Psyllid ID: psy4260
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 129 | ||||||
| 345482492 | 358 | PREDICTED: UV excision repair protein RA | 0.697 | 0.251 | 0.586 | 5e-19 | |
| 345482494 | 367 | PREDICTED: UV excision repair protein RA | 0.697 | 0.245 | 0.586 | 5e-19 | |
| 345482490 | 377 | PREDICTED: UV excision repair protein RA | 0.689 | 0.236 | 0.593 | 7e-19 | |
| 383860341 | 365 | PREDICTED: UV excision repair protein RA | 0.565 | 0.2 | 0.628 | 2e-18 | |
| 307211720 | 357 | UV excision repair protein RAD23-like pr | 0.643 | 0.232 | 0.588 | 2e-18 | |
| 340716523 | 337 | PREDICTED: UV excision repair protein RA | 0.635 | 0.243 | 0.595 | 4e-18 | |
| 340716521 | 348 | PREDICTED: UV excision repair protein RA | 0.635 | 0.235 | 0.595 | 6e-18 | |
| 350404552 | 365 | PREDICTED: UV excision repair protein RA | 0.581 | 0.205 | 0.636 | 7e-18 | |
| 340716519 | 364 | PREDICTED: UV excision repair protein RA | 0.596 | 0.211 | 0.615 | 7e-18 | |
| 340716525 | 357 | PREDICTED: UV excision repair protein RA | 0.635 | 0.229 | 0.595 | 8e-18 |
| >gi|345482492|ref|XP_001608155.2| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 1 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
Score = 99.4 bits (246), Expect = 5e-19, Method: Compositional matrix adjust.
Identities = 54/92 (58%), Positives = 62/92 (67%), Gaps = 2/92 (2%)
Query: 7 AATSTPSTPVSQAGATATATTPGNAESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASF 66
A T TP T Q T+ AT+ ES LLMG+EY MV NI+DMGYER V +ALRASF
Sbjct: 134 APTRTPETATQQPTPTSVATS-NPPESALLMGEEYNAMVNNIMDMGYERDQVEQALRASF 192
Query: 67 NNPDRAVEYLITGIPAAVVGEEAPVAANEPQG 98
NNPDRAVEYL+TGIPA + E+ P A E Q
Sbjct: 193 NNPDRAVEYLLTGIPAQLF-EDPPEEAAESQD 223
|
Source: Nasonia vitripennis Species: Nasonia vitripennis Genus: Nasonia Family: Pteromalidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|345482494|ref|XP_003424607.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 3 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|345482490|ref|XP_003424606.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383860341|ref|XP_003705649.1| PREDICTED: UV excision repair protein RAD23 homolog B-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307211720|gb|EFN87721.1| UV excision repair protein RAD23-like protein A [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|340716523|ref|XP_003396747.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 3 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340716521|ref|XP_003396746.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350404552|ref|XP_003487142.1| PREDICTED: UV excision repair protein RAD23 homolog B-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340716519|ref|XP_003396745.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340716525|ref|XP_003396748.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 4 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 129 | ||||||
| FB|FBgn0026777 | 414 | Rad23 "Rad23" [Drosophila mela | 0.387 | 0.120 | 0.64 | 1.8e-11 | |
| UNIPROTKB|K7ESE3 | 308 | RAD23A "UV excision repair pro | 0.395 | 0.165 | 0.627 | 2.2e-11 | |
| RGD|1309899 | 351 | Rad23a "RAD23 homolog A (S. ce | 0.395 | 0.145 | 0.627 | 3.3e-11 | |
| UNIPROTKB|A3KMV2 | 362 | RAD23A "UV excision repair pro | 0.395 | 0.140 | 0.627 | 3.6e-11 | |
| UNIPROTKB|F1PTL1 | 362 | RAD23A "Uncharacterized protei | 0.395 | 0.140 | 0.627 | 3.6e-11 | |
| ZFIN|ZDB-GENE-040808-59 | 362 | rad23aa "RAD23 homolog Aa (S. | 0.395 | 0.140 | 0.607 | 3.6e-11 | |
| UNIPROTKB|P54725 | 363 | RAD23A "UV excision repair pro | 0.395 | 0.140 | 0.627 | 3.6e-11 | |
| MGI|MGI:105126 | 363 | Rad23a "RAD23a homolog (S. cer | 0.395 | 0.140 | 0.627 | 3.6e-11 | |
