Psyllid ID: psy4227


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------
MAARSDFEKNLLKKFVRGRRFRQPVLKERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPTTDETSIKSEKPSPAKSTTNRIRDSITKPSDTTAALRKSLDLTNKKEGESLDLTNKKKKKKKKKKKKKKKKN
cccccccccccccccccccccccccccccEEEccccccccccccccccccEEEEcccccccccccEEEEccEEEEEccccEEEcccccccccccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccc
ccccccccHcHHHHccccccccccccccEEEEEEEccccccccEEEccccEEEEEEEcccccccEEEEEcccEEEcccccEEEcccccccccccccccccccccccccccccccccccccccccEcccccccccEEEEEcccccccccccccccccc
MAARSDFEKNLLKKFVrgrrfrqpvlKERCKvlypyeaqnedeltlkeEDIVVLISrdapdkgwwkgelhgrvglfpdnfvtvlpttdetsiksekpspaksttnrirdsitkpsdtTAALRKSLdltnkkegesldltNKKKKKKKKKkkkkkkkn
maarsdfeknllkkfvrgrrfrqpvlkerckvlypyeaqnedeltlkEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPttdetsiksekpspaksttnrirdsitkpsdttaalrksldltnkkegesldltnkkkkkkkkkkkkkkkkn
MAARSDFEKNLLKKFVRGRRFRQPVLKERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPTTDETSIKSEKPSPAKSTTNRIRDSITKPSDTTAALRKSLDLTNKKEGESLDLTNkkkkkkkkkkkkkkkkN
**********LLKKFVRGRRFRQPVLKERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLP************************************************************************
****S*************************KVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVT***************************************************************************
MAARSDFEKNLLKKFVRGRRFRQPVLKERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPTT*******************IRDSITKPSDTTAALRKSLDLTNKKEGESLDLT******************
*********N***KFVR*RRFRQPVLKERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLP************************************RKSLDLTNKKEGESLDLTNK****************
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAARSDFEKNLLKKFVRGRRFRQPVLKERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPTTDETSIKSEKPSPAKSTTNRIRDSITKPSDTTAALRKSLDLTNKKEGESxxxxxxxxxxxxxxxxxxxxxN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query157 2.2.26 [Sep-21-2011]
Q925Q9 709 SH3 domain-containing kin no N/A 0.369 0.081 0.666 1e-20
Q8R550 709 SH3 domain-containing kin no N/A 0.369 0.081 0.666 1e-20
Q96B97 665 SH3 domain-containing kin no N/A 0.363 0.085 0.677 2e-20
Q9JLQ0 637 CD2-associated protein OS no N/A 0.382 0.094 0.516 4e-15
Q9Y5K6 639 CD2-associated protein OS no N/A 0.382 0.093 0.516 7e-15
Q7TSG5 549 SH3 domain-containing pro no N/A 0.369 0.105 0.482 3e-12
Q4R729 692 SH3 domain-containing pro N/A N/A 0.369 0.083 0.5 5e-12
A4FU49 640 SH3 domain-containing pro no N/A 0.369 0.090 0.482 3e-11
Q9WVE91217 Intersectin-1 OS=Rattus n no N/A 0.350 0.045 0.491 2e-10
E9Q6341107 Unconventional myosin-Ie no N/A 0.324 0.046 0.509 2e-10
>sp|Q925Q9|SH3K1_RAT SH3 domain-containing kinase-binding protein 1 OS=Rattus norvegicus GN=Sh3kbp1 PE=1 SV=2 Back     alignment and function desciption
 Score = 98.6 bits (244), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 40/60 (66%), Positives = 52/60 (86%)

Query: 27  KERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPT 86
           K+ CKV++PYEAQN+DELT+KE DIV LI++D  D GWW+GEL+GR G+FPDNFV +LP+
Sbjct: 313 KDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPS 372




Adapter protein involved in regulating diverse signal transduction pathways. Involved in the regulation of endocytosis and lysosomal degradation of ligand-induced receptor tyrosine kinases, including EGFR and MET/hepatocyte growth factor receptor, through a association with CBL and endophilins. The association with CBL, and thus the receptor internalization, may inhibited by an interaction with PDCD6IP and/or SPRY2. Involved in regulation of ligand-dependent endocytosis of the IgE receptor (By similarity). Attenuates phosphatidylinositol 3-kinase activity by interaction with its regulatory subunit. May be involved in regulation of cell adhesion; promotes the interaction between TTK2B and PDCD6IP. May be involved in the regulation of cellular stress response via the MAPK pathways through its interaction with MAP3K4. Is involved in modulation of tumor necrosis factor mediated apoptosis. Plays a role in the regulation of cell morphology and cytoskeletal organization. Required in the control of cell shape and migration.
Rattus norvegicus (taxid: 10116)
>sp|Q8R550|SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus GN=Sh3kbp1 PE=1 SV=1 Back     alignment and function description
>sp|Q96B97|SH3K1_HUMAN SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens GN=SH3KBP1 PE=1 SV=2 Back     alignment and function description
>sp|Q9JLQ0|CD2AP_MOUSE CD2-associated protein OS=Mus musculus GN=Cd2ap PE=1 SV=3 Back     alignment and function description
>sp|Q9Y5K6|CD2AP_HUMAN CD2-associated protein OS=Homo sapiens GN=CD2AP PE=1 SV=1 Back     alignment and function description
>sp|Q7TSG5|SH321_MOUSE SH3 domain-containing protein 21 OS=Mus musculus GN=Sh3d21 PE=1 SV=1 Back     alignment and function description
>sp|Q4R729|SH321_MACFA SH3 domain-containing protein 21 OS=Macaca fascicularis GN=SH3D21 PE=2 SV=1 Back     alignment and function description
>sp|A4FU49|SH321_HUMAN SH3 domain-containing protein 21 OS=Homo sapiens GN=SH3D21 PE=2 SV=2 Back     alignment and function description
>sp|Q9WVE9|ITSN1_RAT Intersectin-1 OS=Rattus norvegicus GN=Itsn1 PE=1 SV=1 Back     alignment and function description
>sp|E9Q634|MYO1E_MOUSE Unconventional myosin-Ie OS=Mus musculus GN=Myo1e PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
357625097 741 dab2-interacting protein [Danaus plexipp 0.617 0.130 0.530 5e-24
332028543 565 SH3 domain-containing kinase-binding pro 0.656 0.182 0.523 4e-23
307197094 760 Ras-related protein Rab-8A [Harpegnathos 0.656 0.135 0.552 8e-23
270002104 611 hypothetical protein TcasGA2_TC001058 [T 0.636 0.163 0.521 9e-22
189234607 774 PREDICTED: similar to dab2-interacting p 0.636 0.129 0.521 1e-21
307180591 562 SH3 domain-containing kinase-binding pro 0.343 0.096 0.687 2e-21
345486941 530 PREDICTED: hypothetical protein LOC10067 0.617 0.183 0.485 1e-20
193636453 611 PREDICTED: CD2-associated protein-like [ 0.547 0.140 0.509 1e-19
431909755 720 SH3 domain-containing kinase-binding pro 0.369 0.080 0.683 2e-19
449482834 601 PREDICTED: SH3 domain-containing kinase- 0.369 0.096 0.666 2e-19
>gi|357625097|gb|EHJ75648.1| dab2-interacting protein [Danaus plexippus] Back     alignment and taxonomy information
 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 72/98 (73%), Gaps = 1/98 (1%)

Query: 26  LKERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLP 85
           +KE C+VL+PY A NEDELTL E DIV ++S++APD+GWWKGELHGRVG FPDNFV +LP
Sbjct: 157 VKELCRVLFPYTAVNEDELTLSEGDIVSIVSKEAPDRGWWKGELHGRVGFFPDNFVQLLP 216

Query: 86  TTDETSIKSEKPSPAKSTTNRIRDSITKPSDTTAALRK 123
              +  ++ +KP    S TN +   + K S+ TA++++
Sbjct: 217 AVAQ-EVEEKKPDRPSSKTNSLYPVLNKYSEKTASVKE 253




Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332028543|gb|EGI68580.1| SH3 domain-containing kinase-binding protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307197094|gb|EFN78462.1| Ras-related protein Rab-8A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|270002104|gb|EEZ98551.1| hypothetical protein TcasGA2_TC001058 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189234607|ref|XP_975138.2| PREDICTED: similar to dab2-interacting protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307180591|gb|EFN68546.1| SH3 domain-containing kinase-binding protein 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|345486941|ref|XP_003425592.1| PREDICTED: hypothetical protein LOC100678847 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|193636453|ref|XP_001951086.1| PREDICTED: CD2-associated protein-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|431909755|gb|ELK12901.1| SH3 domain-containing kinase-binding protein 1 [Pteropus alecto] Back     alignment and taxonomy information
>gi|449482834|ref|XP_002193310.2| PREDICTED: SH3 domain-containing kinase-binding protein 1 isoform 1 [Taeniopygia guttata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query157
UNIPROTKB|F1NKX7 739 SH3KBP1 "Uncharacterized prote 0.713 0.151 0.438 6e-20
UNIPROTKB|B7Z6E8 404 SH3KBP1 "SH3 domain-containing 0.464 0.180 0.581 6.4e-20
MGI|MGI:1889583 709 Sh3kbp1 "SH3-domain kinase bin 0.464 0.102 0.594 7.1e-20
RGD|620904 709 Sh3kbp1 "SH3-domain kinase bin 0.464 0.102 0.594 7.1e-20
UNIPROTKB|F1MVN9 629 SH3KBP1 "Uncharacterized prote 0.464 0.116 0.581 2.5e-19
UNIPROTKB|Q96B97 665 SH3KBP1 "SH3 domain-containing 0.464 0.109 0.581 2.8e-19
FB|FBgn0027598 882 cindr "CIN85 and CD2AP ortholo 0.675 0.120 0.415 2e-18
MGI|MGI:1330281 637 Cd2ap "CD2-associated protein" 0.656 0.161 0.414 7.7e-17
ZFIN|ZDB-GENE-030131-8078 657 cd2ap "CD2-associated protein" 0.681 0.162 0.361 1.7e-16
UNIPROTKB|F1MM14 637 CD2AP "Uncharacterized protein 0.509 0.125 0.481 3.4e-16
UNIPROTKB|F1NKX7 SH3KBP1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
 Score = 247 (92.0 bits), Expect = 6.0e-20, P = 6.0e-20
 Identities = 53/121 (43%), Positives = 73/121 (60%)

Query:    27 KERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPT 86
             KE CKV++PYEAQN+DELT++E D+V LIS+D  D GWW+GEL+GR G+FPDNFV +LP+
Sbjct:   344 KEYCKVIFPYEAQNDDELTIREGDVVTLISKDCIDVGWWEGELNGRRGVFPDNFVKLLPS 403

Query:    87 TDETSIKSEKPSPAK-------STTNRIRDSITKPSDTTAALRKSLDLTNKKEGES--LD 137
               E     + P P+         TT+R ++    P +    L    +   + E E   LD
Sbjct:   404 DFEKERPKKPPPPSAPVVKQGLGTTDRKQEVKKVPPERPECLPNRTEEKERSEREQKQLD 463

