Diaphorina citri psyllid: psy4246


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------33
MSANNVALPDSDSEDELPPGWEERVTADGCVYYVNHATEGTQWTHPRTGVKKKVSGDLPLGWEKSVSEDGKITFYNKDTHVKTYTDPRIVFAKEEKENPLDIRQKYDHSTKALQILHGRDLSNYNAIVTGANTGIGFETARSLALHGCRVILACRSLDKANDAISKILTEKPSAQCIAMELNLCRLKSVKKFAEEYQKKFRSLNILVLNAGVFGLGFSHTEDGFETTFQVNHLAHFYLTLQLENALIKGAKLFARQQGAATSIYCATSLDLSLPVSGSYFNNCCRCPPSKAAQDEALATKLWKLSEEMIQSVVSTWLEETTERGEVVF
ccccccccccccccccccccccEEECcccEEEEEEcccccccccccccccccccccccccccEEEECccccEEEEEccccEEEccccccEEEECcccccccccccccccccccEEEccccccccEEEEccccccccHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHHHHccccccEEEcccccccccccccccccHHHcccccHHHHHHHHHHHHHHHHccccccEEEcccccEEEEcccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccc
***************ELPPGWEERVTADGCVYYVNHATEGTQWTHPRTGVKKKVSGDLPLGWEKSVSEDGKITFYNKDTHVKTYTDPRIVFAKE********************ILHGRDLSNYNAIVTGANTGIGFETARSLALHGCRVILACRSLDKANDAISKILTEKPSAQCIAMELNLCRLKSVKKFAEEYQKKFRSLNILVLNAGVFGLGFSHTEDGFETTFQVNHLAHFYLTLQLENALIKGAKLFARQQGAATSIYCATSLDLSLPVSGSYFNNCCRCPPSKAAQDEALATKLWKLSEEMIQSVVSTWL***********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSANNVALPDSDSEDELPPGWEERVTADGCVYYVNHATEGTQWTHPRTGVKKKVSGDLPLGWEKSVSEDGKITFYNKDTHVKTYTDPRIVFAKEEKENPLDIRQKYDHSTKALQILHGRDLSNYNAIVTGANTGIGFETARSLALHGCRVILACRSLDKANDAISKILTEKPSAQCIAMELNLCRLKSVKKFAEEYQKKFRSLNILVLNAGVFGLGFSHTEDGFETTFQVNHLAHFYLTLQLENALIKGAKLFARQQGAATSIYCATSLDLSLPVSGSYFNNCCRCPPSKAAQDEALATKLWKLSEEMIQSVVSTWLEETTERGEVVF

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
WW domain-containing oxidoreductase Putative oxidoreductase. Acts as a tumor suppressor and plays a role in apoptosis. May function synergistically with p53/TP53 to control genotoxic stress-induced cell death. Plays a role in TGFB1 signaling and TGFB1-mediated cell death. May also play a role in tumor necrosis factor (TNF)-mediated cell death. Required for normal bone development. Inhibits Wnt signaling.confidentQ5F389
WW domain-containing oxidoreductase Putative oxidoreductase. Acts as a tumor suppressor and plays a role in apoptosis. Required for normal bone development (By similarity). May function synergistically with p53/TP53 to control genotoxic stress-induced cell death. Plays a role in TGFB1 signaling and TGFB1-mediated cell death. May also play a role in tumor necrosis factor (TNF)-mediated cell death. Inhibits Wnt signaling, probably by sequestering DVL2 in the cytoplasm.confidentQ9NZC7
WW domain-containing oxidoreductase Putative oxidoreductase. Acts as a tumor suppressor and plays a role in apoptosis. May function synergistically with p53/TP53 to control genotoxic stress-induced cell death. Plays a role in TGFB1 signaling and TGFB1-mediated cell death. May also play a role in tumor necrosis factor (TNF)-mediated cell death. Required for normal bone development. Inhibits Wnt signaling, probably by sequestering DVL2 in the cytoplasm.confidentQ5R9W5

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030178 [BP]negative regulation of Wnt receptor signaling pathwayprobableGO:0009968, GO:0009966, GO:0048585, GO:0048583, GO:0050794, GO:0008150, GO:0023057, GO:0030111, GO:0065007, GO:0010648, GO:0023051, GO:0048519, GO:0010646, GO:0050789, GO:0048523
GO:0071560 [BP]cellular response to transforming growth factor beta stimulusprobableGO:0071495, GO:0009719, GO:0051716, GO:0071363, GO:0050896, GO:0009987, GO:0044763, GO:0070848, GO:0010033, GO:0071310, GO:0008150, GO:0070887, GO:0042221, GO:0071559, GO:0044699
GO:0005634 [CC]nucleusprobableGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005902 [CC]microvillusprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0006917 [BP]induction of apoptosisprobableGO:0050789, GO:0043067, GO:0050794, GO:0043065, GO:0048518, GO:0012502, GO:0065007, GO:0010942, GO:0008150, GO:0010941, GO:0042981, GO:0043068, GO:0048522
GO:0005794 [CC]Golgi apparatusprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005886 [CC]plasma membraneprobableGO:0005575, GO:0044464, GO:0016020, GO:0071944, GO:0005623
GO:0016491 [MF]oxidoreductase activityprobableGO:0003824, GO:0003674
GO:0000166 [MF]nucleotide bindingprobableGO:0097159, GO:0036094, GO:0003674, GO:0005488, GO:1901363, GO:1901265
GO:0048705 [BP]skeletal system morphogenesisprobableGO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0001501, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0055114 [BP]oxidation-reduction processprobableGO:0044710, GO:0008150, GO:0008152
GO:0019899 [MF]enzyme bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0046983 [MF]protein dimerization activityprobableGO:0003674, GO:0005488, GO:0005515
GO:0001649 [BP]osteoblast differentiationprobableGO:0032502, GO:0032501, GO:0044707, GO:0048869, GO:0030154, GO:0001503, GO:0044763, GO:0008150, GO:0009987, GO:0044699
GO:0008202 [BP]steroid metabolic processprobableGO:0044238, GO:0044710, GO:0006629, GO:0071704, GO:0008150, GO:0008152, GO:1901360
GO:0050662 [MF]coenzyme bindingprobableGO:0003674, GO:0048037, GO:0005488

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3FTP, chain A
Confidence level:very confident
Coverage over the Query: 118-328
View the alignment between query and template
View the model in PyMOL
Template: 2L5F, chain A
Confidence level:very confident
Coverage over the Query: 13-93
View the alignment between query and template
View the model in PyMOL
Template: 3I3O, chain A
Confidence level:probable
Coverage over the Query: 98-287
View the alignment between query and template
View the model in PyMOL