~~~~v~~lpC~H~Fh~~Ci~~Wl~~~  160 (183)
                      -.+.  ..++.. ++..+..++.++++|...++.++.+...  +.|+||+|+|+.||++++|||+|.||..||++||.++
T Consensus       192 ~~~~--~~~r~~-~~~~r~~k~~l~~~p~~~f~~~~~~~~~--~~CaIClEdY~~GdklRiLPC~H~FH~~CIDpWL~~~  266 (348)
T KOG4628|consen  192 IRRL--IRARNR-LRRNRLIKRLLKKLPVRTFTKGDDEDAT--DTCAICLEDYEKGDKLRILPCSHKFHVNCIDPWLTQT  266 (348)
T ss_pred             HHHH--HHHHhH-hhhhhhHHHHHhhCCcEEeccccccCCC--ceEEEeecccccCCeeeEecCCCchhhccchhhHhhc
Confidence            2222  122222 5667889999999999999988776543  7899999999999999999999999999999999998


Q ss_pred             Cc-ccccccccccccCCCCCCC
Q psy4226         161 RT-CPMCKMDILKHYGFVSYLT  181 (183)
Q Consensus       161 ~~-CP~CR~~i~~~~~~~~~~~  181 (183)
                      ++ ||+||+++.+..+.+...+
T Consensus       267 r~~CPvCK~di~~~~~~~~~~e  288 (348)
T KOG4628|consen  267 RTFCPVCKRDIRTDSGSEPVSE  288 (348)
T ss_pred             CccCCCCCCcCCCCCCCCCccC
Confidence            66 9999999999988776554

>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>KOG0801|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG3268|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>KOG3899|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG1609|consensus Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>KOG3053|consensus Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>KOG1829|consensus Back     alignment and domain information
>PF13901 DUF4206: Domain of unknown function (DUF4206) Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG2066|consensus Back     alignment and domain information
>PF02891 zf-MIZ: MIZ/SP-RING zinc finger; InterPro: IPR004181 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
2ep4_A74 Solution Structure Of Ring Finger From Human Ring F 3e-09
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 6e-09
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 3e-08
1iym_A55 Ring-H2 Finger Domain Of El5 Length = 55 1e-07
2kiz_A69 Solution Structure Of Arkadia Ring-H2 Finger Domain 2e-07
2l0b_A91 Solution Nmr Structure Of Zinc Finger Domain Of E3 3e-07
2ecn_A70 Solution Structure Of The Ring Domain Of The Human 3e-05
>pdb|2EP4|A Chain A, Solution Structure Of Ring Finger From Human Ring Finger Protein 24 Length = 74 Back     alignment and structure 
Iteration: 1

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 22/49 (44%), Positives = 33/49 (67%)
Query: 124 ECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILK 172
           E CA+C+E +KP D + I PCKH +H+ C+  WL   + CP+C M +L+
Sbjct: 16  ELCAVCLEDFKPRDELGICPCKHAFHRKCLIKWLEVRKVCPLCNMPVLQ 64
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure
>pdb|1IYM|A Chain A, Ring-H2 Finger Domain Of El5 Length = 55 Back     alignment and structure
>pdb|2KIZ|A Chain A, Solution Structure Of Arkadia Ring-H2 Finger Domain Length = 69 Back     alignment and structure
>pdb|2L0B|A Chain A, Solution Nmr Structure Of Zinc Finger Domain Of E3 Ubiquitin-Protein Ligase Praja-1 From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr4710b Length = 91 Back     alignment and structure
>pdb|2ECN|A Chain A, Solution Structure Of The Ring Domain Of The Human Ring Finger Protein 141 Length = 70 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query183
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 2e-29
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 3e-28
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 6e-28
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 2e-27
2ect_A78 Ring finger protein 126; metal binding protein, st 9e-26
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 6e-22
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-19
2ecm_A55 Ring finger and CHY zinc finger domain- containing 1e-18
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 4e-17
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 1e-12
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 4e-12
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-10
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 6e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 2e-09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 5e-09
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 8e-09
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 4e-08
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 7e-08
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 1e-07
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 2e-07
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 5e-07
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 1e-06
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 2e-06
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 2e-06
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 5e-06
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 2e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 5e-05
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 7e-05
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 9e-05
1z6u_A150 NP95-like ring finger protein isoform B; structura 1e-04
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 4e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 7e-04
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
 Score =  102 bits (257), Expect = 2e-29
 Identities = 21/77 (27%), Positives = 40/77 (51%), Gaps = 2/77 (2%)

Query: 99  AAKKALSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLL 158
            +  +  ++P+      +     +   C +C+  ++   ++R+LPC HE+H  C+D WL 
Sbjct: 1   GSSGSSGQLPSYRFNPNNH--QSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLK 58

Query: 159 EHRTCPMCKMDILKHYG 175
            +RTCP+C+ D     G
Sbjct: 59  ANRTCPICRADSGPSSG 75
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Length = 150 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 66 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.77
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.76
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.73
2ect_A78 Ring finger protein 126; metal binding protein, st 99.72
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.71
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.71
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.67
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.64
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.64
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.63
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.6
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.6
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.6
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.6
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.58
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.57
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.57
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.57
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.56
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.53
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.53
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.52
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.52
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.51
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.5
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.49
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.49
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.49
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.48
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.47
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.47
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.46
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.45
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.44
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.43
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.43
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.43
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.43
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.39
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.39
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 99.37
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.36
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.36
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.36
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.35
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.35
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.34
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 99.33
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.31
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.3
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.29
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.28
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 99.26
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.24