Query:   138 L 138
             L
Sbjct:   464 L 464


GO:0007010 "cytoskeleton organization" evidence=IEA
GO:0008360 "regulation of cell shape" evidence=IEA
GO:0016477 "cell migration" evidence=IEA
UNIPROTKB|B7Z6E8 SH3KBP1 "SH3 domain-containing kinase-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1889583 Sh3kbp1 "SH3-domain kinase binding protein 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620904 Sh3kbp1 "SH3-domain kinase binding protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1MVN9 SH3KBP1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q96B97 SH3KBP1 "SH3 domain-containing kinase-binding protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0027598 cindr "CIN85 and CD2AP orthologue" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
MGI|MGI:1330281 Cd2ap "CD2-associated protein" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8078 cd2ap "CD2-associated protein" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MM14 CD2AP "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
cd1187555 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 do 7e-30
cd1205756 cd12057, SH3_CIN85_3, Third Src Homology 3 domain 1e-26
cd1205657 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain 7e-23
cd1214255 cd12142, SH3_D21-like, Src Homology 3 domain of SH 5e-21
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 2e-19
smart0032656 smart00326, SH3, Src homology 3 domains 6e-19
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 9e-19
cd1187453 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 d 3e-18
cd1182753 cd11827, SH3_MyoIe_If_like, Src homology 3 domain 5e-18
cd1187353 cd11873, SH3_CD2AP-like_1, First Src Homology 3 do 1e-17
cd1180355 cd11803, SH3_Endophilin_A, Src homology 3 domain o 1e-16
cd1187658 cd11876, SH3_MLK, Src Homology 3 domain of Mixed L 2e-16
cd1182353 cd11823, SH3_Nostrin, Src homology 3 domain of Nit 6e-16
cd1176257 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain 6e-16
cd1183655 cd11836, SH3_Intersectin_1, First Src homology 3 d 7e-16
cd1182652 cd11826, SH3_Abi, Src homology 3 domain of Abl Int 2e-15
cd1205958 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixe 3e-15
cd1205253 cd12052, SH3_CIN85_1, First Src Homology 3 domain 3e-15
cd1195953 cd11959, SH3_Cortactin, Src homology 3 domain of C 4e-15
cd1205858 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed 4e-15
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 1e-14
cd1196153 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src 1e-14
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 2e-14
cd1207355 cd12073, SH3_HS1, Src homology 3 domain of Hematop 3e-14
cd1187753 cd11877, SH3_PIX, Src Homology 3 domain of Pak Int 5e-14
cd1176355 cd11763, SH3_SNX9_like, Src Homology 3 domain of S 1e-13
cd1181954 cd11819, SH3_Cortactin_like, Src homology 3 domain 2e-13
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 3e-13
cd1176653 cd11766, SH3_Nck_2, Second Src Homology 3 domain o 3e-13
cd1205455 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain 3e-13
cd1181651 cd11816, SH3_Eve1_3, Third Src homology 3 domain o 4e-13
cd1205553 cd12055, SH3_CIN85_2, Second Src Homology 3 domain 4e-13
cd1179651 cd11796, SH3_DNMBP_N3, Third N-terminal Src homolo 5e-13
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 1e-12
cd1176157 cd11761, SH3_FCHSD_1, First Src Homology 3 domain 2e-12
cd1199654 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 3e-12
cd1197758 cd11977, SH3_VAV2_2, C-terminal (or second) Src ho 6e-12
cd1195053 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do 6e-12
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 7e-12
pfam0001847 pfam00018, SH3_1, SH3 domain 8e-12
cd1178153 cd11781, SH3_Sorbs_1, First Src Homology 3 domain 1e-11
cd1189456 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domai 1e-11
cd1184154 cd11841, SH3_SH3YL1_like, Src homology 3 domain of 1e-11
cd1182153 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP 2e-11
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 2e-11
cd1184353 cd11843, SH3_PACSIN, Src homology 3 domain of Prot 2e-11
cd1196054 cd11960, SH3_Abp1_eu, Src homology 3 domain of eum 8e-11
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 9e-11
cd1183054 cd11830, SH3_VAV_2, C-terminal (or second) Src hom 9e-11
cd1197654 cd11976, SH3_VAV1_2, C-terminal (or second) Src ho 9e-11
cd1195256 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of 1e-10
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 2e-10
cd1205356 cd12053, SH3_CD2AP_1, First Src Homology 3 domain 3e-10
cd1177851 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain 3e-10
cd1178055 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Ho 3e-10
cd1178653 cd11786, SH3_SH3RF_1, First Src Homology 3 domain 3e-10
cd1198857 cd11988, SH3_Intersectin2_1, First Src homology 3 3e-10
cd1182554 cd11825, SH3_PLCgamma, Src homology 3 domain of Ph 4e-10
cd1183958 cd11839, SH3_Intersectin_4, Fourth Src homology 3 5e-10
cd1189558 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domai 1e-09
cd1181252 cd11812, SH3_AHI-1, Src Homology 3 domain of Abels 1e-09
cd1177357 cd11773, SH3_Sla1p_1, First Src Homology 3 domain 1e-09
cd1198755 cd11987, SH3_Intersectin1_1, First Src homology 3 1e-09
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 2e-09
cd1177160 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain 2e-09
cd1183852 cd11838, SH3_Intersectin_3, Third Src homology 3 d 3e-09
cd1196254 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src h 5e-09
cd1184255 cd11842, SH3_Ysc84p_like, Src homology 3 domain of 5e-09
cd1192155 cd11921, SH3_Vinexin_1, First Src Homology 3 domai 7e-09
cd1200057 cd12000, SH3_CASS4, Src homology 3 domain of CAS ( 8e-09
cd1197261 cd11972, SH3_Abi2, Src homology 3 domain of Abl In 8e-09
cd1200362 cd12003, SH3_EFS, Src homology 3 domain of CAS (Cr 1e-08
cd1177557 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain 1e-08
cd1179355 cd11793, SH3_ephexin1_like, Src homology 3 domain 1e-08
cd1179064 cd11790, SH3_Amphiphysin, Src Homology 3 domain of 1e-08
cd1204653 cd12046, SH3_p67phox_C, C-terminal (or second) Src 2e-08
cd1181850 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain o 2e-08
cd1180757 cd11807, SH3_ASPP, Src homology 3 domain of Apopto 2e-08
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 2e-08
cd1179159 cd11791, SH3_UBASH3, Src homology 3 domain of Ubiq 2e-08
cd1196557 cd11965, SH3_ASAP1, Src homology 3 domain of ArfGA 3e-08
cd1180953 cd11809, SH3_srGAP, Src homology 3 domain of Slit- 4e-08
cd1190155 cd11901, SH3_Nck1_2, Second Src Homology 3 domain 5e-08
cd1197856 cd11978, SH3_VAV3_2, C-terminal (or second) Src ho 5e-08
cd1184456 cd11844, SH3_CAS, Src homology 3 domain of CAS (Cr 5e-08
cd1192754 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain 6e-08
cd1199856 cd11998, SH3_PACSIN1-2, Src homology 3 domain of P 7e-08
cd1199756 cd11997, SH3_PACSIN3, Src homology 3 domain of Pro 8e-08
cd1206058 cd12060, SH3_alphaPIX, Src Homology 3 domain of al 8e-08
cd1192055 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain 8e-08
cd1181750 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain 1e-07
cd1190255 cd11902, SH3_Nck2_2, Second Src Homology 3 domain 1e-07
cd1199152 cd11991, SH3_Intersectin1_3, Third Src homology 3 1e-07
cd1196656 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGA 1e-07
cd1188254 cd11882, SH3_GRAF-like, Src Homology 3 domain of G 1e-07
cd1206154 cd12061, SH3_betaPIX, Src Homology 3 domain of bet 2e-07
cd1195655 cd11956, SH3_srGAP4, Src homology 3 domain of Slit 2e-07
cd1204453 cd12044, SH3_SKAP1, Src Homology 3 domain of Src K 2e-07
cd1178555 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homo 2e-07
cd1183554 cd11835, SH3_ARHGAP32_33, Src homology 3 domain of 3e-07
cd1186653 cd11866, SH3_SKAP1-like, Src Homology 3 domain of 3e-07
cd1191955 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain 3e-07
cd1190457 cd11904, SH3_Nck1_3, Third Src Homology 3 domain o 4e-07
cd1178955 cd11789, SH3_Nebulin_family_C, C-terminal Src Homo 4e-07
cd1183353 cd11833, SH3_Stac_1, First C-terminal Src homology 5e-07
cd1185653 cd11856, SH3_p47phox_like, Src homology 3 domains 5e-07
cd1191155 cd11911, SH3_CIP4-like, Src Homology 3 domain of C 5e-07
cd1192854 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain 5e-07
cd1200168 cd12001, SH3_BCAR1, Src homology 3 domain of the C 6e-07
cd1181353 cd11813, SH3_SGSM3, Src Homology 3 domain of Small 6e-07
cd1204553 cd12045, SH3_SKAP2, Src Homology 3 domain of Src K 6e-07
cd1193558 cd11935, SH3_Nebulette_C, C-terminal Src Homology 8e-07
cd1192954 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain 8e-07
cd1176756 cd11767, SH3_Nck_3, Third Src Homology 3 domain of 9e-07
cd1187053 cd11870, SH3_p67phox-like_C, C-terminal Src Homolo 1e-06
cd1197159 cd11971, SH3_Abi1, Src homology 3 domain of Abl In 1e-06
cd1198553 cd11985, SH3_Stac2_C, C-terminal Src homology 3 do 1e-06
cd1199252 cd11992, SH3_Intersectin2_3, Third Src homology 3 2e-06
cd1181552 cd11815, SH3_Eve1_2, Second Src homology 3 domain 2e-06
cd1178455 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain 2e-06
cd1182952 cd11829, SH3_GAS7, Src homology 3 domain of Growth 2e-06
cd1193662 cd11936, SH3_UBASH3B, Src homology 3 domain of Ubi 3e-06
cd1188355 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 3e-06
cd1214072 cd12140, SH3_Amphiphysin_I, Src Homology 3 domain 3e-06
cd1191858 cd11918, SH3_Vinexin_3, Third (or C-terminal) Src 4e-06
cd1178753 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain 5e-06
cd1180452 cd11804, SH3_GRB2_like_N, N-terminal Src homology 5e-06
cd1204753 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 do 5e-06
cd1188456 cd11884, SH3_MYO15, Src Homology 3 domain of Myosi 6e-06
cd1178355 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain 6e-06
cd1192655 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain 7e-06
cd1197060 cd11970, SH3_PLCgamma1, Src homology 3 domain of P 7e-06
cd1191659 cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src H 8e-06
cd1196955 cd11969, SH3_PLCgamma2, Src homology 3 domain of P 8e-06
cd1195457 cd11954, SH3_ASPP1, Src Homology 3 domain of Apopt 8e-06
cd1202453 cd12024, SH3_NoxO1_2, Second or C-terminal Src hom 8e-06
cd1199956 cd11999, SH3_PACSIN_like, Src homology 3 domain of 9e-06
cd1200257 cd12002, SH3_NEDD9, Src homology 3 domain of CAS ( 1e-05
cd1188655 cd11886, SH3_BOI, Src Homology 3 domain of fungal 1e-05
cd1194854 cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom 1e-05
cd1194752 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 do 1e-05
cd1188953 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of 1e-05
cd1201262 cd12012, SH3_RIM-BP_2, Second Src homology 3 domai 2e-05
cd1183753 cd11837, SH3_Intersectin_2, Second Src homology 3 2e-05
cd1191255 cd11912, SH3_Bzz1_1, First Src Homology 3 domain o 2e-05
cd1195357 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of 2e-05
cd1186954 cd11869, SH3_p40phox, Src Homology 3 domain of the 2e-05
cd1193358 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 3e-05
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 3e-05
cd1206554 cd12065, SH3_GRAF2, Src Homology 3 domain of GTPas 3e-05
cd1190359 cd11903, SH3_Nck2_3, Third Src Homology 3 domain o 3e-05
cd1207654 cd12076, SH3_Tks4_2, Second Src homology 3 domain 3e-05
cd1182853 cd11828, SH3_ARHGEF9_like, Src homology 3 domain o 4e-05
cd1193459 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 do 4e-05
cd1178253 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain 4e-05
cd1180057 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src 5e-05
cd1198952 cd11989, SH3_Intersectin1_2, Second Src homology 3 7e-05
cd1189755 cd11897, SH3_SNX18, Src Homology 3 domain of Sorti 7e-05
cd1186458 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of 7e-05
cd1186555 cd11865, SH3_Nbp2-like, Src Homology 3 domain of S 8e-05
cd1207257 cd12072, SH3_FNBP1L, Src Homology 3 domain of Form 9e-05
cd1198252 cd11982, SH3_Shank1, Src homology 3 domain of SH3 1e-04
cd1199365 cd11993, SH3_Intersectin1_4, Fourth Src homology 3 1e-04
cd1180252 cd11802, SH3_Endophilin_B, Src homology 3 domain o 1e-04
cd1177755 cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain 1e-04
cd1177957 cd11779, SH3_Irsp53_BAIAP2L, Src Homology 3 domain 1e-04
cd1179750 cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homol 2e-04
cd1183250 cd11832, SH3_Shank, Src homology 3 domain of SH3 a 2e-04
cd1206780 cd12067, SH3_MYO15A, Src Homology 3 domain of Myos 2e-04
cd1214157 cd12141, SH3_DNMBP_C2, Second C-terminal Src homol 2e-04
cd1176454 cd11764, SH3_Eps8, Src Homology 3 domain of Epider 2e-04
cd1199052 cd11990, SH3_Intersectin2_2, Second Src homology 3 2e-04
cd1185855 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain 3e-04
cd1195553 cd11955, SH3_srGAP1-3, Src homology 3 domain of Sl 4e-04
cd1193257 cd11932, SH3_SH3RF2_2, Second Src Homology 3 domai 4e-04
cd1180653 cd11806, SH3_PRMT2, Src homology 3 domain of Prote 4e-04
cd1201361 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain 5e-04
cd1180853 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain 5e-04
cd1193955 cd11939, SH3_ephexin1, Src homology 3 domain of th 6e-04
cd1191761 cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src H 7e-04
cd1194656 cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom 8e-04
cd1198352 cd11983, SH3_Shank2, Src homology 3 domain of SH3 0.001
cd1206655 cd12066, SH3_GRAF3, Src Homology 3 domain of GTPas 0.001
cd1192357 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domai 0.001
cd1206456 cd12064, SH3_GRAF, Src Homology 3 domain of GTPase 0.001
cd1207157 cd12071, SH3_FBP17, Src Homology 3 domain of Formi 0.002
cd1194561 cd11945, SH3_Endophilin_B1, Src homology 3 domain 0.002
cd1188555 cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 d 0.003
cd1198653 cd11986, SH3_Stac3_1, First C-terminal Src homolog 0.003
cd1177054 cd11770, SH3_Nephrocystin, Src Homology 3 domain o 0.003
cd1193055 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domai 0.003
cd1176957 cd11769, SH3_CSK, Src Homology 3 domain of C-termi 0.003
cd1176854 cd11768, SH3_Tec_like, Src Homology 3 domain of Te 0.003
cd1201654 cd12016, SH3_Tks_2, Second Src homology 3 domain o 0.003
cd1192557 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain 0.004
cd1197373 cd11973, SH3_ASEF, Src homology 3 domain of APC-St 0.004
>gnl|CDD|212808 cd11875, SH3_CD2AP-like_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein and similar proteins Back     alignment and domain information
 Score =  102 bits (257), Expect = 7e-30
 Identities = 35/55 (63%), Positives = 46/55 (83%)

