Diaphorina citri psyllid: psy4227


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MAARSDFEKNLLKKFVRGRRFRQPVLKERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPTTDETSIKSEKPSPAKSTTNRIRDSITKPSDTTAALRKSLDLTNKKEGESLDLTNKKKKKKKKKKKKKKKKN
cccccccccccccccccccccccccccccEEEccccccccccccccccccEEEEcccccccccccEEEEccCEEECccccEEEccccccccccccccccccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccc
****S********KFVR*RRFRQPVLKERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLP************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAARSDFEKNLLKKFVRGRRFRQPVLKERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPTTDETSIKSEKPSPAKSTTNRIRDSITKPSDTTAALRKSLDLTNKKEGESxxxxxxxxxxxxxxxxxxxxxN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0044422 [CC]organelle partprobableGO:0005575, GO:0043226
GO:0051128 [BP]regulation of cellular component organizationprobableGO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0048522 [BP]positive regulation of cellular processprobableGO:0048518, GO:0008150, GO:0065007, GO:0050789, GO:0050794
GO:0016023 [CC]cytoplasmic membrane-bounded vesicleprobableGO:0005737, GO:0031982, GO:0031410, GO:0044464, GO:0044444, GO:0005623, GO:0031988, GO:0005575, GO:0043229, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0043231
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0043232 [CC]intracellular non-membrane-bounded organelleprobableGO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0006996 [BP]organelle organizationprobableGO:0009987, GO:0016043, GO:0008150, GO:0044699, GO:0044763, GO:0071840
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0065008 [BP]regulation of biological qualityprobableGO:0008150, GO:0065007
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0005912 [CC]adherens junctionprobableGO:0005575, GO:0070161, GO:0030054

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1GRI, chain A
Confidence level:very confident
Coverage over the Query: 26-86
View the alignment between query and template
View the model in PyMOL