Diaphorina citri psyllid: psy422


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160----
PAPASSTSVGSGTRSPKAGGPGGRPTGSTVRQRKPTTTTAARSNRTGAGSGGMWRYYTDDSPGIKVKSPAPASSTSVGSGTRSPKAGGPGGRPTGSTVRQRKPTTTTAARSNRTGAGSGGMWRYYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYTRSSS
ccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccEEEcccccccccccCEHHHHHHHHHHHHHHHHHHHHHHcccc
*****************************************************WR*Y**************************************************************GMWRYYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYTRS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
PAPASSTSVGSGTRSPKAGGPGGRPTGSTVRQRKPTTTTAARSNRTGAGSGGMWRYYTDDSPGIKVKSPAPASSTSVGSGTRSPKAGGPGGRPTGSTVRQRKPTTTTAARSNRTGAGSGGMWRYYTDDSPGIKVGPVPVLVMSLLFIASVFMLHIWGKYTRSSS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein transport protein Sec61 subunit beta Necessary for protein translocation in the endoplasmic reticulum.confidentQ5RB31
Protein transport protein Sec61 subunit beta Necessary for protein translocation in the endoplasmic reticulum.confidentP60467
Protein transport protein Sec61 subunit beta Necessary for protein translocation in the endoplasmic reticulum.confidentQ9CQS8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0006605 [BP]protein targetingprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006886, GO:0006810, GO:0045184, GO:0044765, GO:0008104, GO:0008150, GO:0071702, GO:0015031, GO:0044763, GO:0009987, GO:0051234, GO:0051649, GO:0051179, GO:0044699, GO:0051641
GO:0043022 [MF]ribosome bindingprobableGO:0043021, GO:0003674, GO:0005488
GO:0010507 [BP]negative regulation of autophagyprobableGO:0009894, GO:0009895, GO:0009892, GO:0019222, GO:0031329, GO:0031330, GO:0031324, GO:0031323, GO:0050794, GO:0008150, GO:0065007, GO:0048519, GO:0010506, GO:0050789, GO:0048523
GO:0048812 [BP]neuron projection morphogenesisprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0009653, GO:0007275, GO:0071840, GO:0000902, GO:0048869, GO:0016043, GO:0032989, GO:0044699, GO:0048666, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0044763, GO:0048731, GO:0022008, GO:0032990, GO:0048699, GO:0048858, GO:0007399, GO:0048856, GO:0008150
GO:0016482 [BP]cytoplasmic transportprobableGO:0009987, GO:0046907, GO:0006810, GO:0044763, GO:0051649, GO:0008150, GO:0051234, GO:0051179, GO:0044699, GO:0051641
GO:0033365 [BP]protein localization to organelleprobableGO:0008104, GO:0070727, GO:0034613, GO:0044763, GO:0008150, GO:0009987, GO:0033036, GO:0051179, GO:0044699, GO:0051641
GO:0031205 [CC]endoplasmic reticulum Sec complexprobableGO:0005783, GO:0044464, GO:0005789, GO:0042175, GO:0043229, GO:0043227, GO:0043226, GO:0005737, GO:0044446, GO:0031090, GO:0016020, GO:0044432, GO:0005791, GO:0012505, GO:0043234, GO:0032991, GO:0043231, GO:0030867, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0030433 [BP]ER-associated protein catabolic processprobableGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WWB, chain C
Confidence level:very confident
Coverage over the Query: 127-162
View the alignment between query and template
View the model in PyMOL
Template: 2WWB, chain C
Confidence level:very confident
Coverage over the Query: 59-67
View the alignment between query and template
View the model in PyMOL