Query: 29 RCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTV 83
          + +VL+ YEA+NEDELTL+E DIV ++S+D  DKGWWKGEL+G+ G+FPDNFV  
Sbjct: 1  KARVLFDYEAENEDELTLREGDIVTILSKDCEDKGWWKGELNGKRGVFPDNFVEP 55


This subfamily is composed of the third SH3 domain (SH3C) of CD2AP, CIN85 (Cbl-interacting protein of 85 kDa), and similar domains. CD2AP and CIN85 are adaptor proteins that bind to protein partners and assemble complexes that have been implicated in T cell activation, kidney function, and apoptosis of neuronal cells. They also associate with endocytic proteins, actin cytoskeleton components, and other adaptor proteins involved in receptor tyrosine kinase (RTK) signaling. CD2AP and the main isoform of CIN85 contain three SH3 domains, a proline-rich region, and a C-terminal coiled-coil domain. All of these domains enable CD2AP and CIN85 to bind various protein partners and assemble complexes that have been implicated in many different functions. SH3C of both proteins have been shown to bind to ubiquitin. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 55

>gnl|CDD|212990 cd12057, SH3_CIN85_3, Third Src Homology 3 domain (SH3C) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212989 cd12056, SH3_CD2AP_3, Third Src Homology 3 domain (SH3C) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|213018 cd12142, SH3_D21-like, Src Homology 3 domain of SH3 domain-containing protein 21 (SH3D21) and similar proteins Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|212807 cd11874, SH3_CD2AP-like_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins Back     alignment and domain information
>gnl|CDD|212806 cd11873, SH3_CD2AP-like_1, First Src Homology 3 domain (SH3A) of CD2-associated protein and similar proteins Back     alignment and domain information
>gnl|CDD|212737 cd11803, SH3_Endophilin_A, Src homology 3 domain of Endophilin-A Back     alignment and domain information
>gnl|CDD|212809 cd11876, SH3_MLK, Src Homology 3 domain of Mixed Lineage Kinases Back     alignment and domain information
>gnl|CDD|212757 cd11823, SH3_Nostrin, Src homology 3 domain of Nitric Oxide Synthase TRaffic INducer Back     alignment and domain information
>gnl|CDD|212696 cd11762, SH3_FCHSD_2, Second Src Homology 3 domain of FCH and double SH3 domains proteins Back     alignment and domain information
>gnl|CDD|212770 cd11836, SH3_Intersectin_1, First Src homology 3 domain (or SH3A) of Intersectin Back     alignment and domain information
>gnl|CDD|212760 cd11826, SH3_Abi, Src homology 3 domain of Abl Interactor proteins Back     alignment and domain information
>gnl|CDD|212992 cd12059, SH3_MLK1-3, Src Homology 3 domain of Mixed Lineage Kinases 1, 2, and 3 Back     alignment and domain information
>gnl|CDD|212985 cd12052, SH3_CIN85_1, First Src Homology 3 domain (SH3A) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212892 cd11959, SH3_Cortactin, Src homology 3 domain of Cortactin Back     alignment and domain information
>gnl|CDD|212991 cd12058, SH3_MLK4, Src Homology 3 domain of Mixed Lineage Kinase 4 Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212894 cd11961, SH3_Abp1_fungi_C2, Second C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|213006 cd12073, SH3_HS1, Src homology 3 domain of Hematopoietic lineage cell-specific protein 1 Back     alignment and domain information
>gnl|CDD|212810 cd11877, SH3_PIX, Src Homology 3 domain of Pak Interactive eXchange factors Back     alignment and domain information
>gnl|CDD|212697 cd11763, SH3_SNX9_like, Src Homology 3 domain of Sorting Nexin 9 and similar proteins Back     alignment and domain information
>gnl|CDD|212753 cd11819, SH3_Cortactin_like, Src homology 3 domain of Cortactin and related proteins Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|212700 cd11766, SH3_Nck_2, Second Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212987 cd12054, SH3_CD2AP_2, Second Src Homology 3 domain (SH3B) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212750 cd11816, SH3_Eve1_3, Third Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212988 cd12055, SH3_CIN85_2, Second Src Homology 3 domain (SH3B) of Cbl-interacting protein of 85 kDa Back     alignment and domain information
>gnl|CDD|212730 cd11796, SH3_DNMBP_N3, Third N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|212695 cd11761, SH3_FCHSD_1, First Src Homology 3 domain of FCH and double SH3 domains proteins Back     alignment and domain information
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212910 cd11977, SH3_VAV2_2, C-terminal (or second) Src homology 3 domain of VAV2 protein Back     alignment and domain information
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212715 cd11781, SH3_Sorbs_1, First Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212827 cd11894, SH3_FCHSD2_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 2 Back     alignment and domain information
>gnl|CDD|212775 cd11841, SH3_SH3YL1_like, Src homology 3 domain of SH3 domain containing Ysc84-like 1 (SH3YL1) protein Back     alignment and domain information
>gnl|CDD|212755 cd11821, SH3_ASAP, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing proteins Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212777 cd11843, SH3_PACSIN, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212893 cd11960, SH3_Abp1_eu, Src homology 3 domain of eumetazoan Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|212764 cd11830, SH3_VAV_2, C-terminal (or second) Src homology 3 domain of VAV proteins Back     alignment and domain information
>gnl|CDD|212909 cd11976, SH3_VAV1_2, C-terminal (or second) Src homology 3 domain of VAV1 protein Back     alignment and domain information
>gnl|CDD|212885 cd11952, SH3_iASPP, Src Homology 3 (SH3) domain of Inhibitor of ASPP protein (iASPP) Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212986 cd12053, SH3_CD2AP_1, First Src Homology 3 domain (SH3A) of CD2-associated protein Back     alignment and domain information
>gnl|CDD|212712 cd11778, SH3_Bzz1_2, Second Src Homology 3 domain of Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212714 cd11780, SH3_Sorbs_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|212921 cd11988, SH3_Intersectin2_1, First Src homology 3 domain (or SH3A) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212759 cd11825, SH3_PLCgamma, Src homology 3 domain of Phospholipase C (PLC) gamma Back     alignment and domain information
>gnl|CDD|212773 cd11839, SH3_Intersectin_4, Fourth Src homology 3 domain (or SH3D) of Intersectin Back     alignment and domain information
>gnl|CDD|212828 cd11895, SH3_FCHSD1_2, Second Src Homology 3 domain of FCH and double SH3 domains protein 1 Back     alignment and domain information
>gnl|CDD|212746 cd11812, SH3_AHI-1, Src Homology 3 domain of Abelson helper integration site-1 (AHI-1) Back     alignment and domain information
>gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212920 cd11987, SH3_Intersectin1_1, First Src homology 3 domain (or SH3A) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212705 cd11771, SH3_Pex13p_fungal, Src Homology 3 domain of fungal peroxisomal membrane protein Pex13p Back     alignment and domain information
>gnl|CDD|212772 cd11838, SH3_Intersectin_3, Third Src homology 3 domain (or SH3C) of Intersectin Back     alignment and domain information
>gnl|CDD|212895 cd11962, SH3_Abp1_fungi_C1, First C-terminal Src homology 3 domain of Fungal Actin-binding protein 1 Back     alignment and domain information
>gnl|CDD|212776 cd11842, SH3_Ysc84p_like, Src homology 3 domain of Ysc84p and similar fungal proteins Back     alignment and domain information
>gnl|CDD|212854 cd11921, SH3_Vinexin_1, First Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|212933 cd12000, SH3_CASS4, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member 4 Back     alignment and domain information
>gnl|CDD|212905 cd11972, SH3_Abi2, Src homology 3 domain of Abl Interactor 2 Back     alignment and domain information
>gnl|CDD|212936 cd12003, SH3_EFS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Embryonal Fyn-associated Substrate Back     alignment and domain information
>gnl|CDD|212709 cd11775, SH3_Sla1p_3, Third Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212727 cd11793, SH3_ephexin1_like, Src homology 3 domain of ephexin-1-like SH3 domain containing Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212724 cd11790, SH3_Amphiphysin, Src Homology 3 domain of Amphiphysin and related domains Back     alignment and domain information
>gnl|CDD|212979 cd12046, SH3_p67phox_C, C-terminal (or second) Src Homology 3 domain of the p67phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212752 cd11818, SH3_Eve1_5, Fifth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212741 cd11807, SH3_ASPP, Src homology 3 domain of Apoptosis Stimulating of p53 proteins (ASPP) Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|212725 cd11791, SH3_UBASH3, Src homology 3 domain of Ubiquitin-associated and SH3 domain-containing proteins, also called TULA (T cell Ubiquitin LigAnd) family of proteins Back     alignment and domain information
>gnl|CDD|212898 cd11965, SH3_ASAP1, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 1 Back     alignment and domain information
>gnl|CDD|212743 cd11809, SH3_srGAP, Src homology 3 domain of Slit-Robo GTPase Activating Proteins Back     alignment and domain information
>gnl|CDD|212834 cd11901, SH3_Nck1_2, Second Src Homology 3 domain of Nck1 adaptor protein Back     alignment and domain information
>gnl|CDD|212911 cd11978, SH3_VAV3_2, C-terminal (or second) Src homology 3 domain of VAV3 protein Back     alignment and domain information
>gnl|CDD|212778 cd11844, SH3_CAS, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding proteins Back     alignment and domain information
>gnl|CDD|212860 cd11927, SH3_SH3RF1_1, First Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212931 cd11998, SH3_PACSIN1-2, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 1 (PACSIN1) and PACSIN 2 Back     alignment and domain information
>gnl|CDD|212930 cd11997, SH3_PACSIN3, Src homology 3 domain of Protein kinase C and Casein kinase Substrate in Neurons 3 (PACSIN3) Back     alignment and domain information
>gnl|CDD|212993 cd12060, SH3_alphaPIX, Src Homology 3 domain of alpha-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212853 cd11920, SH3_Sorbs2_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212751 cd11817, SH3_Eve1_4, Fourth Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212835 cd11902, SH3_Nck2_2, Second Src Homology 3 domain of Nck2 adaptor protein Back     alignment and domain information
>gnl|CDD|212924 cd11991, SH3_Intersectin1_3, Third Src homology 3 domain (or SH3C) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212899 cd11966, SH3_ASAP2, Src homology 3 domain of ArfGAP with SH3 domain, ankyrin repeat and PH domain containing protein 2 Back     alignment and domain information
>gnl|CDD|212815 cd11882, SH3_GRAF-like, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase and similar proteins Back     alignment and domain information
>gnl|CDD|212994 cd12061, SH3_betaPIX, Src Homology 3 domain of beta-Pak Interactive eXchange factor Back     alignment and domain information
>gnl|CDD|212889 cd11956, SH3_srGAP4, Src homology 3 domain of Slit-Robo GTPase Activating Protein 4 Back     alignment and domain information
>gnl|CDD|212977 cd12044, SH3_SKAP1, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 Back     alignment and domain information
>gnl|CDD|212719 cd11785, SH3_SH3RF_C, C-terminal (Fourth) Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|212769 cd11835, SH3_ARHGAP32_33, Src homology 3 domain of Rho GTPase-activating proteins 32 and 33, and similar proteins Back     alignment and domain information
>gnl|CDD|212800 cd11866, SH3_SKAP1-like, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 1 and similar proteins Back     alignment and domain information
>gnl|CDD|212852 cd11919, SH3_Sorbs1_1, First Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212837 cd11904, SH3_Nck1_3, Third Src Homology 3 domain of Nck1 adaptor protein Back     alignment and domain information
>gnl|CDD|212723 cd11789, SH3_Nebulin_family_C, C-terminal Src Homology 3 domain of the Nebulin family of proteins Back     alignment and domain information
>gnl|CDD|212767 cd11833, SH3_Stac_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing (Stac) proteins Back     alignment and domain information
>gnl|CDD|212790 cd11856, SH3_p47phox_like, Src homology 3 domains of the p47phox subunit of NADPH oxidase and similar domains Back     alignment and domain information
>gnl|CDD|212844 cd11911, SH3_CIP4-like, Src Homology 3 domain of Cdc42-Interacting Protein 4 Back     alignment and domain information
>gnl|CDD|212861 cd11928, SH3_SH3RF3_1, First Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212934 cd12001, SH3_BCAR1, Src homology 3 domain of the CAS (Crk-Associated Substrate) scaffolding protein family member, Breast Cancer Anti-estrogen Resistance 1 Back     alignment and domain information
>gnl|CDD|212747 cd11813, SH3_SGSM3, Src Homology 3 domain of Small G protein Signaling Modulator 3 Back     alignment and domain information
>gnl|CDD|212978 cd12045, SH3_SKAP2, Src Homology 3 domain of Src Kinase-Associated Phosphoprotein 2 Back     alignment and domain information
>gnl|CDD|212868 cd11935, SH3_Nebulette_C, C-terminal Src Homology 3 domain of Nebulette and LIM-nebulette (or Lasp2) Back     alignment and domain information
