Diaphorina citri psyllid: psy4260


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MIGAPAAATSTPSTPVSQAGATATATTPGNAESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGEEAPVAANEPQGNNIKQFSSVKEIEIPNLMQGDNKVYTLKYSN
cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccHHHHcccccccccccccccccccHHHccc
***********************************LMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVV**************************************TLKYS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGAPAAATSTPSTPVSQAGATATATTPGNAESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGEEAPVAANEPQGNNIKQFSSVKEIEIPNLMQGDNKVYTLKYSN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UV excision repair protein rhp23 Protects ubiquitin chains against dissambly by deubiquitinating enzymes thereby promoting protein degradation.confidentO74803
UV excision repair protein RAD23 Plays a central role both in proteasomal degradation of misfolded proteins and DNA repair. Central component of a complex required to couple deglycosylation and proteasome-mediated degradation of misfolded proteins in the endoplasmic reticulun that are retrotranslocated in the cytosol. Involved in DNA excision repair. May play a part in DNA damage recognition and/or in altering chromatin structure to allow access by damage-processing enzymes.confidentP32628

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0043130 [MF]ubiquitin bindingprobableGO:0003674, GO:0032182, GO:0005488, GO:0005515
GO:0070628 [MF]proteasome bindingprobableGO:0032403, GO:0003674, GO:0005488, GO:0005515
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1OQY, chain A
Confidence level:very confident
Coverage over the Query: 31-111
View the alignment between query and template
View the model in PyMOL