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.23
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.21
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.2
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 99.11
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.11
2ea5_A68 Cell growth regulator with ring finger domain prot 99.1
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 99.08
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 99.04
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.98
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.98
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.97
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.97
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.96
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.84
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.8
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.76
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.5
3nw0_A238 Non-structural maintenance of chromosomes element 98.01
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 96.6
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 96.16
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 95.58
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 94.95
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 94.47
1wil_A89 KIAA1045 protein; ring finger domain, structural g 94.35
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 94.09
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 93.66
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 93.6
1we9_A64 PHD finger family protein; structural genomics, PH 93.34
3o36_A 184 Transcription intermediary factor 1-alpha; TRIM24, 93.28
3u5n_A 207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 93.14
2k16_A75 Transcription initiation factor TFIID subunit 3; p 93.05
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 92.39
3lqh_A 183 Histone-lysine N-methyltransferase MLL; PHD finger 91.69
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 91.07
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 90.86
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 90.01
2yt5_A66 Metal-response element-binding transcription facto 89.99
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 89.47
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 89.36
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 88.12
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 88.11
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 88.04
1weu_A91 Inhibitor of growth family, member 4; structural g 87.85
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 86.88
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 85.7
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 85.63
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 85.39
1wem_A76 Death associated transcription factor 1; structura 83.77
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 82.61
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 82.05
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 81.66
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 81.31
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 80.77
1zbd_B134 Rabphilin-3A; G protein, effector, RABCDR, synapti 80.7
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
Probab=99.77  E-value=1.7e-19  Score=117.78  Aligned_cols=70  Identities=30%  Similarity=0.851  Sum_probs=58.2

Q ss_pred             hhcCCCccccCCCcccCCCccccccccccccCCCceEEecCCCccccccHHHHhcCCCcccccccccccccC
Q psy4226         104 LSKIPTKHIKGEDKEISGDGECCAICIEFYKPSDIVRILPCKHEYHKNCIDPWLLEHRTCPMCKMDILKHYG  175 (183)
Q Consensus       104 i~~l~~~~~~~~~~~~~~~~~~C~ICle~~~~~~~v~~lpC~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~~~~~  175 (183)
                      ++++|...+....  ...+...|+||+++|..++.++.+||||.||..|+.+|+..+.+||+||+++.+..|
T Consensus         6 i~~lp~~~~~~~~--~~~~~~~C~IC~~~~~~~~~~~~l~C~H~fh~~Ci~~w~~~~~~CP~Cr~~~~~~~g   75 (75)
T 1x4j_A            6 SGQLPSYRFNPNN--HQSEQTLCVVCMCDFESRQLLRVLPCNHEFHAKCVDKWLKANRTCPICRADSGPSSG   75 (75)
T ss_dssp             CSSCCCEEBCSSS--CSSSCCEETTTTEECCBTCEEEEETTTEEEETTHHHHHHHHCSSCTTTCCCCCCCCC
T ss_pred             HhhCCcEEecCcc--ccCCCCCCeECCcccCCCCeEEEECCCCHhHHHHHHHHHHcCCcCcCcCCcCCCCCC
Confidence            4566766665432  233466799999999999999999999999999999999999999999999987654
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>1zbd_B Rabphilin-3A; G protein, effector, RABCDR, synaptic exocytosis, RAB protein, RAB3A; HET: GTP; 2.60A {Rattus norvegicus} SCOP: g.50.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 183
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-16
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 4e-13
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 9e-11
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 1e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 7e-08
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 1e-07
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 1e-07
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 1e-06
d1wima_94 g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA016 2e-06
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 7e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 9e-06
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 3e-04
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 6e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 0.003
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

 Score = 67.6 bits (165), Expect = 2e-16
 Identities = 20/51 (39%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 122 DGECCAICIEFYKPSDIVRILP-CKHEYHKNCIDPWLLEHRTCPMCKMDIL 171
           DG  CA+C+   +  +  R LP C H +H  C+D WL  H TCP+C++ ++
Sbjct: 4   DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV 54
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Length = 94 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query183
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.81
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.7
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.64
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.63
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.62
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.6
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.52
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.51
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.5
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.42
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 99.35
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.28
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.28
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.22
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 99.02
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.88
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 95.71
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 95.03
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 95.01
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 94.89
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 94.08
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 92.93
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 91.44
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 87.63
d1wema_76 Death associated transcription factor 1, Datf1 (DI 85.78
d1y02a251 Rififylin (FYVE-RING finger protein Sakura) {Human 85.43
d1z60a159 TFIIH p44 subunit cysteine-rich domain {Human (Hom 83.34
d2co8a236 Nedd9 interacting protein with calponin homology, 82.87
d1zbdb_124 Effector domain of rabphilin-3a {Rat (Rattus norve 80.47
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.81  E-value=4.9e-21  Score=116.35  Aligned_cols=50  Identities=40%  Similarity=1.081  Sum_probs=45.7

Q ss_pred             CccccccccccccCCCceEEec-CCCccccccHHHHhcCCCcccccccccc
Q psy4226         122 DGECCAICIEFYKPSDIVRILP-CKHEYHKNCIDPWLLEHRTCPMCKMDIL  171 (183)
Q Consensus       122 ~~~~C~ICle~~~~~~~v~~lp-C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~  171 (183)
                      ++.+|+||+++|..++.++.+| |||.||.+|+.+|++.+++||+||+++.
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~CR~~i~   54 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVV   54 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSSSCCCSC
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCCCCCEeE
Confidence            3556999999999999998886 9999999999999999999999999874
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y02a2 g.50.1.1 (A:20-70) Rififylin (FYVE-RING finger protein Sakura) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z60a1 g.49.1.2 (A:328-386) TFIIH p44 subunit cysteine-rich domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zbdb_ g.50.1.1 (B:) Effector domain of rabphilin-3a {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure