Diaphorina citri psyllid: psy4231


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------
MSDLSDWFNSQPFFTRWWLALTIAFTIGGRFGLLRGSDLILIYDLFVNNFHIWRPITALFYYPLSPANGFHFLMNCYFLYSYSGLLEKGLFDGKPADYAFMLLFNWVCCVVIALLADIYFLMNPMVLSVMYVWCQLNKDANVTFMFRTQFKAMYLPWVLFACNLILFGGGVMELIGILIGHLYFFLTFKYPQEMGGPALLSTPAFMYKWFPNERTTVHGFGQVPRRPAEPTSAGGRSWGRGNVLGGS
cccHHHHHHcccHHHHHHHHHHHHHHHHHHccccccccEEEEHHHHHHHccccccEEEEEEcccccccHHHHHHHHHHHHHHcHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHcccccccccccccccccccccccccccccccccccccc
*SDLSDWFNSQPFFTRWWLALTIAFTIGGRFGLLRGSDLILIYDLFVNNFHIWRPITALFYYPLSPANGFHFLMNCYFLYSYSGLLEKGLFDGKPADYAFMLLFNWVCCVVIALLADIYFLMNPMVLSVMYVWCQLNKDANVTFMFRTQFKAMYLPWVLFACNLILFGGGVMELIGILIGHLYFFLTFKYPQEMGGPALLSTPAFMYKWFPNE***************************GNVL***
xxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDLSDWFNSQPFFTRWWLALTIAFTIGGRFGLLRGSDLILIYDLFVNNFHIWRPITALFYYPLSPANGFHFLMNCYFLYSYSGLLEKGLFDGKPADYAFMLLFNWVCCVVIALLADIYFLMNPMVLSVMYVWCQLNKDANVTFMFRTQFKAMYLPWVLFACNLILFGGGVMELIGILIGHLYFFLTFKYPQEMGGPALLSTPAFMYKWFPNERTTVHGFGQVPRRPAEPTSAGGRSWGRGNVLGGS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Derlin-1 Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and the degradation substrate.very confidentQ5R9W3
Derlin-1 Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and the degradation substrate.very confidentQ99J56
Derlin-1 Functional component of endoplasmic reticulum-associated degradation (ERAD) for misfolded lumenal proteins. May act by forming a channel that allows the retrotranslocation of misfolded proteins into the cytosol where they are ubiquitinated and degraded by the proteasome. May mediate the interaction between VCP and the degradation substrate.very confidentQ71SS4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005770 [CC]late endosomeconfidentGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0030968 [BP]endoplasmic reticulum unfolded protein responseconfidentGO:0023052, GO:0007165, GO:0070887, GO:0007154, GO:0050789, GO:0044699, GO:0006984, GO:0051716, GO:0006986, GO:0071310, GO:0065007, GO:0009987, GO:0050794, GO:0006950, GO:0044763, GO:0042221, GO:0010033, GO:0044700, GO:0050896, GO:0035967, GO:0035966, GO:0033554, GO:0008150, GO:0034976, GO:0034620
GO:0030176 [CC]integral to endoplasmic reticulum membraneconfidentGO:0005783, GO:0005789, GO:0042175, GO:0043229, GO:0031301, GO:0031300, GO:0043227, GO:0031227, GO:0031224, GO:0005737, GO:0044446, GO:0031090, GO:0016021, GO:0016020, GO:0043226, GO:0044432, GO:0012505, GO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0044425, GO:0044422
GO:0006886 [BP]intracellular protein transportconfidentGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006810, GO:0045184, GO:0008104, GO:0044763, GO:0044699, GO:0071702, GO:0015031, GO:0008150, GO:0009987, GO:0051234, GO:0051179, GO:0051649, GO:0051641
GO:0030433 [BP]ER-associated protein catabolic processconfidentGO:0044248, GO:0043632, GO:0044267, GO:1901575, GO:0044265, GO:0044260, GO:0043161, GO:0071704, GO:0006508, GO:0044238, GO:0009987, GO:0019941, GO:0008150, GO:0030163, GO:0008152, GO:0044257, GO:0009056, GO:0009057, GO:0051603, GO:0019538, GO:0010498, GO:0044237, GO:0043170, GO:0006511
GO:0042288 [MF]MHC class I protein bindingconfidentGO:0042287, GO:0005102, GO:0003674, GO:0005488, GO:0005515
GO:0005769 [CC]early endosomeconfidentGO:0005737, GO:0043231, GO:0043227, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0005768, GO:0043226
GO:0030307 [BP]positive regulation of cell growthprobableGO:0045927, GO:0040008, GO:0051128, GO:0001558, GO:0065007, GO:0048518, GO:0008150, GO:0050794, GO:0050789, GO:0048522
GO:0030970 [BP]retrograde protein transport, ER to cytosolprobableGO:0033036, GO:0034613, GO:0046907, GO:0070727, GO:0006886, GO:0006810, GO:0045184, GO:0044765, GO:0008104, GO:0008150, GO:0071702, GO:0015031, GO:0044763, GO:0009987, GO:0051234, GO:0051649, GO:0051179, GO:0044699, GO:0051641
GO:0019060 [BP]intracellular transport of viral proteins in host cellprobableGO:0030581, GO:0008104, GO:0046719, GO:0019048, GO:0042592, GO:0051641, GO:0044699, GO:0000003, GO:0070727, GO:0006886, GO:0044419, GO:0065007, GO:0071702, GO:0065008, GO:0034613, GO:0006810, GO:0006858, GO:0022415, GO:0044766, GO:0044764, GO:0008150, GO:0051649, GO:0051701, GO:0051234, GO:0051179, GO:0051704, GO:0045184, GO:0044703, GO:0033036, GO:0046907, GO:0022414, GO:0044763, GO:0048878, GO:0051708, GO:0016032, GO:0015031, GO:0044403, GO:0009987
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0097038 [CC]perinuclear endoplasmic reticulumprobableGO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044432, GO:0044444, GO:0044424, GO:0048471, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0051788 [BP]response to misfolded proteinprobableGO:0050896, GO:0006950, GO:0035966, GO:0008150, GO:0042221, GO:0010033
GO:0006897 [BP]endocytosisprobableGO:0006810, GO:0008150, GO:0016192, GO:0051234, GO:0051179
GO:0001967 [BP]suckling behaviorprobableGO:0007631, GO:0050896, GO:0007610, GO:0008150, GO:0051705, GO:0051704
GO:0042742 [BP]defense response to bacteriumprobableGO:0009607, GO:0050896, GO:0009617, GO:0006952, GO:0006950, GO:0008150, GO:0051707, GO:0051704
GO:0043581 [BP]mycelium developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0008150, GO:0007275, GO:0044699
GO:0004872 [MF]receptor activityprobableGO:0003674
GO:0018279 [BP]protein N-linked glycosylation via asparagineprobableGO:0044249, GO:0044237, GO:0034645, GO:0009100, GO:0009101, GO:0044267, GO:0044260, GO:0006487, GO:0018196, GO:0018193, GO:0071704, GO:1901576, GO:0009987, GO:0070085, GO:0006464, GO:0043412, GO:0036211, GO:0008150, GO:0008152, GO:0044723, GO:0044238, GO:0005975, GO:0006486, GO:1901137, GO:1901135, GO:0009058, GO:0009059, GO:0043170, GO:0019538, GO:0043413

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NR9, chain A
Confidence level:confident
Coverage over the Query: 9-187
View the alignment between query and template
View the model in PyMOL