Diaphorina citri psyllid: psy4254


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110----
MIREKFGEGPRRRYQVRSPPLTKICDCGGVVTNYTLAYKLAMPIHRATPLNSAVRTAQILLMLVICFLLAWTPYAVITFIGQFGDASLITPWVSATPAIFAKFLVDSRIYILVL
cccccccccccccEEEccccCEEECccHHHHHHHHHHHHHHcHHHHcccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcHHHHEEcc
**********R*RYQVRSPPLTKICDCGGVVTNYTLAYKLAMPIHRATPLNSAVRTAQILLMLVICFLLAWTPYAVITFIGQFGDASLITPWVSATPAIFAKFLVDSRIYILVL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxHHHHHHHHHHHHHHHHHxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIREKFGEGPRRRYQVRSPPLTKICDCGGVVTNYTLAYKLAMPIHRATPLNSAVRTAQILLMLVICFLLAWTPYAVITFIGQFGDASLITPWVSATPAIFAKFLVDSRIYILVL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0007165 [BP]signal transductionprobableGO:0044700, GO:0051716, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0023052, GO:0007154, GO:0050789, GO:0044699
GO:0009584 [BP]detection of visible lightprobableGO:0009581, GO:0009582, GO:0009583, GO:0051606, GO:0009605, GO:0009628, GO:0009314, GO:0050896, GO:0009416, GO:0008150
GO:0005575 [CC]cellular_componentprobable

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z73, chain A
Confidence level:very confident
Coverage over the Query: 17-113
View the alignment between query and template
View the model in PyMOL