>gnl|CDD|212862 cd11929, SH3_SH3RF2_1, First Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212803 cd11870, SH3_p67phox-like_C, C-terminal Src Homology 3 domain of the p67phox subunit of NADPH oxidase and similar proteins Back     alignment and domain information
>gnl|CDD|212904 cd11971, SH3_Abi1, Src homology 3 domain of Abl Interactor 1 Back     alignment and domain information
>gnl|CDD|212918 cd11985, SH3_Stac2_C, C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 2 (Stac2) Back     alignment and domain information
>gnl|CDD|212925 cd11992, SH3_Intersectin2_3, Third Src homology 3 domain (or SH3C) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212749 cd11815, SH3_Eve1_2, Second Src homology 3 domain of ADAM-binding protein Eve-1 Back     alignment and domain information
>gnl|CDD|212718 cd11784, SH3_SH3RF2_3, Third Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212763 cd11829, SH3_GAS7, Src homology 3 domain of Growth Arrest Specific protein 7 Back     alignment and domain information
>gnl|CDD|212869 cd11936, SH3_UBASH3B, Src homology 3 domain of Ubiquitin-associated and SH3 domain-containing protein B Back     alignment and domain information
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|213016 cd12140, SH3_Amphiphysin_I, Src Homology 3 domain of Amphiphysin I Back     alignment and domain information
>gnl|CDD|212851 cd11918, SH3_Vinexin_3, Third (or C-terminal) Src Homology 3 domain of Vinexin, also called Sorbin and SH3 domain containing 3 (Sorbs3) Back     alignment and domain information
>gnl|CDD|212721 cd11787, SH3_SH3RF_2, Second Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212980 cd12047, SH3_Noxa1_C, C-terminal Src Homology 3 domain of NADPH oxidase activator 1 Back     alignment and domain information
>gnl|CDD|212817 cd11884, SH3_MYO15, Src Homology 3 domain of Myosin XV Back     alignment and domain information
>gnl|CDD|212717 cd11783, SH3_SH3RF_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1 (SH3RF1), SH3RF3, and similar domains Back     alignment and domain information
>gnl|CDD|212859 cd11926, SH3_SH3RF1_3, Third Src Homology 3 domain of SH3 domain containing ring finger 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212903 cd11970, SH3_PLCgamma1, Src homology 3 domain of Phospholipase C (PLC) gamma 1 Back     alignment and domain information
>gnl|CDD|212849 cd11916, SH3_Sorbs1_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 1 (Sorbs1), also called ponsin Back     alignment and domain information
>gnl|CDD|212902 cd11969, SH3_PLCgamma2, Src homology 3 domain of Phospholipase C (PLC) gamma 2 Back     alignment and domain information
>gnl|CDD|212887 cd11954, SH3_ASPP1, Src Homology 3 domain of Apoptosis Stimulating of p53 protein 1 Back     alignment and domain information
>gnl|CDD|212957 cd12024, SH3_NoxO1_2, Second or C-terminal Src homology 3 domain of NADPH oxidase (Nox) Organizing protein 1 Back     alignment and domain information
>gnl|CDD|212932 cd11999, SH3_PACSIN_like, Src homology 3 domain of an unknown subfamily of proteins with similarity to Protein kinase C and Casein kinase Substrate in Neurons (PACSIN) proteins Back     alignment and domain information
>gnl|CDD|212935 cd12002, SH3_NEDD9, Src homology 3 domain of CAS (Crk-Associated Substrate) scaffolding protein family member, Neural precursor cell Expressed, Developmentally Down-regulated 9 Back     alignment and domain information
>gnl|CDD|212819 cd11886, SH3_BOI, Src Homology 3 domain of fungal BOI-like proteins Back     alignment and domain information
>gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212880 cd11947, SH3_GRAP2_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212822 cd11889, SH3_Cyk3p-like, Src Homology 3 domain of Cytokinesis protein 3 and similar proteins Back     alignment and domain information
>gnl|CDD|212945 cd12012, SH3_RIM-BP_2, Second Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212771 cd11837, SH3_Intersectin_2, Second Src homology 3 domain (or SH3B) of Intersectin Back     alignment and domain information
>gnl|CDD|212845 cd11912, SH3_Bzz1_1, First Src Homology 3 domain of Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212886 cd11953, SH3_ASPP2, Src Homology 3 (SH3) domain of Apoptosis Stimulating of p53 protein 2 Back     alignment and domain information
>gnl|CDD|212802 cd11869, SH3_p40phox, Src Homology 3 domain of the p40phox subunit of NADPH oxidase Back     alignment and domain information
>gnl|CDD|212866 cd11933, SH3_Nebulin_C, C-terminal Src Homology 3 domain of Nebulin Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212998 cd12065, SH3_GRAF2, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase 2 Back     alignment and domain information
>gnl|CDD|212836 cd11903, SH3_Nck2_3, Third Src Homology 3 domain of Nck2 adaptor protein Back     alignment and domain information
>gnl|CDD|213009 cd12076, SH3_Tks4_2, Second Src homology 3 domain of Tyrosine kinase substrate with four SH3 domains Back     alignment and domain information
>gnl|CDD|212762 cd11828, SH3_ARHGEF9_like, Src homology 3 domain of ARHGEF9-like Rho guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|212867 cd11934, SH3_Lasp1_C, C-terminal Src Homology 3 domain of LIM and SH3 domain protein 1 Back     alignment and domain information
>gnl|CDD|212716 cd11782, SH3_Sorbs_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing (Sorbs) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212734 cd11800, SH3_DNMBP_C2_like, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains Back     alignment and domain information
>gnl|CDD|212922 cd11989, SH3_Intersectin1_2, Second Src homology 3 domain (or SH3B) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212830 cd11897, SH3_SNX18, Src Homology 3 domain of Sorting nexin 18 Back     alignment and domain information
>gnl|CDD|212798 cd11864, SH3_PEX13_eumet, Src Homology 3 domain of eumetazoan Peroxisomal biogenesis factor 13 Back     alignment and domain information
>gnl|CDD|212799 cd11865, SH3_Nbp2-like, Src Homology 3 domain of Saccharomyces cerevisiae Nap1-binding protein 2 and similar fungal proteins Back     alignment and domain information
>gnl|CDD|213005 cd12072, SH3_FNBP1L, Src Homology 3 domain of Formin Binding Protein 1-Like Back     alignment and domain information
>gnl|CDD|212915 cd11982, SH3_Shank1, Src homology 3 domain of SH3 and multiple ankyrin repeat domains protein 1 Back     alignment and domain information
>gnl|CDD|212926 cd11993, SH3_Intersectin1_4, Fourth Src homology 3 domain (or SH3D) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212736 cd11802, SH3_Endophilin_B, Src homology 3 domain of Endophilin-B Back     alignment and domain information
>gnl|CDD|212711 cd11777, SH3_CIP4_Bzz1_like, Src Homology 3 domain of Cdc42-Interacting Protein 4, Bzz1 and similar domains Back     alignment and domain information
>gnl|CDD|212713 cd11779, SH3_Irsp53_BAIAP2L, Src Homology 3 domain of Insulin Receptor tyrosine kinase Substrate p53, Brain-specific Angiogenesis Inhibitor 1-Associated Protein 2 (BAIAP2)-Like proteins, and similar proteins Back     alignment and domain information
>gnl|CDD|212731 cd11797, SH3_DNMBP_N4, Fourth N-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba Back     alignment and domain information
>gnl|CDD|212766 cd11832, SH3_Shank, Src homology 3 domain of SH3 and multiple ankyrin repeat domains (Shank) proteins Back     alignment and domain information
>gnl|CDD|213000 cd12067, SH3_MYO15A, Src Homology 3 domain of Myosin XVa Back     alignment and domain information
>gnl|CDD|213017 cd12141, SH3_DNMBP_C2, Second C-terminal Src homology 3 domain of Dynamin Binding Protein, also called Tuba, and similar domains Back     alignment and domain information
>gnl|CDD|212698 cd11764, SH3_Eps8, Src Homology 3 domain of Epidermal growth factor receptor kinase substrate 8 and similar proteins Back     alignment and domain information
>gnl|CDD|212923 cd11990, SH3_Intersectin2_2, Second Src homology 3 domain (or SH3B) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212792 cd11858, SH3_Myosin-I_fungi, Src homology 3 domain of Type I fungal Myosins Back     alignment and domain information
>gnl|CDD|212888 cd11955, SH3_srGAP1-3, Src homology 3 domain of Slit-Robo GTPase Activating Proteins 1, 2, and 3 Back     alignment and domain information
>gnl|CDD|212865 cd11932, SH3_SH3RF2_2, Second Src Homology 3 domain of SH3 domain containing ring finger 2 Back     alignment and domain information
>gnl|CDD|212740 cd11806, SH3_PRMT2, Src homology 3 domain of Protein arginine N-methyltransferase 2 Back     alignment and domain information
>gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212742 cd11808, SH3_Alpha_Spectrin, Src homology 3 domain of Alpha Spectrin Back     alignment and domain information
>gnl|CDD|212872 cd11939, SH3_ephexin1, Src homology 3 domain of the Rho guanine nucleotide exchange factor, ephexin-1 (also called NGEF or ARHGEF27) Back     alignment and domain information
>gnl|CDD|212850 cd11917, SH3_Sorbs2_3, Third (or C-terminal) Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212916 cd11983, SH3_Shank2, Src homology 3 domain of SH3 and multiple ankyrin repeat domains protein 2 Back     alignment and domain information
>gnl|CDD|212999 cd12066, SH3_GRAF3, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase 3 Back     alignment and domain information
>gnl|CDD|212856 cd11923, SH3_Sorbs2_2, Second Src Homology 3 domain of Sorbin and SH3 domain containing 2 (Sorbs2), also called Arg-binding protein 2 (ArgBP2) Back     alignment and domain information
>gnl|CDD|212997 cd12064, SH3_GRAF, Src Homology 3 domain of GTPase Regulator Associated with Focal adhesion kinase Back     alignment and domain information
>gnl|CDD|213004 cd12071, SH3_FBP17, Src Homology 3 domain of Formin Binding Protein 17 Back     alignment and domain information
>gnl|CDD|212878 cd11945, SH3_Endophilin_B1, Src homology 3 domain of Endophilin-B1 Back     alignment and domain information
>gnl|CDD|212818 cd11885, SH3_SH3TC, Src Homology 3 domain of SH3 domain and tetratricopeptide repeat-containing (SH3TC) proteins and similar domains Back     alignment and domain information
>gnl|CDD|212919 cd11986, SH3_Stac3_1, First C-terminal Src homology 3 domain of SH3 and cysteine-rich domain-containing protein 3 (Stac3) Back     alignment and domain information
>gnl|CDD|212704 cd11770, SH3_Nephrocystin, Src Homology 3 domain of Nephrocystin (or Nephrocystin-1) Back     alignment and domain information
>gnl|CDD|212863 cd11930, SH3_SH3RF1_2, Second Src Homology 3 domain of SH3 domain containing ring finger protein 1, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|212702 cd11768, SH3_Tec_like, Src Homology 3 domain of Tec-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|212949 cd12016, SH3_Tks_2, Second Src homology 3 domain of Tyrosine kinase substrate (Tks) proteins Back     alignment and domain information
>gnl|CDD|212858 cd11925, SH3_SH3RF3_3, Third Src Homology 3 domain of SH3 domain containing ring finger 3, an E3 ubiquitin-protein ligase Back     alignment and domain information
>gnl|CDD|212906 cd11973, SH3_ASEF, Src homology 3 domain of APC-Stimulated guanine nucleotide Exchange Factor Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 157
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 99.63
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 99.53
KOG2070|consensus 661 99.39
KOG2199|consensus 462 99.37
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 99.37
KOG1029|consensus1118 99.35
KOG1118|consensus366 99.33
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 99.3
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 99.25
KOG4225|consensus 489 99.25
KOG4226|consensus 379 99.23
KOG0162|consensus1106 99.2
KOG4348|consensus 627 99.2
KOG2996|consensus865 99.16
KOG4348|consensus 627 99.15
KOG1029|consensus 1118 99.13
KOG1264|consensus 1267 99.11
KOG4226|consensus379 99.07
KOG2856|consensus472 99.07
KOG4225|consensus489 98.98
KOG4792|consensus293 98.81
KOG2546|consensus483 98.79
KOG0515|consensus752 98.79
KOG3655|consensus484 98.72
KOG3601|consensus222 98.66
KOG1843|consensus473 98.51
KOG3875|consensus362 98.51
KOG1702|consensus264 98.47
KOG3523|consensus695 98.23
KOG4278|consensus 1157 98.17
KOG3557|consensus721 98.07
KOG2528|consensus 490 98.06
KOG4773|consensus386 98.05
KOG3632|consensus1335 98.03
KOG2222|consensus 848 97.91
KOG4575|consensus 874 97.76
KOG3771|consensus460 97.52
KOG1451|consensus812 97.48
KOG4429|consensus421 97.42
KOG3775|consensus482 97.36
KOG4792|consensus293 97.29
KOG3725|consensus375 97.28
KOG0609|consensus 542 97.18
KOG0197|consensus 468 96.97
KOG3632|consensus 1335 96.89
KOG3601|consensus222 96.78
KOG3565|consensus640 96.28
PF1460389 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A. 95.28
KOG0199|consensus 1039 95.0
PF0823955 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 S 94.62
KOG3812|consensus 475 93.83
smart0028763 SH3b Bacterial SH3 domain homologues. 93.29
PRK10884206 SH3 domain-containing protein; Provisional 93.01
PF0634755 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 S 92.25
KOG2996|consensus 865 91.16
KOG0040|consensus 2399 90.55
KOG3705|consensus580 87.99
KOG4384|consensus361 81.72
PRK13914 481 invasion associated secreted endopeptidase; Provis 80.72
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
Probab=99.63  E-value=9.2e-16  Score=91.43  Aligned_cols=49  Identities=49%  Similarity=1.072  Sum_probs=44.3

Q ss_pred             EecCCCCCCCCCCccCCCCEEEEEEecCCCCCeEEEEeCCeEEEEcCCCee
Q psy4227          32 VLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVT   82 (157)
Q Consensus        32 al~df~~~~~~eLs~~~Gd~i~vl~~~~~~~gWw~g~~~g~~G~fP~~yv~   82 (157)
                      |+|+|.+..++||+|.+||+|.|+.+  .++|||.|+.+|+.|+||++||+
T Consensus         1 Al~~y~~~~~dELs~~~Gd~i~v~~~--~~~~W~~g~~~g~~G~~P~~yV~   49 (49)
T PF14604_consen    1 ALYDYEAQDPDELSFKKGDVITVLEK--SDDGWWYGRNTGRTGLFPANYVE   49 (49)
T ss_dssp             ESSCBCSSSTTB-EB-TTEEEEEEEE--SSTSEEEEEETTEEEEEEGGGEE
T ss_pred             CCccCCCCCcCEeeEcCCCEEEEEEe--CCCCEEEEEECCEEEEECHHhCC
Confidence            78999999999999999999999976  68899999999999999999985



...

>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG2528|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG4429|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG3565|consensus Back     alignment and domain information
>PF14603 hSH3: Helically-extended SH3 domain; PDB: 1RI9_A Back     alignment and domain information
>KOG0199|consensus Back     alignment and domain information
>PF08239 SH3_3: Bacterial SH3 domain; InterPro: IPR013247 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>smart00287 SH3b Bacterial SH3 domain homologues Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF06347 SH3_4: Bacterial SH3 domain; InterPro: IPR010466 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>KOG0040|consensus Back     alignment and domain information
>KOG3705|consensus Back     alignment and domain information
>KOG4384|consensus Back     alignment and domain information
>PRK13914 invasion associated secreted endopeptidase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
2k9g_A73 Solution Structure Of The Third Sh3 Domain Of The C 2e-20
2k6d_A62 Cin85 Sh3-C Domain In Complex With Ubiquitin Length 4e-20
2ydl_A69 Crystal Structure Of Sh3c From Cin85 Length = 69 1e-19
2da9_A70 Solution Structure Of The Third Sh3 Domain Of Sh3-D 3e-19
2jte_A64 Third Sh3 Domain Of Cd2ap Length = 64 1e-15
2xmf_A60 Myosin 1e Sh3 Length = 60 2e-11
1udl_A98 The Solution Structure Of The Fifth Sh3 Domain Of I 2e-10
2yun_A79 Solution Structure Of The Sh3 Domain Of Human Nostr 2e-10
3u23_A65 Atomic Resolution Crystal Structure Of The 2nd Sh3 2e-10
3jv3_A 283 Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l 3e-10
3gf9_A 295 Crystal Structure Of Human Intersectin 2 Rhogef Dom 6e-10
1wi7_A68 Solution Structure Of The Sh3 Domain Of Sh3-Domain 1e-09
1x2q_A88 Solution Structure Of The Sh3 Domain Of The Signal 1e-09
2fei_A65 Solution Structure Of The Second Sh3 Domain Of Huma 2e-09
2o2o_A92 Solution Structure Of Domain B From Human Cin85 Pro 2e-09
2dbm_A73 Solution Structures Of The Sh3 Domain Of Human Sh3- 2e-09
3iql_A71 Crystal Structure Of The Rat Endophilin-A1 Sh3 Doma 2e-09
2dm1_A73 Solution Structure Of The Second Sh3 Domain Of Huma 2e-09
2krn_A60 High Resolution Structure Of The Second Sh3 Domain 3e-09
2bz8_A58 N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Pepti 4e-09
3c0c_A73 X-Ray Crystal Structure Of The Rat Endophilin A2 Sh 4e-09
2kbt_A142 Attachment Of An Nmr-Invisible Solubility Enhanceme 8e-09
2l0a_A72 Solution Nmr Structure Of Signal Transducing Adapte 8e-09
2drk_A59 Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L 1e-08
2drm_A58 Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 L 1e-08
1uj0_A62 Crystal Structure Of Stam2 Sh3 Domain In Complex Wi 1e-08
1uff_A93 Solution Structure Of The First Sh3 Domain Of Human 3e-08
2nwm_A65 Solution Structure Of The First Sh3 Domain Of Human 4e-08
2rf0_A89 Crystal Structure Of Human Mixed Lineage Kinase Map 8e-08
2ew3_A68 Solution Structure Of The Sh3 Domain Of Human Sh3gl 9e-08
2dlm_A68 Solution Structure Of The First Sh3 Domain Of Human 1e-07
2dl7_A73 Solution Structure Of The Second Sh3 Domain Of Huma 2e-07
1x69_A79 Solution Structures Of The Sh3 Domain Of Human Src 3e-07
1k76_A62 Solution Structure Of The C-Terminal Sem-5 Sh3 Doma 5e-07
3sem_A60 Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le 5e-07
3ulr_B65 Lysozyme Contamination Facilitates Crystallization 5e-07
2d1x_A66 The Crystal Structure Of The Cortactin-Sh3 Domain A 6e-07
1h3h_A60 Structural Basis For Specific Recognition Of An Rxx 6e-07
1sem_A58 Structural Determinants Of Peptide-Binding Orientat 6e-07
1oeb_A62 MonaGADS SH3C DOMAIN Length = 62 7e-07
3haj_A486 Crystal Structure Of Human Pacsin2 F-Bar Domain (P2 7e-07
2d8h_A80 Solution Structure Of The Sh3 Domain Of Hypothetica 7e-07
1uti_A58 MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE L 7e-07
2d0n_A59 Crystal Structure Of The C-Terminal Sh3 Domain Of T 7e-07
2j6f_A62 N-Terminal Sh3 Domain Of Cms (Cd2ap Human Homolog) 9e-07
1x2k_A68 Solution Structure Of The Sh3 Domain Of Human Osteo 1e-06
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 1e-06
1ywo_A64 Phospholipase Cgamma1 Sh3 In Complex With A Slp-76 1e-06
2ed0_A78 Solution Structure Of The Sh3 Domain Of Abl Interac 1e-06
2krm_A57 Rdc Refined Solution Structure Of The First Sh3 Dom 1e-06
1zlm_A58 Crystal Structure Of The Sh3 Domain Of Human Osteoc 2e-06
2vwf_A58 Grb2 Sh3c (2) Length = 58 2e-06
2yuo_A78 Solution Structure Of The Sh3 Domain Of Mouse Run A 2e-06
1gri_A217 Grb2 Length = 217 3e-06
1gcq_A61 Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt 3e-06
1io6_A59 Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter 3e-06
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 3e-06
1ujy_A76 Solution Structure Of Sh3 Domain In RacCDC42 GUANIN 3e-06
2vvk_A56 Grb2 Sh3c (1) Length = 56 3e-06
2ed1_A76 Solution Structure Of The Sh3 Domain Of 130 Kda Pho 4e-06
1zsg_A65 Beta Pix-Sh3 Complexed With An Atypical Peptide Fro 4e-06
2js0_A61 Solution Structure Of Second Sh3 Domain Of Adaptor 8e-06
1y0m_A61 Crystal Structure Of Of The Sh3 Domain Of Phospholi 9e-06
2cub_A88 Solution Structure Of The Sh3 Domain Of The Human C 1e-05
2rqt_A61 Solution Structure Of The Human Ddef1 Sh3 Domain Le 1e-05
2dl3_A68 Solution Structure Of The First Sh3 Domain Of Human 1e-05
1ynz_A58 Sh3 Domain Of Yeast Pin3 Length = 58 1e-05
4a63_B239 Crystal Structure Of The P73-Aspp2 Complex At 2.6a 2e-05
1ycs_B239 P53-53bp2 Complex Length = 239 2e-05
1hsq_A71 Solution Structure Of The Sh3 Domain Of Phospholipa 2e-05
2dl4_A68 Solution Structure Of The First Sh3 Domain Of Stac 3e-05
1j3t_A74 Solution Structure Of The Second Sh3 Domain Of Huma 3e-05
2a28_A54 Atomic-Resolution Crystal Structure Of The Second S 3e-05
2cre_A71 Solution Structure Of Rsgi Ruh-036, An Sh3 Domain F 3e-05
2ak5_A64 Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length 3e-05
1wyx_A69 The Crystal Structure Of The P130cas Sh3 Domain At 3e-05
3ngp_A62 High Resolution Structure Of Alpha-Spectrin Sh3 Dom 4e-05
1uue_A62 A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = 4e-05
4gbq_A74 Solution Nmr Structure Of The Grb2 N-Terminal Sh3 D 4e-05
2df6_A59 Crystal Structure Of The Sh3 Domain Of Betapix In C 5e-05
2esw_A61 Atomic Structure Of The N-Terminal Sh3 Domain Of Mo 6e-05
1oot_A60 Crystal Structure Of The Sh3 Domain From A S. Cerev 6e-05
2x3w_D60 Structure Of Mouse Syndapin I (Crystal Form 2) Leng 6e-05
4iim_A70 Crystal Structure Of The Second Sh3 Domain Of Itsn1 6e-05
1bk2_A57 A-Spectrin Sh3 Domain D48g Mutant Length = 57 6e-05
2frw_A57 Solution Structure Of The Second Sh3 Domain Of Huma 7e-05
1k4u_S62 Solution Structure Of The C-Terminal Sh3 Domain Of 7e-05
3m0p_A62 Crystal Structure Of The R21d Mutant Of Alpha-Spect 7e-05
3m0s_A57 Crystal Structure Of The R21d Mutant Of Alpha-Spect 8e-05
2a08_A60 Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 8e-05
2lx7_A60 Solution Nmr Structure Of Sh3 Domain Of Growth Arre 1e-04
1z9q_A79 Solution Structure Of Sh3 Domain Of P40phox Length 1e-04
4e6r_A58 Crystal Structure Of A Cytoplasmic Protein Nck2 (Nc 1e-04
1wx6_A91 Solution Structure Of The Sh3 Domain Of The Human C 2e-04
1w6x_A60 Sh3 Domain Of P40phox, Component Of The Nadph Oxida 2e-04
2fry_A61 Solution Structure Of The Third Sh3 Domain Of Human 2e-04
2dyb_A341 The Crystal Structure Of Human P40(Phox) Length = 3 2e-04
1u5s_A71 Nmr Structure Of The Complex Between Nck-2 Sh3 Doma 2e-04
1e6g_A62 A-Spectrin Sh3 Domain A11v, V23l, M25i, V53i, V58l 2e-04
2e5k_A94 Solution Structure Of Sh3 Domain In Suppressor Of T 2e-04
3i9q_A57 Crystal Structure Of The Triple Mutant S19g-P20d-R2 2e-04
4f14_A64 Structure Of The Sh3 Domain Of Human Nebulette In C 2e-04
2djq_A68 The Solution Structure Of The First Sh3 Domain Of M 2e-04
1uhf_A69 Solution Structure Of The Third Sh3 Domain Of Human 2e-04
2epd_A76 Solution Structure Of Sh3 Domain In Rho-Gtpase-Acti 3e-04
1ark_A60 Sh3 Domain From Human Nebulin, Nmr, 15 Structures L 3e-04
1e7o_A62 A-Spectrin Sh3 Domain A11v, V23l, M25v, V44i, V58l 3e-04
2cdt_A62 Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 3e-04
3thk_A73 Structure Of Sh3 Chimera With A Type Ii Ligand Link 4e-04
2f2v_A62 Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 5e-04
2jt4_A71 Solution Structure Of The Sla1 Sh3-3-Ubiquitin Comp 5e-04
1neg_A83 Crystal Structure Analysis Of N-And C-Terminal Labe 5e-04
2k3b_A62 Seeing The Invisible: Structures Of Excited Protein 5e-04
2f2x_A62 Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 5e-04
2f2w_A62 Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 5e-04
2rpn_A59 A Crucial Role For High Intrinsic Specificity In Th 5e-04
2dil_A69 Solution Structure Of The Sh3 Domain Of The Human P 5e-04
1jo8_A58 Structural Analysis Of The Yeast Actin Binding Prot 5e-04
1pwt_A61 Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Tw 6e-04
2eqi_A69 Solution Structure Of The Sh3 Domain From Phospholi 6e-04
2lj3_A63 Pfbd: High-Throughput Strategy Of Backbone Fold Det 6e-04
1m8m_A62 Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 6e-04
1e6h_A62 A-Spectrin Sh3 Domain A11v, M25i, V44i, V58l Mutant 6e-04
1aze_A56 Nmr Structure Of The Complex Between The C32s-Y7v M 8e-04
1hd3_A62 A-Spectrin Sh3 Domain F52y Mutant Length = 62 8e-04
>pdb|2K9G|A Chain A, Solution Structure Of The Third Sh3 Domain Of The Cin85 Adapter Protein Length = 73 Back     alignment and structure