| UNIPROTKB|D4AD39 | 363 | Rad23a "RAD23a homolog (S. cer | 0.395 | 0.140 | 0.627 | 3.6e-11 | |
| UNIPROTKB|F1SD96 | 380 | RAD23A "Uncharacterized protei | 0.395 | 0.134 | 0.627 | 5.1e-11 |
| FB|FBgn0026777 Rad23 "Rad23" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 164 (62.8 bits), Expect = 1.8e-11, P = 1.8e-11
Identities = 32/50 (64%), Positives = 39/50 (78%)
Query: 31 AESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGI 80
AES LLMGDEY + V ++V+MGY R V A+ AS+NNP+RAVEYLI GI
Sbjct: 149 AESNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNPERAVEYLINGI 198
|
|
| UNIPROTKB|K7ESE3 RAD23A "UV excision repair protein RAD23 homolog A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| RGD|1309899 Rad23a "RAD23 homolog A (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A3KMV2 RAD23A "UV excision repair protein RAD23 homolog A" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PTL1 RAD23A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040808-59 rad23aa "RAD23 homolog Aa (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P54725 RAD23A "UV excision repair protein RAD23 homolog A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:105126 Rad23a "RAD23a homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4AD39 Rad23a "RAD23a homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SD96 RAD23A "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 129 | |||
| TIGR00601 | 378 | TIGR00601, rad23, UV excision repair protein Rad23 | 1e-20 | |
| pfam00627 | 37 | pfam00627, UBA, UBA/TS-N domain | 2e-09 | |
| cd00194 | 38 | cd00194, UBA, Ubiquitin Associated domain | 2e-09 | |
| smart00165 | 37 | smart00165, UBA, Ubiquitin associated domain | 7e-08 |
| >gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 | Back alignment and domain information |
|---|
Score = 84.9 bits (210), Expect = 1e-20
Identities = 39/115 (33%), Positives = 55/115 (47%), Gaps = 17/115 (14%)
Query: 4 APAAATSTPSTPVSQAGATATATTP--------GNAESTLLMGDEYGRMVQNIVDMGYER 55
A A+ +P ++ +P +A STL++G E ++ I++MGYER
Sbjct: 111 AAPASAVEEKSPSEESATATAPESPSTSVPSSGSDAASTLVVGSERETTIEEIMEMGYER 170
Query: 56 SAVTEALRASFNNPDRAVEYLITGIP---------AAVVGEEAPVAANEPQGNNI 101
V ALRA+FNNPDRAVEYL+TGIP A PQ ++
Sbjct: 171 EEVERALRAAFNNPDRAVEYLLTGIPEDPEQPEPVQQTAASTAAATTETPQHGSV 225
|
All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 378 |
| >gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain | Back alignment and domain information |
|---|
| >gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 99.93 | |
| KOG0011|consensus | 340 | 99.9 | ||
| PF00627 | 37 | UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma | 99.47 | |
| cd00194 | 38 | UBA Ubiquitin Associated domain. The UBA domain is | 99.4 | |
| smart00165 | 37 | UBA Ubiquitin associated domain. Present in Rad23, | 99.38 | |
| KOG0944|consensus | 763 | 98.62 | ||
| TIGR00601 | 378 | rad23 UV excision repair protein Rad23. All protei | 98.24 | |
| KOG0418|consensus | 200 | 97.95 | ||
| PF02845 | 42 | CUE: CUE domain; InterPro: IPR003892 This domain m | 97.92 | |
| KOG0011|consensus | 340 | 97.78 | ||
| PF14555 | 43 | UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A | 97.71 | |
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 97.66 | |
| smart00546 | 43 | CUE Domain that may be involved in binding ubiquit | 97.56 | |
| KOG0944|consensus | 763 | 97.51 | ||
| KOG2561|consensus | 568 | 97.39 | ||
| COG5207 | 749 | UBP14 Isopeptidase T [Posttranslational modificati | 97.36 | |
| PF09288 | 55 | UBA_3: Fungal ubiquitin-associated domain ; InterP | 97.04 | |
| KOG2561|consensus | 568 | 96.77 | ||
| PRK06369 | 115 | nac nascent polypeptide-associated complex protein | 96.36 | |
| KOG0010|consensus | 493 | 96.35 | ||
| PF09280 | 59 | XPC-binding: XPC-binding domain; InterPro: IPR0153 | 96.03 | |
| TIGR00264 | 116 | alpha-NAC-related protein. This hypothetical prote | 95.92 | |
| TIGR00116 | 290 | tsf translation elongation factor Ts. This protein | 95.91 | |
| PF07223 | 358 | DUF1421: Protein of unknown function (DUF1421); In | 95.85 | |
| PRK12332 | 198 | tsf elongation factor Ts; Reviewed | 95.84 | |
| PF11626 | 87 | Rap1_C: TRF2-interacting telomeric protein/Rap1 - | 95.82 | |
| PRK09377 | 290 | tsf elongation factor Ts; Provisional | 95.75 | |
| CHL00098 | 200 | tsf elongation factor Ts | 95.64 | |
| KOG2689|consensus | 290 | 95.48 | ||
| COG1308 | 122 | EGD2 Transcription factor homologous to NACalpha-B | 95.23 | |
| PF07499 | 47 | RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 | 93.25 | |
| COG0264 | 296 | Tsf Translation elongation factor Ts [Translation, | 93.01 | |
| PF06972 | 60 | DUF1296: Protein of unknown function (DUF1296); In | 92.3 | |
| PF08938 | 79 | HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This | 90.75 | |
| PF11547 | 53 | E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro | 90.72 | |
| KOG1071|consensus | 340 | 89.19 | ||
| smart00804 | 63 | TAP_C C-terminal domain of vertebrate Tap protein. | 88.98 | |
| PF02954 | 42 | HTH_8: Bacterial regulatory protein, Fis family; I | 88.64 | |
| PF03943 | 51 | TAP_C: TAP C-terminal domain; InterPro: IPR005637 | 87.55 | |
| TIGR00084 | 191 | ruvA Holliday junction DNA helicase, RuvA subunit. | 85.1 | |
| PF03474 | 39 | DMA: DMRTA motif; InterPro: IPR005173 This region | 82.35 | |
| COG4008 | 153 | Predicted metal-binding transcription factor [Tran | 81.63 |
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
Probab=99.93 E-value=2.3e-26 Score=196.63 Aligned_cols=92 Identities=42% Similarity=0.642 Sum_probs=77.0
Q ss_pred CcccccCCCchHHHHHHHHHcCCChHHHHHHHHHhCCCHHHHHHHHHcCCCCCcCCCC----C----------C-c----
Q psy4260 31 AESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGEE----A----------P-V---- 91 (129)
Q Consensus 31 ~~s~~~~g~~~ee~I~~L~eMGF~reqv~~ALras~~n~erAvE~L~~giP~~~~~~~----~----------~-~---- 91 (129)
+.|++++|+.+|+.|++||+|||+|++|++|||++|||+|||||||++|||+..+..+ + + .
T Consensus 146 ~~s~l~~g~~~e~~I~~i~eMGf~R~qV~~ALRAafNNPdRAVEYL~tGIP~~~~~~~~~~~~~~~~~~~~~~~~~~~~l 225 (378)
T TIGR00601 146 AASTLVVGSERETTIEEIMEMGYEREEVERALRAAFNNPDRAVEYLLTGIPEDPEQPEPVQQTAASTAAATTETPQHGSV 225 (378)
T ss_pred cccccccchHHHHHHHHHHHhCCCHHHHHHHHHHHhCCHHHHHHHHHhCCCccccccccCCCcccccccccCCCCCCcch
Confidence 5678999999999999999999999999999999999999999999999997632100 0 0 0
Q ss_pred -------------------cCCCCCCCCCCCccchhhhh------hhhhhhcCCce
Q psy4260 92 -------------------AANEPQGNNIKQFSSVKEIE------IPNLMQGDNKV 122 (129)
Q Consensus 92 -------------------a~~~~~~~n~PqF~~~r~~~------lp~llq~~~~~ 122 (129)
...+.+||++|+|.+||++| |+.|||++++-
T Consensus 226 f~~a~~~~~~~~~~~~~~g~~~l~~Lr~~pqf~~lR~~vq~NP~~L~~lLqql~~~ 281 (378)
T TIGR00601 226 FEQAAQGGTEQPATEAAQGGNPLEFLRNQPQFQQLRQVVQQNPQLLPPLLQQIGQE 281 (378)
T ss_pred hhhhhcccccccccccccCCchHHHhhcCHHHHHHHHHHHHCHHHHHHHHHHHHhh
Confidence 01236689999999999999 99999998764
|
All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). |
| >KOG0011|consensus | Back alignment and domain information |
|---|
| >PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] | Back alignment and domain information |
|---|
| >cd00194 UBA Ubiquitin Associated domain | Back alignment and domain information |
|---|
| >smart00165 UBA Ubiquitin associated domain | Back alignment and domain information |
|---|
| >KOG0944|consensus | Back alignment and domain information |
|---|
| >TIGR00601 rad23 UV excision repair protein Rad23 | Back alignment and domain information |
|---|
| >KOG0418|consensus | Back alignment and domain information |
|---|
| >PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >KOG0011|consensus | Back alignment and domain information |
|---|
| >PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) | Back alignment and domain information |
|---|
| >KOG0944|consensus | Back alignment and domain information |
|---|
| >KOG2561|consensus | Back alignment and domain information |
|---|
| >COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle | Back alignment and domain information |
|---|
| >KOG2561|consensus | Back alignment and domain information |
|---|
| >PRK06369 nac nascent polypeptide-associated complex protein; Reviewed | Back alignment and domain information |
|---|
| >KOG0010|consensus | Back alignment and domain information |
|---|
| >PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array | Back alignment and domain information |
|---|
| >TIGR00264 alpha-NAC-related protein | Back alignment and domain information |
|---|
| >TIGR00116 tsf translation elongation factor Ts | Back alignment and domain information |
|---|
| >PF07223 DUF1421: Protein of unknown function (DUF1421); InterPro: IPR010820 This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function | Back alignment and domain information |
|---|
| >PRK12332 tsf elongation factor Ts; Reviewed | Back alignment and domain information |
|---|
| >PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] | Back alignment and domain information |
|---|
| >PRK09377 tsf elongation factor Ts; Provisional | Back alignment and domain information |
|---|
| >CHL00098 tsf elongation factor Ts | Back alignment and domain information |
|---|
| >KOG2689|consensus | Back alignment and domain information |
|---|
| >COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] | Back alignment and domain information |
|---|
| >PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction | Back alignment and domain information |
|---|
| >COG0264 Tsf Translation elongation factor Ts [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function | Back alignment and domain information |
|---|
| >PF08938 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This domain is found in various eukaryotic HBS1-like proteins | Back alignment and domain information |
|---|
| >PF11547 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro: IPR024725 EDD, the ER ubiquitin ligase from the HECT ligases, contains an N-terminal ubiquitin-associated (UBA) domain which binds ubiquitin | Back alignment and domain information |
|---|
| >KOG1071|consensus | Back alignment and domain information |
|---|
| >smart00804 TAP_C C-terminal domain of vertebrate Tap protein | Back alignment and domain information |
|---|
| >PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] | Back alignment and domain information |
|---|
| >PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) | Back alignment and domain information |
|---|
| >TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit | Back alignment and domain information |
|---|
| >PF03474 DMA: DMRTA motif; InterPro: IPR005173 This region is found to the C terminus of the DM DNA-binding domain IPR001275 from INTERPRO [] | Back alignment and domain information |
|---|
| >COG4008 Predicted metal-binding transcription factor [Transcription] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 129 | ||||
| 1oqy_A | 368 | Structure Of The Dna Repair Protein Hhr23a Length = | 8e-13 | ||
| 1ify_A | 49 | Solution Structure Of The Internal Uba Domain Of Hh | 1e-11 |
| >pdb|1OQY|A Chain A, Structure Of The Dna Repair Protein Hhr23a Length = 368 | Back alignment and structure |
|
| >pdb|1IFY|A Chain A, Solution Structure Of The Internal Uba Domain Of Hhr23a Length = 49 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 129 | |||
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 3e-21 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 6e-14 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 3e-07 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 3e-06 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 4e-06 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 1e-05 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 4e-06 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 2e-04 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 6e-04 |
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 49 | Back alignment and structure |
|---|
Score = 79.0 bits (195), Expect = 3e-21
Identities = 31/49 (63%), Positives = 36/49 (73%)
Query: 34 TLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPA 82
TL+ G EY M+ I+ MGYER V ALRAS+NNP RAVEYL+TGIP
Sbjct: 1 TLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPG 49
|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 99.91 | |
| 1ify_A | 49 | HHR23A, UV excision repair protein RAD23 homolog A | 99.78 | |
| 2g3q_A | 43 | Protein YBL047C; endocytosis, solution structure, | 99.65 | |
| 1vej_A | 74 | Riken cDNA 4931431F19; UBA domain, three helix bun | 99.64 | |
| 1vg5_A | 73 | RSGI RUH-014, rhomboid family protein; UBA domain, | 99.61 | |
| 1wji_A | 63 | Tudor domain containing protein 3; UBA domain, str | 99.6 | |
| 1wgn_A | 63 | UBAP1, ubiquitin associated protein; ubiquitin ass | 99.59 | |
| 2jy5_A | 52 | Ubiquilin-1; UBA, alternative splicing, cytoplasm, | 99.59 | |
| 2dak_A | 63 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 99.58 | |
| 2knz_A | 53 | Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc | 99.56 | |
| 1wiv_A | 73 | UBP14, ubiquitin-specific protease 14; ubiquitin a | 99.55 | |
| 1veg_A | 83 | NEDD8 ultimate buster-1; ubiquitin associated doma | 99.55 | |
| 2cpw_A | 64 | CBL-interacting protein STS-1 variant; ubiquitin a | 99.55 | |
| 2bwb_A | 46 | Ubiquitin-like protein DSK2; UBA, signaling protei | 99.55 | |
| 2dag_A | 74 | Ubiquitin carboxyl-terminal hydrolase 5; isopeptid | 99.53 | |
| 2crn_A | 64 | Ubash3A protein; compact three-helix bundle, struc | 99.53 | |
| 1whc_A | 64 | RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain | 99.53 | |
| 1z96_A | 40 | DNA-damage, UBA-domain protein MUD1; ubiquitin, th | 99.52 | |
| 1wr1_B | 58 | Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu | 99.52 | |
| 2ekk_A | 47 | UBA domain from E3 ubiquitin-protein ligase HUWE1; | 99.49 | |
| 2dai_A | 83 | Ubadc1, ubiquitin associated domain containing 1; | 99.48 | |
| 1dv0_A | 47 | DNA repair protein HHR23A; helical bundle, DNA bin | 99.48 | |
| 1vek_A | 84 | UBP14, ubiquitin-specific protease 14, putative; U | 99.44 | |
| 2dna_A | 67 | Unnamed protein product; ubiquitin associated doma | 99.44 | |
| 2dah_A | 54 | Ubiquilin-3; UBA domain, structural genomics, NPPS | 99.44 | |
| 2dkl_A | 85 | Trinucleotide repeat containing 6C protein; TNRC6C | 99.41 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 99.36 | |
| 2cwb_A | 108 | Chimera of immunoglobulin G binding protein G and | 99.3 | |
| 2ooa_A | 52 | E3 ubiquitin-protein ligase CBL-B; alpha-helical d | 99.21 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 99.2 | |
| 2d9s_A | 53 | CBL E3 ubiquitin protein ligase; UBA domain, dimer | 99.17 | |
| 3k9o_A | 201 | Ubiquitin-conjugating enzyme E2 K; E2-25K, complex | 99.12 | |
| 2juj_A | 56 | E3 ubiquitin-protein ligase CBL; alpha helix, UBA | 99.06 | |
| 2lbc_A | 126 | Ubiquitin carboxyl-terminal hydrolase 13; tandem U | 99.04 | |
| 1wj7_A | 104 | Hypothetical protein (RSGI RUH-015); UBA domain, u | 99.01 | |
| 2oo9_A | 46 | E3 ubiquitin-protein ligase CBL; alpha-helical dom | 98.97 | |
| 4ae4_A | 118 | Ubiquitin-associated protein 1; protein transport, | 98.96 | |
| 1oqy_A | 368 | HHR23A, UV excision repair protein RAD23 homolog A | 98.92 | |
| 2qsf_X | 171 | RAD23, UV excision repair protein RAD23; alpha-bet | 98.86 | |
| 2cp8_A | 54 | NEXT to BRCA1 gene 1 protein; UBA domain, structur | 98.85 | |
| 3e46_A | 253 | Ubiquitin-conjugating enzyme E2-25 kDa; huntington | 98.73 | |
| 2cos_A | 54 | Serine/threonine protein kinase LATS2; UBA domain, | 98.59 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 98.12 | |
| 2pwq_A | 216 | Ubiquitin conjugating enzyme; structural genomics | 98.06 | |
| 1wgl_A | 59 | TOLL-interacting protein; CUE domain, structural g | 97.76 | |
| 1otr_A | 49 | Protein CUE2; protein-protein complex, cell cycle; | 97.62 | |
| 2cp9_A | 64 | EF-TS, EF-TSMT, elongation factor TS, mitochondria | 97.54 | |
| 2dhy_A | 67 | CUE domain-containing protein 1; structural genomi | 97.38 | |
| 3ihp_A | 854 | Ubiquitin carboxyl-terminal hydrolase 5; hydrolase | 97.32 | |
| 1tte_A | 215 | Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq | 97.22 | |
| 2di0_A | 71 | Activating signal cointegrator 1 complex subunit 2 | 97.13 | |
| 1v92_A | 46 | NSFL1 cofactor P47; 3-helix bundle, recombination; | 96.94 | |
| 1q02_A | 52 | Sequestosome 1; helical bundle, protein binding; N | 96.84 | |
| 1pve_A | 72 | HHR23B, UV excision repair protein RAD23 homolog B | 96.68 | |
| 2dal_A | 62 | Protein KIAA0794; FAS associted factor 1, UBA-like | 96.6 | |
| 2dam_A | 67 | ETEA protein; KIAA0887, UBA-like domain, structura | 96.21 | |
| 2f4m_B | 61 | UV excision repair protein RAD23 homolog B; glycop | 96.12 | |
| 2dzl_A | 66 | Protein FAM100B; UBA-like domain, structural genom | 96.11 | |
| 4dbg_B | 162 | Ring finger protein 31; ubiquitin fold, ubiquitina | 95.94 | |
| 1xb2_B | 291 | EF-TS, elongation factor TS, mitochondrial, EF-TSM | 95.89 | |
| 1tr8_A | 102 | Conserved protein (MTH177); chaperones, nascent po | 95.82 | |
| 1aip_C | 196 | EF-TS, elongation factor TS; nucleotide exchange, | 95.71 | |
| 3e21_A | 45 | HFAF1, FAS-associated factor 1; UBA, alternative s | 95.18 | |
| 2qsf_X | 171 | RAD23, UV excision repair protein RAD23; alpha-bet | 94.85 | |
| 1p3q_Q | 54 | VPS9P, vacuolar protein sorting-associated protein | 93.67 | |
| 1ixs_A | 62 | Holliday junction DNA helicase RUVA; heterodimeric | 92.65 | |
| 2qho_B | 53 | E3 ubiquitin-protein ligase EDD1; protein-protein | 92.0 | |
| 1oai_A | 59 | Nuclear RNA export factor; nuclear transport, nucl | 90.64 | |
| 1vdl_A | 80 | Ubiquitin carboxyl-terminal hydrolase 25; UBA doma | 90.35 | |
| 1ufz_A | 83 | Hypothetical protein BAB28515; HBS1-like domain, s | 88.55 | |
| 3bq3_A | 270 | Defective in cullin neddylation protein 1; ubiquit | 86.22 | |
| 3e7l_A | 63 | Transcriptional regulator (NTRC family); sigma43 a | 84.48 | |
| 2jp7_A | 57 | MRNA export factor MEX67; solution MEX67, UBA, tra | 83.15 | |
| 3avx_A | 1289 | Elongation factor TS, elongation factor TU, linke | 81.69 | |
| 2ekf_A | 61 | Ancient ubiquitous protein 1; CUE, ubiquitin ligas | 81.29 | |
| 2ejs_A | 58 | Autocrine motility factor receptor, isoform 2; CUE | 80.83 |
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
Probab=99.91 E-value=1.3e-25 Score=189.55 Aligned_cols=92 Identities=42% Similarity=0.641 Sum_probs=78.0
Q ss_pred CcccccCCCchHHHHHHHHHcCCChHHHHHHHHHhCCCHHHHHHHHHcCCCCCcCCCCCC---------------ccCCC
Q psy4260 31 AESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGEEAP---------------VAANE 95 (129)
Q Consensus 31 ~~s~~~~g~~~ee~I~~L~eMGF~reqv~~ALras~~n~erAvE~L~~giP~~~~~~~~~---------------~a~~~ 95 (129)
+.|++++|+.+++.|++|++|||+|++|++|||+++||+|||+||||+|||+..+...+. .....
T Consensus 158 ~~s~l~~g~~~~~~i~~l~~MGf~~~~~~~AL~a~~nn~~~A~e~L~~gip~~~~~~~~~~~~~~~~~~~~~~~~~~~~l 237 (368)
T 1oqy_A 158 AASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPL 237 (368)
T ss_dssp CCTTTCCTTTHHHHHHHHHTTTCCSHHHHHHHHHSCSSTTHHHHTTTTSSTTCSSCCCCCCCCCCSSCCCCSSCCSCCTT
T ss_pred ccccccCCcchHHHHHHHHHcCCCHHHHHHHHHHcCCCHHHHHHHHHhCCCcccccccCCccccccccccCccccccchH
Confidence 468899999999999999999999999999999999999999999999999864421110 01233
Q ss_pred CCCCCCCCccchhhhh------hhhhhhcCCce
Q psy4260 96 PQGNNIKQFSSVKEIE------IPNLMQGDNKV 122 (129)
Q Consensus 96 ~~~~n~PqF~~~r~~~------lp~llq~~~~~ 122 (129)
.++||+|||++||++| |+.|||+.++-
T Consensus 238 ~~Lr~~pqf~~lR~~vq~nP~~l~~~lq~l~~~ 270 (368)
T 1oqy_A 238 EFLRDQPQFQNMRQVIQQNPALLPALLQQLGQE 270 (368)
T ss_dssp HHHHHSHHHHHHHHSTTTCTTHHHHHHTTTTTT
T ss_pred HHHhcChHHHHHHHHHHhChHHHHHHHHHHHhh
Confidence 4578999999999999 99999999863
|
| >1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B | Back alignment and structure |
|---|
| >2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A | Back alignment and structure |
|---|
| >2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A | Back alignment and structure |
|---|
| >1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A | Back alignment and structure |
|---|
| >2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A | Back alignment and structure |
|---|
| >2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* | Back alignment and structure |
|---|
| >1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A | Back alignment and structure |
|---|
| >2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* | Back alignment and structure |
|---|
| >2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} | Back alignment and structure |
|---|
| >1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 | Back alignment and structure |
|---|
| >2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 | Back alignment and structure |
|---|
| >2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 | Back alignment and structure |
|---|
| >1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A | Back alignment and structure |
|---|
| >1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 | Back alignment and structure |
|---|
| >2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* | Back alignment and structure |
|---|
| >2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} | Back alignment and structure |
|---|
| >1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 | Back alignment and structure |
|---|
| >1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} | Back alignment and structure |
|---|
| >1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 | Back alignment and structure |
|---|
| >3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} | Back alignment and structure |
|---|
| >1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A | Back alignment and structure |
|---|
| >1ixs_A Holliday junction DNA helicase RUVA; heterodimeric protein complex, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.20A {Thermus thermophilus} SCOP: a.5.1.1 | Back alignment and structure |
|---|
| >2qho_B E3 ubiquitin-protein ligase EDD1; protein-protein complex, protein binding/ligase complex; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 | Back alignment and structure |
|---|
| >1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 | Back alignment and structure |
|---|
| >1ufz_A Hypothetical protein BAB28515; HBS1-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, translatio; NMR {Mus musculus} SCOP: a.5.9.1 | Back alignment and structure |
|---|
| >3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A | Back alignment and structure |
|---|
| >2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A | Back alignment and structure |
|---|
| >3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B | Back alignment and structure |
|---|
| >2ekf_A Ancient ubiquitous protein 1; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2ejs_A Autocrine motility factor receptor, isoform 2; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 129 | ||||
| d1oqya1 | 41 | a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum | 5e-15 | |
| d1wjia_ | 63 | a.5.2.1 (A:) Tudor domain containing protein 3, TD | 4e-10 | |
| d1wgna_ | 63 | a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 | 6e-10 | |
| d1wiva_ | 73 | a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress | 6e-10 | |
| d1vg5a_ | 73 | a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th | 7e-08 | |
| d1whca_ | 64 | a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus | 3e-05 | |
| d2crna1 | 51 | a.5.2.1 (A:8-58) Suppressor of T-cell receptor sig | 3e-04 | |
| d2cpwa1 | 51 | a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 | 0.001 | |
| d1veka_ | 84 | a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress | 0.003 |
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: RuvA C-terminal domain-like superfamily: UBA-like family: UBA domain domain: DNA repair protein Hhr23a species: Human (Homo sapiens) [TaxId: 9606]
Score = 61.9 bits (151), Expect = 5e-15
Identities = 26/41 (63%), Positives = 30/41 (73%)
Query: 38 GDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLIT 78
G EY M+ I+ MGYER V ALRAS+NNP RAVEYL+T
Sbjct: 1 GSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLT 41
|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 | Back information, alignment and structure |
|---|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 129 | |||
| d1oqya1 | 41 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 99.71 | |
| d1vg5a_ | 73 | Rhomboid family protein At3g58460 {Thale cress (Ar | 99.66 | |
| d1wjia_ | 63 | Tudor domain containing protein 3, TDRD3 {Human (H | 99.64 | |
| d1wgna_ | 63 | Ubiquitin-associated protein 1, UBAP1 {Human (Homo | 99.61 | |
| d1wiva_ | 73 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 99.58 | |
| d1whca_ | 64 | UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta | 99.53 | |
| d2cpwa1 | 51 | Cbl-interacting protein p70, STS1 {Human (Homo sap | 99.47 | |
| d2crna1 | 51 | Suppressor of T-cell receptor signaling 2 (STS-2) | 99.42 | |
| d2g3qa1 | 43 | Endocytic protein Ede1, YBL047C {Saccharomyces cer | 99.38 | |
| d1veka_ | 84 | Ubiquitin isopeptidase T {Thale cress (Arabidopsis | 99.34 | |
| d1veja1 | 61 | 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] | 99.06 | |
| d2bwba1 | 44 | DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta | 99.03 | |
| d2dnaa1 | 50 | Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus | 98.87 | |
| d2daha1 | 41 | Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | 98.78 | |
| d3e46a1 | 42 | Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal | 98.69 | |
| d1oqya2 | 44 | DNA repair protein Hhr23a {Human (Homo sapiens) [T | 98.52 | |
| d1vega_ | 83 | NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu | 98.34 | |
| d1z96a1 | 38 | UBA-domain protein mud1 {Schizosaccharomyces pombe | 98.28 | |
| d1wj7a1 | 91 | Ubiquitin-associated protein 2-like Ubap2l {Mouse | 97.84 | |
| d1aipc1 | 52 | Elongation factor Ts (EF-Ts), N-terminal domain {T | 97.57 | |
| d1xb2b1 | 56 | Elongation factor Ts (EF-Ts), N-terminal domain {C | 97.49 | |
| d1ttea1 | 55 | Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc | 97.43 | |
| d1efub3 | 54 | Elongation factor Ts (EF-Ts), N-terminal domain {E | 97.4 | |
| d2cosa1 | 41 | Serine/threonine protein kinase LATS2 {Mouse (Mus | 97.24 | |
| d1wgla_ | 59 | Toll-interacting protein {Human (Homo sapiens) [Ta | 97.13 | |
| d1v92a_ | 46 | NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { | 96.92 | |
| d2f4mb1 | 58 | XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu | 96.86 | |
| d2dkla1 | 72 | Trinucleotide repeat containing 6c protein, TNRC6C | 96.56 | |
| d1mn3a_ | 54 | Vacuolar protein sorting-associated protein vps9 { | 96.17 | |
| d2cp8a1 | 41 | Migration-inducing protein 19 NBR1 {Human (Homo sa | 94.85 | |
| d2k0bx1 | 52 | Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [Tax | 93.6 | |
| d2di0a1 | 63 | Activating signal cointegrator 1 complex subunit 2 | 92.89 | |
| d1vdla_ | 80 | Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M | 92.82 | |
| d1oaia_ | 59 | FG-binding, C-terminal domain of TAP {Human (Homo | 90.45 | |
| d1cuka1 | 48 | DNA helicase RuvA subunit, C-terminal domain {Esch | 89.83 | |
| d1umqa_ | 60 | Photosynthetic apparatus regulatory protein PprA ( | 88.66 | |
| d1ufza_ | 83 | HBS1-like protein {Mouse (Mus musculus) [TaxId: 10 | 84.86 | |
| d1etxa_ | 89 | FIS protein {Escherichia coli [TaxId: 562]} | 81.5 |
| >d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: RuvA C-terminal domain-like superfamily: UBA-like family: UBA domain domain: DNA repair protein Hhr23a species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71 E-value=1.3e-18 Score=105.86 Aligned_cols=41 Identities=63% Similarity=1.041 Sum_probs=39.3
Q ss_pred CCchHHHHHHHHHcCCChHHHHHHHHHhCCCHHHHHHHHHc
Q psy4260 38 GDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLIT 78 (129)
Q Consensus 38 g~~~ee~I~~L~eMGF~reqv~~ALras~~n~erAvE~L~~ 78 (129)
|+..|++|++|++|||+|++|++||++++||+|+|+||||+
T Consensus 1 G~~~e~~i~~L~~MGF~~~~a~~AL~~~~~N~e~A~~~LlS 41 (41)
T d1oqya1 1 GSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLT 41 (41)
T ss_dssp TTTHHHHHHHHHTTTCCSHHHHHHHHHSCSSTTHHHHTTTT
T ss_pred ChhHHHHHHHHHHcCCCHHHHHHHHHHhCCCHHHHHHHHhC
Confidence 57889999999999999999999999999999999999985
|
| >d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2k0bx1 a.5.2.1 (X:1-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1cuka1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|