Iteration: 1

Score = 94.4 bits (233), Expect = 2e-20, Method: Compositional matrix adjust. Identities = 40/59 (67%), Positives = 51/59 (86%) Query: 27 KERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLP 85 K+ CKV++PYEAQN+DELT+KE DIV LI++D D GWW+GEL+GR G+FPDNFV +LP Sbjct: 9 KDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLP 67
>pdb|2K6D|A Chain A, Cin85 Sh3-C Domain In Complex With Ubiquitin Length = 62 Back     alignment and structure
>pdb|2YDL|A Chain A, Crystal Structure Of Sh3c From Cin85 Length = 69 Back     alignment and structure
>pdb|2DA9|A Chain A, Solution Structure Of The Third Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 (Regulator Of Ubiquitous Kinase, Ruk) Length = 70 Back     alignment and structure
>pdb|2JTE|A Chain A, Third Sh3 Domain Of Cd2ap Length = 64 Back     alignment and structure
>pdb|2XMF|A Chain A, Myosin 1e Sh3 Length = 60 Back     alignment and structure
>pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 Back     alignment and structure
>pdb|2YUN|A Chain A, Solution Structure Of The Sh3 Domain Of Human Nostrin Length = 79 Back     alignment and structure
>pdb|3U23|A Chain A, Atomic Resolution Crystal Structure Of The 2nd Sh3 Domain From Human Cd2ap (Cms) In Complex With A Proline-Rich Peptide From Human Rin3 Length = 65 Back     alignment and structure
>pdb|3JV3|A Chain A, Structure Of Sh3e-Dh Unit Of Murine Intersectin-1l Length = 283 Back     alignment and structure
>pdb|3GF9|A Chain A, Crystal Structure Of Human Intersectin 2 Rhogef Domain Length = 295 Back     alignment and structure
>pdb|1WI7|A Chain A, Solution Structure Of The Sh3 Domain Of Sh3-Domain Kinase Binding Protein 1 Length = 68 Back     alignment and structure
>pdb|1X2Q|A Chain A, Solution Structure Of The Sh3 Domain Of The Signal Transducing Adaptor Molecule 2 Length = 88 Back     alignment and structure
>pdb|2FEI|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Cms Protein Length = 65 Back     alignment and structure
>pdb|2O2O|A Chain A, Solution Structure Of Domain B From Human Cin85 Protein Length = 92 Back     alignment and structure
>pdb|2DBM|A Chain A, Solution Structures Of The Sh3 Domain Of Human Sh3- Containing Grb2-Like Protein 2 Length = 73 Back     alignment and structure
>pdb|3IQL|A Chain A, Crystal Structure Of The Rat Endophilin-A1 Sh3 Domain Length = 71 Back     alignment and structure
>pdb|2DM1|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Protein Vav-2 Length = 73 Back     alignment and structure
>pdb|2KRN|A Chain A, High Resolution Structure Of The Second Sh3 Domain Of Cd2ap Length = 60 Back     alignment and structure
>pdb|2BZ8|A Chain A, N-Terminal Sh3 Domain Of Cin85 Bound To Cbl-B Peptide Length = 58 Back     alignment and structure
>pdb|3C0C|A Chain A, X-Ray Crystal Structure Of The Rat Endophilin A2 Sh3 Domain Length = 73 Back     alignment and structure
>pdb|2KBT|A Chain A, Attachment Of An Nmr-Invisible Solubility Enhancement Tag (Inset) Using A Sortase-Mediated Protein Ligation Method Length = 142 Back     alignment and structure
>pdb|2L0A|A Chain A, Solution Nmr Structure Of Signal Transducing Adapter Molecule 1 Stam-1 From Homo Sapiens, Northeast Structural Genomics Consortium Target Hr4479e Length = 72 Back     alignment and structure
>pdb|2DRK|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 59 Back     alignment and structure
>pdb|2DRM|A Chain A, Acanthamoeba Myosin I Sh3 Domain Bound To Acan125 Length = 58 Back     alignment and structure
>pdb|1UJ0|A Chain A, Crystal Structure Of Stam2 Sh3 Domain In Complex With A Ubpy-Derived Peptide Length = 62 Back     alignment and structure
>pdb|1UFF|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Intersectin2 (Kiaa1256) Length = 93 Back     alignment and structure
>pdb|2NWM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin And Its Interaction With The Peptides From Vinculin Length = 65 Back     alignment and structure
>pdb|2RF0|A Chain A, Crystal Structure Of Human Mixed Lineage Kinase Map3k10 Sh3 Domain Length = 89 Back     alignment and structure
>pdb|2EW3|A Chain A, Solution Structure Of The Sh3 Domain Of Human Sh3gl3 Length = 68 Back     alignment and structure
>pdb|2DLM|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Vinexin Length = 68 Back     alignment and structure
>pdb|2DL7|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Kiaa0769 Protein Length = 73 Back     alignment and structure
>pdb|1X69|A Chain A, Solution Structures Of The Sh3 Domain Of Human Src Substrate Cortactin Length = 79 Back     alignment and structure
>pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 Back     alignment and structure
>pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 Back     alignment and structure
>pdb|3ULR|B Chain B, Lysozyme Contamination Facilitates Crystallization Of A Hetero- Trimericcortactin:arg:lysozyme Complex Length = 65 Back     alignment and structure
>pdb|2D1X|A Chain A, The Crystal Structure Of The Cortactin-Sh3 Domain And Amap1- Peptide Complex Length = 66 Back     alignment and structure
>pdb|1H3H|A Chain A, Structural Basis For Specific Recognition Of An Rxxk-Containing Slp-76 Peptide By The Gads C-Terminal Sh3 Domain Length = 60 Back     alignment and structure
>pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 Back     alignment and structure
>pdb|1OEB|A Chain A, MonaGADS SH3C DOMAIN Length = 62 Back     alignment and structure
>pdb|3HAJ|A Chain A, Crystal Structure Of Human Pacsin2 F-Bar Domain (P212121 Lattice) Length = 486 Back     alignment and structure
>pdb|2D8H|A Chain A, Solution Structure Of The Sh3 Domain Of Hypothetical Protein Sh3yl1 Length = 80 Back     alignment and structure
>pdb|1UTI|A Chain A, MonaGADS SH3C IN COMPLEX WITH HPK DERIVED PEPTIDE Length = 58 Back     alignment and structure
>pdb|2D0N|A Chain A, Crystal Structure Of The C-Terminal Sh3 Domain Of The Adaptor Protein Gads In Complex With Slp-76 Motif Peptide Reveals A Unique Sh3-Sh3 Interaction Length = 59 Back     alignment and structure
>pdb|2J6F|A Chain A, N-Terminal Sh3 Domain Of Cms (Cd2ap Human Homolog) Bound To Cbl-B Peptide Length = 62 Back     alignment and structure
>pdb|1X2K|A Chain A, Solution Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor 1 (Ostf1) Length = 68 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|1YWO|A Chain A, Phospholipase Cgamma1 Sh3 In Complex With A Slp-76 Motif Length = 64 Back     alignment and structure
>pdb|2ED0|A Chain A, Solution Structure Of The Sh3 Domain Of Abl Interactor 2 (Abelson Interactor 2) Length = 78 Back     alignment and structure
>pdb|2KRM|A Chain A, Rdc Refined Solution Structure Of The First Sh3 Domain Of Cd2ap Length = 57 Back     alignment and structure
>pdb|1ZLM|A Chain A, Crystal Structure Of The Sh3 Domain Of Human Osteoclast Stimulating Factor Length = 58 Back     alignment and structure
>pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 Back     alignment and structure
>pdb|2YUO|A Chain A, Solution Structure Of The Sh3 Domain Of Mouse Run And Tbc1 Domain Containing 3 Length = 78 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 Back     alignment and structure
>pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure
>pdb|1UJY|A Chain A, Solution Structure Of Sh3 Domain In RacCDC42 GUANINE Nucleotide Exchange Factor(Gef) 6 Length = 76 Back     alignment and structure
>pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 Back     alignment and structure
>pdb|2ED1|A Chain A, Solution Structure Of The Sh3 Domain Of 130 Kda Phosphatidylinositol 4,5-Biphosphate-Dependent Arf1 Gtpase- Activating Protein Length = 76 Back     alignment and structure
>pdb|1ZSG|A Chain A, Beta Pix-Sh3 Complexed With An Atypical Peptide From Alpha- Pak Length = 65 Back     alignment and structure
>pdb|2JS0|A Chain A, Solution Structure Of Second Sh3 Domain Of Adaptor Nck Length = 61 Back     alignment and structure
>pdb|1Y0M|A Chain A, Crystal Structure Of Of The Sh3 Domain Of Phospholipase C Gamma-1 Length = 61 Back     alignment and structure
>pdb|2CUB|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Cytoplasmic Protein Nck1 Length = 88 Back     alignment and structure
>pdb|2RQT|A Chain A, Solution Structure Of The Human Ddef1 Sh3 Domain Length = 61 Back     alignment and structure
>pdb|2DL3|A Chain A, Solution Structure Of The First Sh3 Domain Of Human Sorbin And Sh3 Domain-Containing Protein 1 Length = 68 Back     alignment and structure
>pdb|1YNZ|A Chain A, Sh3 Domain Of Yeast Pin3 Length = 58 Back     alignment and structure
>pdb|4A63|B Chain B, Crystal Structure Of The P73-Aspp2 Complex At 2.6a Resolution Length = 239 Back     alignment and structure
>pdb|1YCS|B Chain B, P53-53bp2 Complex Length = 239 Back     alignment and structure
>pdb|1HSQ|A Chain A, Solution Structure Of The Sh3 Domain Of Phospholipase Cgamma Length = 71 Back     alignment and structure
>pdb|2DL4|A Chain A, Solution Structure Of The First Sh3 Domain Of Stac Protein Length = 68 Back     alignment and structure
>pdb|1J3T|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Intersectin 2 (Kiaa1256) Length = 74 Back     alignment and structure
>pdb|2A28|A Chain A, Atomic-Resolution Crystal Structure Of The Second Sh3 Domain Of Yeast Bzz1 Determined From A Pseudomerohedrally Twinned Crystal Length = 54 Back     alignment and structure
>pdb|2CRE|A Chain A, Solution Structure Of Rsgi Ruh-036, An Sh3 Domain From Human Cdna Length = 71 Back     alignment and structure
>pdb|2AK5|A Chain A, Beta Pix-Sh3 Complexed With A Cbl-B Peptide Length = 64 Back     alignment and structure
>pdb|1WYX|A Chain A, The Crystal Structure Of The P130cas Sh3 Domain At 1.1 A Resolution Length = 69 Back     alignment and structure
>pdb|3NGP|A Chain A, High Resolution Structure Of Alpha-Spectrin Sh3 Domain Mutant With A Redesigned Core Length = 62 Back     alignment and structure
>pdb|1UUE|A Chain A, A-Spectrin Sh3 Domain (V44t, D48g Mutant) Length = 62 Back     alignment and structure
>pdb|4GBQ|A Chain A, Solution Nmr Structure Of The Grb2 N-Terminal Sh3 Domain Complexed With A Ten-Residue Peptide Derived From Sos Direct Refinement Against Noes, J-Couplings, And 1h And 13c Chemical Shifts, 15 Structures Length = 74 Back     alignment and structure
>pdb|2DF6|A Chain A, Crystal Structure Of The Sh3 Domain Of Betapix In Complex With A High Affinity Peptide From Pak2 Length = 59 Back     alignment and structure
>pdb|2ESW|A Chain A, Atomic Structure Of The N-Terminal Sh3 Domain Of Mouse Beta Pix,P21-Activated Kinase (Pak)-Interacting Exchange Factor Length = 61 Back     alignment and structure
>pdb|1OOT|A Chain A, Crystal Structure Of The Sh3 Domain From A S. Cerevisiae Hypothetical 40.4 Kda Protein At 1.39 A Resolution Length = 60 Back     alignment and structure
>pdb|2X3W|D Chain D, Structure Of Mouse Syndapin I (Crystal Form 2) Length = 60 Back     alignment and structure
>pdb|4IIM|A Chain A, Crystal Structure Of The Second Sh3 Domain Of Itsn1 Bound With A Synthetic Peptide Length = 70 Back     alignment and structure
>pdb|1BK2|A Chain A, A-Spectrin Sh3 Domain D48g Mutant Length = 57 Back     alignment and structure
>pdb|2FRW|A Chain A, Solution Structure Of The Second Sh3 Domain Of Human Adaptor Protein Nck2 Length = 57 Back     alignment and structure
>pdb|1K4U|S Chain S, Solution Structure Of The C-Terminal Sh3 Domain Of P67phox Complexed With The C-Terminal Tail Region Of P47phox Length = 62 Back     alignment and structure
>pdb|3M0P|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 4. Length = 62 Back     alignment and structure
>pdb|3M0S|A Chain A, Crystal Structure Of The R21d Mutant Of Alpha-Spectrin Sh3 Domain. Crystal Obtained In Ammonium Sulphate At Ph 7 Length = 57 Back     alignment and structure
>pdb|2A08|A Chain A, Structure Of The Yeast Yhh6 Sh3 Domain Length = 60 Back     alignment and structure
>pdb|2LX7|A Chain A, Solution Nmr Structure Of Sh3 Domain Of Growth Arrest-Specific Protein 7 (Gas7) (Fragment 1-60) From Homo Sapiens, Northeast Structural Genomics Consortium (Nesg) Target Hr8574a Length = 60 Back     alignment and structure
>pdb|1Z9Q|A Chain A, Solution Structure Of Sh3 Domain Of P40phox Length = 79 Back     alignment and structure
>pdb|4E6R|A Chain A, Crystal Structure Of A Cytoplasmic Protein Nck2 (Nck2) From Homo Sapiens At 2.20 A Resolution Length = 58 Back     alignment and structure
>pdb|1WX6|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Cytoplasmic Protein Nck2 Length = 91 Back     alignment and structure
>pdb|1W6X|A Chain A, Sh3 Domain Of P40phox, Component Of The Nadph Oxidase Length = 60 Back     alignment and structure
>pdb|2FRY|A Chain A, Solution Structure Of The Third Sh3 Domain Of Human Nck2 Adaptor Protein Length = 61 Back     alignment and structure
>pdb|2DYB|A Chain A, The Crystal Structure Of Human P40(Phox) Length = 341 Back     alignment and structure
>pdb|1U5S|A Chain A, Nmr Structure Of The Complex Between Nck-2 Sh3 Domain And Pinch-1 Lim4 Domain Length = 71 Back     alignment and structure
>pdb|1E6G|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25i, V53i, V58l Mutant Length = 62 Back     alignment and structure
>pdb|2E5K|A Chain A, Solution Structure Of Sh3 Domain In Suppressor Of T-Cell Receptor Signaling 1 Length = 94 Back     alignment and structure
>pdb|3I9Q|A Chain A, Crystal Structure Of The Triple Mutant S19g-P20d-R21s Of Alpha Spectrin Sh3 Domain Length = 57 Back     alignment and structure
>pdb|4F14|A Chain A, Structure Of The Sh3 Domain Of Human Nebulette In Complex With A Peptide Of Xirp2 Length = 64 Back     alignment and structure
>pdb|2DJQ|A Chain A, The Solution Structure Of The First Sh3 Domain Of Mouse Sh3 Domain Containing Ring Finger 2 Length = 68 Back     alignment and structure
>pdb|1UHF|A Chain A, Solution Structure Of The Third Sh3 Domain Of Human Intersectin 2(Kiaa1256) Length = 69 Back     alignment and structure
>pdb|2EPD|A Chain A, Solution Structure Of Sh3 Domain In Rho-Gtpase-Activating Protein 4 Length = 76 Back     alignment and structure
>pdb|1ARK|A Chain A, Sh3 Domain From Human Nebulin, Nmr, 15 Structures Length = 60 Back     alignment and structure
>pdb|1E7O|A Chain A, A-Spectrin Sh3 Domain A11v, V23l, M25v, V44i, V58l Mutations Length = 62 Back     alignment and structure
>pdb|2CDT|A Chain A, Alpha-Spectrin Sh3 Domain A56s Mutant Length = 62 Back     alignment and structure
>pdb|3THK|A Chain A, Structure Of Sh3 Chimera With A Type Ii Ligand Linked To The Chain C- Terminal Length = 73 Back     alignment and structure
>pdb|2F2V|A Chain A, Alpha-Spectrin Sh3 Domain A56g Mutant Length = 62 Back     alignment and structure
>pdb|2JT4|A Chain A, Solution Structure Of The Sla1 Sh3-3-Ubiquitin Complex Length = 71 Back     alignment and structure
>pdb|1NEG|A Chain A, Crystal Structure Analysis Of N-And C-Terminal Labeled Sh3- Domain Of Alpha-Chicken Spectrin Length = 83 Back     alignment and structure
>pdb|2K3B|A Chain A, Seeing The Invisible: Structures Of Excited Protein States By Relaxation Dispersion Nmr Length = 62 Back     alignment and structure
>pdb|2F2X|A Chain A, Alpha-Spectrin Sh3 Domain R21g Mutant Length = 62 Back     alignment and structure
>pdb|2F2W|A Chain A, Alpha-Spectrin Sh3 Domain R21a Mutant Length = 62 Back     alignment and structure
>pdb|2RPN|A Chain A, A Crucial Role For High Intrinsic Specificity In The Function Of Yeast Sh3 Domains Length = 59 Back     alignment and structure
>pdb|2DIL|A Chain A, Solution Structure Of The Sh3 Domain Of The Human Proline- Serine-Threonine Phosphatase-Interacting Protein 1 Length = 69 Back     alignment and structure
>pdb|1JO8|A Chain A, Structural Analysis Of The Yeast Actin Binding Protein Abp1 Sh3 Domain Length = 58 Back     alignment and structure
>pdb|1PWT|A Chain A, Thermodynamic Analysis Of Alpha-Spectrin Sh3 And Two Of Its Circular Permutants With Different Loop Lengths: Discerning The Reasons For Rapid Folding In Proteins Length = 61 Back     alignment and structure
>pdb|2EQI|A Chain A, Solution Structure Of The Sh3 Domain From Phospholipase C, Gamma 2 Length = 69 Back     alignment and structure
>pdb|2LJ3|A Chain A, Pfbd: High-Throughput Strategy Of Backbone Fold Determination For Small Well-Folded Proteins In Less Than A Day Length = 63 Back     alignment and structure
>pdb|1M8M|A Chain A, Solid-State Mas Nmr Structure Of The A-Spectrin Sh3 Domain Length = 62 Back     alignment and structure
>pdb|1E6H|A Chain A, A-Spectrin Sh3 Domain A11v, M25i, V44i, V58l Mutants Length = 62 Back     alignment and structure
>pdb|1AZE|A Chain A, Nmr Structure Of The Complex Between The C32s-Y7v Mutant Of The Nsh3 Domain Of Grb2 With A Peptide From Sos, 10 Structures Length = 56 Back     alignment and structure
>pdb|1HD3|A Chain A, A-Spectrin Sh3 Domain F52y Mutant Length = 62 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query157
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 3e-31
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 1e-30
2da9_A70 SH3-domain kinase binding protein 1; structural ge 2e-30
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 1e-29
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 3e-29
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 5e-29
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 1e-28
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 2e-28
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 5e-28
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 5e-28
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 5e-28
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 6e-28
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 6e-28
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 8e-28
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 2e-27
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 2e-27
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 2e-27
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 2e-27
3u23_A65 CD2-associated protein; structural genomics, struc 3e-27
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 4e-27
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 4e-27
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 5e-27
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 6e-27
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 6e-27
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 7e-27
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 1e-26
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 1e-26
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 2e-26
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 2e-26
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 2e-26
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 2e-26
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 3e-26
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 3e-26
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 3e-26
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 6e-26
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 6e-26
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 7e-26
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 7e-26
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 7e-26
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 7e-26
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 8e-26
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 8e-26
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 8e-26
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 1e-25
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 1e-25
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 1e-25
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 2e-25
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 2e-25
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 2e-25
2j6f_A62 CD2-associated protein; metal-binding, immune resp 3e-25
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 3e-25
1uti_A58 GRB2-related adaptor protein 2; signaling protein 4e-25
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 4e-25
2dil_A69 Proline-serine-threonine phosphatase-interacting p 4e-25
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 4e-25
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 5e-25
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 7e-25
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 7e-25
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 8e-25
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 8e-25
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 9e-25
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 9e-25
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 1e-24
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 1e-24
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 1e-24
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 1e-24
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 2e-24
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 2e-24
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 2e-24
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 7e-24
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 8e-24
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 1e-23
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 2e-23
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 5e-23
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 5e-23
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 5e-23
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 8e-23
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 8e-23
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 9e-23
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 1e-22
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 1e-22
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 2e-22
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 3e-22
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 3e-22
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 4e-22
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 8e-22
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 1e-21
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 1e-21
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 2e-21
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 2e-21
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 3e-21
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 4e-21
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 5e-21
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 5e-21
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 5e-21
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 5e-21
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 5e-21
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 7e-21
2cuc_A70 SH3 domain containing ring finger 2; structural ge 1e-20
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 1e-20
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 3e-20
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 3e-20
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 3e-20
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 3e-20
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 5e-20
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 6e-20
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 6e-20
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 3e-19
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 7e-20
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 2e-19
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 2e-19
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 2e-19
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 2e-19
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 2e-19
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 3e-19
1wxb_A68 Epidermal growth factor receptor pathway substrate 6e-19
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 6e-19
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 8e-19
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 9e-19
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 9e-19
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 9e-19
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 1e-18
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 1e-18
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 1e-18
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 2e-18
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 1e-13
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 2e-18
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 2e-18
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 3e-18
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 8e-18
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 8e-18
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 2e-17
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 2e-17
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 2e-17
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 3e-17
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 2e-11
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 6e-17
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 1e-16
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 1e-16
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 1e-16
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 6e-14
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 1e-16
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 2e-16
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 2e-16
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 2e-16
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 4e-16
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 4e-16
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 7e-16
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 9e-16
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 1e-15
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 1e-15
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 1e-15
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 2e-15
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 2e-15
1i07_A60 Epidermal growth factor receptor kinase substrate 2e-15
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 3e-15
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 3e-15
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 4e-15
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 5e-15
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 5e-15
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 1e-14
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 2e-14
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 4e-14
1awj_A77 ITK; transferase, regulatory intramolecular comple 5e-14
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 7e-14
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 1e-13
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 1e-13
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 1e-13
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 1e-13
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 2e-13
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 2e-13
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 8e-13
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 2e-12
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 2e-12
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 4e-12
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 1e-11
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 1e-11
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 4e-11
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 6e-11
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 3e-10
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 8e-10
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 1e-09
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 2e-09
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 2e-09
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 5e-09
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 7e-08
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 2e-07
1u3o_A82 Huntingtin-associated protein-interacting protein; 3e-07
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 4e-07
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 6e-07
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 7e-07
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 5e-06
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 2e-05
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 6e-05
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-04
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
 Score =  106 bits (266), Expect = 3e-31
 Identities = 39/63 (61%), Positives = 51/63 (80%)

Query: 27 KERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPT 86
           + CKV++PYEAQN+DELT+KE DIV LI++D  D GWW+GEL+GR G+FPDNFV +LP 
Sbjct: 2  SDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWEGELNGRRGVFPDNFVKLLPP 61

Query: 87 TDE 89
           + 
Sbjct: 62 LEH 64


>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Length = 60 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Length = 62 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Length = 71 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Length = 58 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} PDB: 2kt1_A Length = 90 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Length = 184 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Length = 466 Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Length = 83 Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Length = 283 Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Length = 70 Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Length = 78 Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Length = 108 Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Length = 82 Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Length = 526 Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Length = 495 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Length = 175 Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Length = 535 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.74
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 99.71
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 99.71
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 99.7
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.7
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 99.69
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 99.69
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 99.69
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 99.69
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 99.68
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.68
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 99.68
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.68
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 99.68
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.68
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.68
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.68
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 99.68
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 99.68
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 99.68
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 99.68
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.68
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 99.67
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 99.67
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 99.67
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.67
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 99.67
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 99.67
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 99.67
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 99.67
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 99.67
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 99.67
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.67
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.67
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.67
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 99.67
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 99.67
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 99.66
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.66
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.66
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 99.66
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.66
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.66
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.66
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.66
2da9_A70 SH3-domain kinase binding protein 1; structural ge 99.66
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 99.66
2j6f_A62 CD2-associated protein; metal-binding, immune resp 99.66
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.66
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 99.65
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.65
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 99.65
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 99.65
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 99.65
3u23_A65 CD2-associated protein; structural genomics, struc 99.65
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 99.65
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 99.65
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 99.65
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.65
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 99.65
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 99.65
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 99.65
2dil_A69 Proline-serine-threonine phosphatase-interacting p 99.65
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 99.65
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 99.65
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 99.65
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 99.64
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.64
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 99.64
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.64
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 99.64
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 99.64
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.64
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 99.64
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 99.64
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.64
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 99.64
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 99.64
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 99.63
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 99.63
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 99.63
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.63
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 99.63
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 99.63
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 99.63
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 99.63
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 99.63
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.63
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 99.63
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.63
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.63
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.63
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 99.63
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.63
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 99.62
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 99.62
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 99.62
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 99.62
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 99.62
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 99.62
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 99.62
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 99.62
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 99.62
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 99.62
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 99.62
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 99.62
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 99.62
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 99.61
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 99.61
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 99.61
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 99.61
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 99.61
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.61
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 99.61
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 99.61
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 99.61
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.61
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 99.61
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 99.61
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 99.61
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 99.61
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 99.61
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 99.61
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 99.61
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 99.61
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 99.61
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.6
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 99.6
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 99.6
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 99.6
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 99.6
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 99.6
2cuc_A70 SH3 domain containing ring finger 2; structural ge 99.6
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 99.59
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 99.59
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 99.59
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 99.59
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 99.59
1i07_A60 Epidermal growth factor receptor kinase substrate 99.59
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 99.58
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 99.58
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 99.58
1wxb_A68 Epidermal growth factor receptor pathway substrate 99.58
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 99.57
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 99.57
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 99.57
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 99.57
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 99.57
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 99.57
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 99.57
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 99.56
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 99.56
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 99.56
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 99.55
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.55
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 99.55
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 99.55
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 99.54
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 99.53
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 99.53
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 99.52
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 99.51
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 99.51
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 99.48
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.48
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 99.48
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.46
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 99.45
1awj_A77 ITK; transferase, regulatory intramolecular comple 99.45
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 99.44
3jv3_A 283 Intersectin-1; SH3 domain, DH domain, guanine nucl 99.43
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 99.42
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 99.41
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 99.41
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 99.41
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 99.39
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 99.39
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 99.37
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 99.37
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 99.36
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.35
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.29
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 99.28
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.26
1u3o_A82 Huntingtin-associated protein-interacting protein; 99.25
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 99.23
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 99.22
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 99.21
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 99.21
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.84
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 99.19
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 99.18
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 98.75
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 99.13
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 99.12
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 99.11
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 99.09
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 99.05
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 99.02
1kjw_A 295 Postsynaptic density protein 95; protein-protein i 98.97
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 98.86
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 98.84
4dey_A 337 Voltage-dependent L-type calcium channel subunit; 98.78
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 98.72
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 98.69
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 98.48
3tsz_A 391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.47
3kfv_A 308 Tight junction protein ZO-3; structural genomics c 98.45
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 98.39
3shw_A 468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.34
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 98.3
3tvt_A 292 Disks large 1 tumor suppressor protein; DLG, SRC-h 98.25
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 97.7
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 97.69
2krs_A74 Probable enterotoxin; all beta, SH3, ENTD, CPF_058 96.26
2kt8_A76 Probable surface protein; SH3 family, structural g 96.03
2kq8_A70 Cell WALL hydrolase; GFT protein structure, NESG, 95.52
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 93.28
1wfw_A74 Kalirin-9A; SH3 domain, neuron-specific GDP/GTP ex 92.53
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 91.42
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 86.02
3h8z_A128 FragIle X mental retardation syndrome-related Pro; 85.06
3npf_A 306 Putative dipeptidyl-peptidase VI; structural genom 83.91
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
Probab=99.74  E-value=3.4e-18  Score=105.25  Aligned_cols=56  Identities=36%  Similarity=0.946  Sum_probs=50.5

Q ss_pred             cceEEEecCCCCCCCCC-CccCCCCEEEEEEecCCCCCeEEEEe-CCeEEEEcCCCeeec
Q psy4227          27 KERCKVLYPYEAQNEDE-LTLKEEDIVVLISRDAPDKGWWKGEL-HGRVGLFPDNFVTVL   84 (157)
Q Consensus        27 ~~~~~al~df~~~~~~e-Ls~~~Gd~i~vl~~~~~~~gWw~g~~-~g~~G~fP~~yv~~~   84 (157)
                      +..|+|+|||.++.++| |+|.+||+|.|+.+  .++|||.|++ +|+.||||++||+.+
T Consensus         3 g~~~rAlydy~~~~~~e~Ls~~~Gd~i~v~~~--~~~~Ww~g~~~~G~~G~fP~nyVe~i   60 (60)
T 2lx7_A            3 GARCRTLYPFSGERHGQGLRFAAGELITLLQV--PDGGWWEGEKEDGLRGWFPASYVQLL   60 (60)
T ss_dssp             SCEEEESCCCCSCCCSSCCCCCTTCEEEBSCC--CTTSCEEEECTTSCEEEECGGGEEEC
T ss_pred             CCEEEECcccCCCCCCCCccCCCCCEEEEeEe--cCCCeEEEEeCCCCEEEEcHHHEEEC
Confidence            45799999999998887 99999999999965  6789999997 789999999999875



>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>2krs_A Probable enterotoxin; all beta, SH3, ENTD, CPF_0587, CPE0606, structural genomics, PSI-2, protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2kt8_A Probable surface protein; SH3 family, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; NMR {Clostridium perfringens} PDB: 2kyb_A Back     alignment and structure
>2kq8_A Cell WALL hydrolase; GFT protein structure, NESG, PSI, SH3 domain, structural genomics, protein structure initiative; NMR {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>1wfw_A Kalirin-9A; SH3 domain, neuron-specific GDP/GTP exchange factor, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3h8z_A FragIle X mental retardation syndrome-related Pro; tudor domains, FXR2, structura genomics, structural genomics consortium, SGC; 1.92A {Homo sapiens} PDB: 3o8v_A 3kuf_A 2bkd_N* Back     alignment and structure
>3npf_A Putative dipeptidyl-peptidase VI; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: CSA GOL; 1.72A {Bacteroides ovatus} PDB: 3pvq_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 157
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 1e-23
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 8e-23
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-22
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 3e-22
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 4e-22
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 8e-22
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 1e-21
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 1e-21
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-21
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 2e-21
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 3e-21
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 4e-21
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 8e-21
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 1e-20
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 3e-20
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 5e-20
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 5e-20
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 3e-19
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 4e-19
d1opka157 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domai 5e-19
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 9e-19
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 1e-18
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 1e-18
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 3e-18
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 4e-18
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 6e-18
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 1e-17
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 1e-17
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 2e-17
d1wlpb153 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic 3e-17
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 4e-17
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 4e-17
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 7e-17
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 1e-16
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 1e-16
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 2e-16
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 3e-16
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 6e-16
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 2e-15
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 3e-15
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 1e-14
d1phta_83 b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-a 6e-14
d1ug1a_92 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 3e-13
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 5e-13
d1i1ja_106 b.34.2.1 (A:) Melanoma inhibitory activity protein 9e-11
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 1e-07
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 3e-06
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 7e-05
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Intersectin 2 (KIAA1256)
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 86.7 bits (214), Expect = 1e-23
 Identities = 25/88 (28%), Positives = 43/88 (48%), Gaps = 2/88 (2%)

Query: 28  ERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVLPTT 87
              + LYP+EA+N DE++    DI+ +  +   + GW  G   G  G FP N+V  +P++
Sbjct: 6   SGYRALYPFEARNHDEMSFNSGDIIQVDEKTVGEPGWLYGSFQGNFGWFPCNYVEKMPSS 65

Query: 88  DETSIKSEKPSPAKSTTNRIRDSITKPS 115
           +     S K +    T +    + + PS
Sbjct: 66  ENEKAVSPKKALLPPTVS--LSATSGPS 91


>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 53 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Length = 106 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query157
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.74
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.73
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.72
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.72
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 99.72
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.71
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.71
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.71
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.7
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 99.69
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.69
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.69
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.69
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.69
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.68
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.68
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.67
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 99.66
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.66
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.66
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.66
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 99.66
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 99.65
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 99.65
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.64
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.64
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.64
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 99.63
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 99.63
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.63
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.62
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 99.61
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.61
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.6
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 99.6
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.6
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 99.6
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 99.59
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 99.59
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 99.57
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.56
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 99.56
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 99.5
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.49
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.48
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.33
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 99.11
d1ri9a_77 Fyn-binding protein (T-cell adapter protein adap) 96.31
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 86.5
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: Grb2-related adaptor protein 2 (Mona/Gads)
species: Mouse (Mus musculus) [TaxId: 10090]
Probab=99.74  E-value=3e-18  Score=102.99  Aligned_cols=55  Identities=36%  Similarity=0.886  Sum_probs=51.4

Q ss_pred             ceEEEecCCCCCCCCCCccCCCCEEEEEEecCCCCCeEEEEeCCeEEEEcCCCeeec
Q psy4227          28 ERCKVLYPYEAQNEDELTLKEEDIVVLISRDAPDKGWWKGELHGRVGLFPDNFVTVL   84 (157)
Q Consensus        28 ~~~~al~df~~~~~~eLs~~~Gd~i~vl~~~~~~~gWw~g~~~g~~G~fP~~yv~~~   84 (157)
                      ++|+|+|+|.++.++||+|.+||+|.|+..  .++|||.|+.+|+.|+||++||+++
T Consensus         2 ~yarAlydy~~~~~~eLs~~~Gd~i~v~~~--~~~~Ww~g~~~g~~G~~P~~yve~i   56 (57)
T d1utia_           2 RWARALYDFEALEEDELGFRSGEVVEVLDS--SNPSWWTGRLHNKLGLFPANYVAPM   56 (57)
T ss_dssp             CEEEESSCBCCCSTTBCCBCTTCEEEEEEC--CSSSEEEEEETTEEEEEEGGGEEEC
T ss_pred             EEEEECcCCCCCCcCCcCCCCCCEEEEeEE--cCCCEEEEEECCcEEEEEHHHEEEc
Confidence            479999999999999999999999999975  5789999999999999999999976



>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ri9a_ b.34.2.1 (A:) Fyn-binding protein (T-cell adapter protein adap) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure