Psyllid ID: psy4260


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------13
MIGAPAAATSTPSTPVSQAGATATATTPGNAESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGEEAPVAANEPQGNNIKQFSSVKEIEIPNLMQGDNKVYTLKYSN
cccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccHHHHcccccccccccccccccccHHHccc
ccccccccccccccccccccccccccccHcHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHHHHccHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHcHHHHHHHHcccccEEEEEEcc
migapaaatstpstpvsqagatatattpgnaestllmgdEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGipaavvgeeapvaanepqgnnikqfssvkeieipnlmqgdnkvytlkysn
migapaaatstpstpvsqagatatattpgnaeSTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGEEAPVAanepqgnnikqfssvkeieipnlmqgdnkvytlkysn
MIGapaaatstpstpvsqagatatattPGNAESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIpaavvgeeapvaanepQGNNIKQFSSVKEIEIPNLMQGDNKVYTLKYSN
**********************************LLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGE******************************************
******************************************RMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITG********************************************TLKYS*
***************************PGNAESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGEEAPVAANEPQGNNIKQFSSVKEIEIPNLMQGDNKVYTLKYSN
***********************************LMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVV******AANEPQGNNIKQFSSVKEIEIPNLMQGDNKVYTLKYSN
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGAPAAATSTPSTPVSQAGATATATTPGNAESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGEEAPVAANEPQGNNIKQFSSVKEIEIPNLMQGDNKVYTLKYSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query129 2.2.26 [Sep-21-2011]
O74803 368 UV excision repair protei yes N/A 0.581 0.203 0.506 4e-14
P54728 416 UV excision repair protei yes N/A 0.596 0.185 0.468 8e-14
Q4KMA2 415 UV excision repair protei yes N/A 0.573 0.178 0.493 1e-13
P54727 409 UV excision repair protei yes N/A 0.558 0.176 0.5 6e-13
A3KMV2 362 UV excision repair protei yes N/A 0.604 0.215 0.461 9e-13
P54725 363 UV excision repair protei no N/A 0.604 0.214 0.461 1e-12
P54726 363 UV excision repair protei no N/A 0.418 0.148 0.611 1e-12
Q29RK4 408 UV excision repair protei no N/A 0.403 0.127 0.634 1e-12
Q84L33 371 Putative DNA repair prote yes N/A 0.596 0.207 0.453 6e-12
Q84L32 368 Putative DNA repair prote no N/A 0.550 0.192 0.506 7e-12
>sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 Back     alignment and function desciption
 Score = 76.6 bits (187), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 42/83 (50%), Positives = 56/83 (67%), Gaps = 8/83 (9%)

Query: 6   AAATSTPSTPVSQAGATATATTPGNAESTLLMGDEYGRMVQNIVDMGYERSAVTEALRAS 65
           AAA S P T       TAT+  P +A +TL +G +    V+N+V+MGYERS V  A+RA+
Sbjct: 120 AAAPSNPDT-------TATSEAPIDA-NTLAVGAQRNVAVENMVEMGYERSEVERAMRAA 171

Query: 66  FNNPDRAVEYLITGIPAAVVGEE 88
           FNNPDRAVEYL+TGIP  ++  +
Sbjct: 172 FNNPDRAVEYLLTGIPEDILNRQ 194




Protects ubiquitin chains against dissambly by deubiquitinating enzymes thereby promoting protein degradation.
Schizosaccharomyces pombe (strain 972 / ATCC 24843) (taxid: 284812)
>sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 Back     alignment and function description
>sp|Q4KMA2|RD23B_RAT UV excision repair protein RAD23 homolog B OS=Rattus norvegicus GN=Rad23b PE=1 SV=1 Back     alignment and function description
>sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 Back     alignment and function description
>sp|A3KMV2|RD23A_BOVIN UV excision repair protein RAD23 homolog A OS=Bos taurus GN=RAD23A PE=2 SV=1 Back     alignment and function description
>sp|P54725|RD23A_HUMAN UV excision repair protein RAD23 homolog A OS=Homo sapiens GN=RAD23A PE=1 SV=1 Back     alignment and function description
>sp|P54726|RD23A_MOUSE UV excision repair protein RAD23 homolog A OS=Mus musculus GN=Rad23a PE=1 SV=2 Back     alignment and function description
>sp|Q29RK4|RD23B_BOVIN UV excision repair protein RAD23 homolog B OS=Bos taurus GN=RAD23B PE=2 SV=1 Back     alignment and function description
>sp|Q84L33|RD23A_ARATH Putative DNA repair protein RAD23-1 OS=Arabidopsis thaliana GN=RAD23-1 PE=2 SV=3 Back     alignment and function description
>sp|Q84L32|RD23B_ARATH Putative DNA repair protein RAD23-2 OS=Arabidopsis thaliana GN=RAD23-2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
345482492 358 PREDICTED: UV excision repair protein RA 0.697 0.251 0.586 5e-19
345482494 367 PREDICTED: UV excision repair protein RA 0.697 0.245 0.586 5e-19
345482490 377 PREDICTED: UV excision repair protein RA 0.689 0.236 0.593 7e-19
383860341 365 PREDICTED: UV excision repair protein RA 0.565 0.2 0.628 2e-18
307211720 357 UV excision repair protein RAD23-like pr 0.643 0.232 0.588 2e-18
340716523 337 PREDICTED: UV excision repair protein RA 0.635 0.243 0.595 4e-18
340716521 348 PREDICTED: UV excision repair protein RA 0.635 0.235 0.595 6e-18
350404552 365 PREDICTED: UV excision repair protein RA 0.581 0.205 0.636 7e-18
340716519 364 PREDICTED: UV excision repair protein RA 0.596 0.211 0.615 7e-18
340716525 357 PREDICTED: UV excision repair protein RA 0.635 0.229 0.595 8e-18
>gi|345482492|ref|XP_001608155.2| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score = 99.4 bits (246), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 54/92 (58%), Positives = 62/92 (67%), Gaps = 2/92 (2%)

Query: 7   AATSTPSTPVSQAGATATATTPGNAESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASF 66
           A T TP T   Q   T+ AT+    ES LLMG+EY  MV NI+DMGYER  V +ALRASF
Sbjct: 134 APTRTPETATQQPTPTSVATS-NPPESALLMGEEYNAMVNNIMDMGYERDQVEQALRASF 192

Query: 67  NNPDRAVEYLITGIPAAVVGEEAPVAANEPQG 98
           NNPDRAVEYL+TGIPA +  E+ P  A E Q 
Sbjct: 193 NNPDRAVEYLLTGIPAQLF-EDPPEEAAESQD 223




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|345482494|ref|XP_003424607.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 3 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|345482490|ref|XP_003424606.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|383860341|ref|XP_003705649.1| PREDICTED: UV excision repair protein RAD23 homolog B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|307211720|gb|EFN87721.1| UV excision repair protein RAD23-like protein A [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340716523|ref|XP_003396747.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 3 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340716521|ref|XP_003396746.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350404552|ref|XP_003487142.1| PREDICTED: UV excision repair protein RAD23 homolog B-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716519|ref|XP_003396745.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340716525|ref|XP_003396748.1| PREDICTED: UV excision repair protein RAD23 homolog B-like isoform 4 [Bombus terrestris] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query129
FB|FBgn0026777 414 Rad23 "Rad23" [Drosophila mela 0.387 0.120 0.64 1.8e-11
UNIPROTKB|K7ESE3308 RAD23A "UV excision repair pro 0.395 0.165 0.627 2.2e-11
RGD|1309899351 Rad23a "RAD23 homolog A (S. ce 0.395 0.145 0.627 3.3e-11
UNIPROTKB|A3KMV2 362 RAD23A "UV excision repair pro 0.395 0.140 0.627 3.6e-11
UNIPROTKB|F1PTL1 362 RAD23A "Uncharacterized protei 0.395 0.140 0.627 3.6e-11
ZFIN|ZDB-GENE-040808-59 362 rad23aa "RAD23 homolog Aa (S. 0.395 0.140 0.607 3.6e-11
UNIPROTKB|P54725 363 RAD23A "UV excision repair pro 0.395 0.140 0.627 3.6e-11
MGI|MGI:105126 363 Rad23a "RAD23a homolog (S. cer 0.395 0.140 0.627 3.6e-11
UNIPROTKB|D4AD39 363 Rad23a "RAD23a homolog (S. cer 0.395 0.140 0.627 3.6e-11
UNIPROTKB|F1SD96 380 RAD23A "Uncharacterized protei 0.395 0.134 0.627 5.1e-11
FB|FBgn0026777 Rad23 "Rad23" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 164 (62.8 bits), Expect = 1.8e-11, P = 1.8e-11
 Identities = 32/50 (64%), Positives = 39/50 (78%)

Query:    31 AESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGI 80
             AES LLMGDEY + V ++V+MGY R  V  A+ AS+NNP+RAVEYLI GI
Sbjct:   149 AESNLLMGDEYNQTVLSMVEMGYPREQVERAMAASYNNPERAVEYLINGI 198




GO:0006289 "nucleotide-excision repair" evidence=ISS;NAS
GO:0003684 "damaged DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=IEA
GO:0043161 "proteasomal ubiquitin-dependent protein catabolic process" evidence=IEA
UNIPROTKB|K7ESE3 RAD23A "UV excision repair protein RAD23 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1309899 Rad23a "RAD23 homolog A (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A3KMV2 RAD23A "UV excision repair protein RAD23 homolog A" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PTL1 RAD23A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040808-59 rad23aa "RAD23 homolog Aa (S. cerevisiae)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P54725 RAD23A "UV excision repair protein RAD23 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:105126 Rad23a "RAD23a homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4AD39 Rad23a "RAD23a homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SD96 RAD23A "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O74803RHP23_SCHPONo assigned EC number0.50600.58130.2038yesN/A
P32628RAD23_YEASTNo assigned EC number0.51660.42630.1381yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
TIGR00601 378 TIGR00601, rad23, UV excision repair protein Rad23 1e-20
pfam0062737 pfam00627, UBA, UBA/TS-N domain 2e-09
cd0019438 cd00194, UBA, Ubiquitin Associated domain 2e-09
smart0016537 smart00165, UBA, Ubiquitin associated domain 7e-08
>gnl|CDD|233045 TIGR00601, rad23, UV excision repair protein Rad23 Back     alignment and domain information
 Score = 84.9 bits (210), Expect = 1e-20
 Identities = 39/115 (33%), Positives = 55/115 (47%), Gaps = 17/115 (14%)

Query: 4   APAAATSTPSTPVSQAGATATATTP--------GNAESTLLMGDEYGRMVQNIVDMGYER 55
           A  A+     +P  ++       +P         +A STL++G E    ++ I++MGYER
Sbjct: 111 AAPASAVEEKSPSEESATATAPESPSTSVPSSGSDAASTLVVGSERETTIEEIMEMGYER 170

Query: 56  SAVTEALRASFNNPDRAVEYLITGIP---------AAVVGEEAPVAANEPQGNNI 101
             V  ALRA+FNNPDRAVEYL+TGIP                A      PQ  ++
Sbjct: 171 EEVERALRAAFNNPDRAVEYLLTGIPEDPEQPEPVQQTAASTAAATTETPQHGSV 225


All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University) [DNA metabolism, DNA replication, recombination, and repair]. Length = 378

>gnl|CDD|201355 pfam00627, UBA, UBA/TS-N domain Back     alignment and domain information
>gnl|CDD|238116 cd00194, UBA, Ubiquitin Associated domain Back     alignment and domain information
>gnl|CDD|197551 smart00165, UBA, Ubiquitin associated domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 129
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 99.93
KOG0011|consensus340 99.9
PF0062737 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA doma 99.47
cd0019438 UBA Ubiquitin Associated domain. The UBA domain is 99.4
smart0016537 UBA Ubiquitin associated domain. Present in Rad23, 99.38
KOG0944|consensus763 98.62
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 98.24
KOG0418|consensus200 97.95
PF0284542 CUE: CUE domain; InterPro: IPR003892 This domain m 97.92
KOG0011|consensus340 97.78
PF1455543 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 97.71
COG5207 749 UBP14 Isopeptidase T [Posttranslational modificati 97.66
smart0054643 CUE Domain that may be involved in binding ubiquit 97.56
KOG0944|consensus 763 97.51
KOG2561|consensus 568 97.39
COG5207749 UBP14 Isopeptidase T [Posttranslational modificati 97.36
PF0928855 UBA_3: Fungal ubiquitin-associated domain ; InterP 97.04
KOG2561|consensus568 96.77
PRK06369115 nac nascent polypeptide-associated complex protein 96.36
KOG0010|consensus493 96.35
PF0928059 XPC-binding: XPC-binding domain; InterPro: IPR0153 96.03
TIGR00264116 alpha-NAC-related protein. This hypothetical prote 95.92
TIGR00116 290 tsf translation elongation factor Ts. This protein 95.91
PF07223358 DUF1421: Protein of unknown function (DUF1421); In 95.85
PRK12332 198 tsf elongation factor Ts; Reviewed 95.84
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 95.82
PRK09377 290 tsf elongation factor Ts; Provisional 95.75
CHL00098 200 tsf elongation factor Ts 95.64
KOG2689|consensus 290 95.48
COG1308122 EGD2 Transcription factor homologous to NACalpha-B 95.23
PF0749947 RuvA_C: RuvA, C-terminal domain; InterPro: IPR0111 93.25
COG0264 296 Tsf Translation elongation factor Ts [Translation, 93.01
PF0697260 DUF1296: Protein of unknown function (DUF1296); In 92.3
PF0893879 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This 90.75
PF1154753 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro 90.72
KOG1071|consensus 340 89.19
smart0080463 TAP_C C-terminal domain of vertebrate Tap protein. 88.98
PF0295442 HTH_8: Bacterial regulatory protein, Fis family; I 88.64
PF0394351 TAP_C: TAP C-terminal domain; InterPro: IPR005637 87.55
TIGR00084191 ruvA Holliday junction DNA helicase, RuvA subunit. 85.1
PF0347439 DMA: DMRTA motif; InterPro: IPR005173 This region 82.35
COG4008153 Predicted metal-binding transcription factor [Tran 81.63
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
Probab=99.93  E-value=2.3e-26  Score=196.63  Aligned_cols=92  Identities=42%  Similarity=0.642  Sum_probs=77.0

Q ss_pred             CcccccCCCchHHHHHHHHHcCCChHHHHHHHHHhCCCHHHHHHHHHcCCCCCcCCCC----C----------C-c----
Q psy4260          31 AESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGEE----A----------P-V----   91 (129)
Q Consensus        31 ~~s~~~~g~~~ee~I~~L~eMGF~reqv~~ALras~~n~erAvE~L~~giP~~~~~~~----~----------~-~----   91 (129)
                      +.|++++|+.+|+.|++||+|||+|++|++|||++|||+|||||||++|||+..+..+    +          + .    
T Consensus       146 ~~s~l~~g~~~e~~I~~i~eMGf~R~qV~~ALRAafNNPdRAVEYL~tGIP~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  225 (378)
T TIGR00601       146 AASTLVVGSERETTIEEIMEMGYEREEVERALRAAFNNPDRAVEYLLTGIPEDPEQPEPVQQTAASTAAATTETPQHGSV  225 (378)
T ss_pred             cccccccchHHHHHHHHHHHhCCCHHHHHHHHHHHhCCHHHHHHHHHhCCCccccccccCCCcccccccccCCCCCCcch
Confidence            5678999999999999999999999999999999999999999999999997632100    0          0 0    


Q ss_pred             -------------------cCCCCCCCCCCCccchhhhh------hhhhhhcCCce
Q psy4260          92 -------------------AANEPQGNNIKQFSSVKEIE------IPNLMQGDNKV  122 (129)
Q Consensus        92 -------------------a~~~~~~~n~PqF~~~r~~~------lp~llq~~~~~  122 (129)
                                         ...+.+||++|+|.+||++|      |+.|||++++-
T Consensus       226 f~~a~~~~~~~~~~~~~~g~~~l~~Lr~~pqf~~lR~~vq~NP~~L~~lLqql~~~  281 (378)
T TIGR00601       226 FEQAAQGGTEQPATEAAQGGNPLEFLRNQPQFQQLRQVVQQNPQLLPPLLQQIGQE  281 (378)
T ss_pred             hhhhhcccccccccccccCCchHHHhhcCHHHHHHHHHHHHCHHHHHHHHHHHHhh
Confidence                               01236689999999999999      99999998764



All proteins in this family for which functions are known are components of a multiprotein complex used for targeting nucleotide excision repair to specific parts of the genome. In humans, Rad23 complexes with the XPC protein. This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University).

>KOG0011|consensus Back     alignment and domain information
>PF00627 UBA: UBA/TS-N domain; InterPro: IPR000449 UBA domains are a commonly occurring sequence motif of approximately 45 amino acid residues that are found in diverse proteins involved in the ubiquitin/proteasome pathway, DNA excision-repair, and cell signalling via protein kinases [] Back     alignment and domain information
>cd00194 UBA Ubiquitin Associated domain Back     alignment and domain information
>smart00165 UBA Ubiquitin associated domain Back     alignment and domain information
>KOG0944|consensus Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>KOG0418|consensus Back     alignment and domain information
>PF02845 CUE: CUE domain; InterPro: IPR003892 This domain may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>KOG0011|consensus Back     alignment and domain information
>PF14555 UBA_4: UBA-like domain; PDB: 2DAL_A 3BQ3_A 2L4E_A 2L4F_A 2DZL_A 2L2D_A 2DAM_A 1V92_A 3E21_A Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>smart00546 CUE Domain that may be involved in binding ubiquitin-conjugating enzymes (UBCs) Back     alignment and domain information
>KOG0944|consensus Back     alignment and domain information
>KOG2561|consensus Back     alignment and domain information
>COG5207 UBP14 Isopeptidase T [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF09288 UBA_3: Fungal ubiquitin-associated domain ; InterPro: IPR015368 This C-terminal domain is found in ubiquitin binding proteins, it adopts a structure consisting of a three alpha-helix bundle Back     alignment and domain information
>KOG2561|consensus Back     alignment and domain information
>PRK06369 nac nascent polypeptide-associated complex protein; Reviewed Back     alignment and domain information
>KOG0010|consensus Back     alignment and domain information
>PF09280 XPC-binding: XPC-binding domain; InterPro: IPR015360 Members of this entry adopt a structure consisting of four alpha helices, arranged in an array Back     alignment and domain information
>TIGR00264 alpha-NAC-related protein Back     alignment and domain information
>TIGR00116 tsf translation elongation factor Ts Back     alignment and domain information
>PF07223 DUF1421: Protein of unknown function (DUF1421); InterPro: IPR010820 This family represents a conserved region approximately 350 residues long within a number of plant proteins of unknown function Back     alignment and domain information
>PRK12332 tsf elongation factor Ts; Reviewed Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>PRK09377 tsf elongation factor Ts; Provisional Back     alignment and domain information
>CHL00098 tsf elongation factor Ts Back     alignment and domain information
>KOG2689|consensus Back     alignment and domain information
>COG1308 EGD2 Transcription factor homologous to NACalpha-BTF3 [Transcription] Back     alignment and domain information
>PF07499 RuvA_C: RuvA, C-terminal domain; InterPro: IPR011114 In prokaryotes, RuvA, RuvB, and RuvC process the universal DNA intermediate of homologous recombination, termed Holliday junction Back     alignment and domain information
>COG0264 Tsf Translation elongation factor Ts [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF06972 DUF1296: Protein of unknown function (DUF1296); InterPro: IPR009719 This family represents a conserved region approximately 60 residues long within a number of plant proteins of unknown function Back     alignment and domain information
>PF08938 HBS1_N: HBS1 N-terminus; InterPro: IPR015033 This domain is found in various eukaryotic HBS1-like proteins Back     alignment and domain information
>PF11547 E3_UbLigase_EDD: E3 ubiquitin ligase EDD; InterPro: IPR024725 EDD, the ER ubiquitin ligase from the HECT ligases, contains an N-terminal ubiquitin-associated (UBA) domain which binds ubiquitin Back     alignment and domain information
>KOG1071|consensus Back     alignment and domain information
>smart00804 TAP_C C-terminal domain of vertebrate Tap protein Back     alignment and domain information
>PF02954 HTH_8: Bacterial regulatory protein, Fis family; InterPro: IPR002197 The Factor for Inversion Stimulation (FIS) protein is a regulator of bacterial functions, and binds specifically to weakly related DNA sequences [,] Back     alignment and domain information
>PF03943 TAP_C: TAP C-terminal domain; InterPro: IPR005637 This entry contains the NXF family of shuttling transport receptors for nuclear export of mRNA, which include: vertebrate mRNA export factor TAP or nuclear RNA export factor 1 (NXF1) Back     alignment and domain information
>TIGR00084 ruvA Holliday junction DNA helicase, RuvA subunit Back     alignment and domain information
>PF03474 DMA: DMRTA motif; InterPro: IPR005173 This region is found to the C terminus of the DM DNA-binding domain IPR001275 from INTERPRO [] Back     alignment and domain information
>COG4008 Predicted metal-binding transcription factor [Transcription] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1oqy_A 368 Structure Of The Dna Repair Protein Hhr23a Length = 8e-13
1ify_A49 Solution Structure Of The Internal Uba Domain Of Hh 1e-11
>pdb|1OQY|A Chain A, Structure Of The Dna Repair Protein Hhr23a Length = 368 Back     alignment and structure

Iteration: 1

Score = 68.6 bits (166), Expect = 8e-13, Method: Compositional matrix adjust. Identities = 32/51 (62%), Positives = 38/51 (74%) Query: 30 NAESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGI 80 +A STL+ G EY M+ I+ MGYER V ALRAS+NNP RAVEYL+TGI Sbjct: 157 DAASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGI 207
>pdb|1IFY|A Chain A, Solution Structure Of The Internal Uba Domain Of Hhr23a Length = 49 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query129
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 3e-21
1oqy_A 368 HHR23A, UV excision repair protein RAD23 homolog A 6e-14
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 3e-07
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 3e-06
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 4e-06
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 1e-05
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 4e-06
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 2e-04
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 6e-04
>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Length = 49 Back     alignment and structure
 Score = 79.0 bits (195), Expect = 3e-21
 Identities = 31/49 (63%), Positives = 36/49 (73%)

Query: 34 TLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPA 82
          TL+ G EY  M+  I+ MGYER  V  ALRAS+NNP RAVEYL+TGIP 
Sbjct: 1  TLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPG 49


>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 63 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Length = 118 Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Length = 73 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Length = 854 Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 83 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 99.91
1ify_A49 HHR23A, UV excision repair protein RAD23 homolog A 99.78
2g3q_A43 Protein YBL047C; endocytosis, solution structure, 99.65
1vej_A74 Riken cDNA 4931431F19; UBA domain, three helix bun 99.64
1vg5_A73 RSGI RUH-014, rhomboid family protein; UBA domain, 99.61
1wji_A63 Tudor domain containing protein 3; UBA domain, str 99.6
1wgn_A63 UBAP1, ubiquitin associated protein; ubiquitin ass 99.59
2jy5_A52 Ubiquilin-1; UBA, alternative splicing, cytoplasm, 99.59
2dak_A63 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.58
2knz_A53 Ubiquilin-4; cytoplasm, endoplasmic reticulum, nuc 99.56
1wiv_A73 UBP14, ubiquitin-specific protease 14; ubiquitin a 99.55
1veg_A83 NEDD8 ultimate buster-1; ubiquitin associated doma 99.55
2cpw_A64 CBL-interacting protein STS-1 variant; ubiquitin a 99.55
2bwb_A46 Ubiquitin-like protein DSK2; UBA, signaling protei 99.55
2dag_A74 Ubiquitin carboxyl-terminal hydrolase 5; isopeptid 99.53
2crn_A64 Ubash3A protein; compact three-helix bundle, struc 99.53
1whc_A64 RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain 99.53
1z96_A40 DNA-damage, UBA-domain protein MUD1; ubiquitin, th 99.52
1wr1_B58 Ubiquitin-like protein DSK2; UBA domain, UBA-ubiqu 99.52
2ekk_A47 UBA domain from E3 ubiquitin-protein ligase HUWE1; 99.49
2dai_A83 Ubadc1, ubiquitin associated domain containing 1; 99.48
1dv0_A47 DNA repair protein HHR23A; helical bundle, DNA bin 99.48
1vek_A84 UBP14, ubiquitin-specific protease 14, putative; U 99.44
2dna_A67 Unnamed protein product; ubiquitin associated doma 99.44
2dah_A54 Ubiquilin-3; UBA domain, structural genomics, NPPS 99.44
2dkl_A85 Trinucleotide repeat containing 6C protein; TNRC6C 99.41
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.36
2cwb_A108 Chimera of immunoglobulin G binding protein G and 99.3
2ooa_A52 E3 ubiquitin-protein ligase CBL-B; alpha-helical d 99.21
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 99.2
2d9s_A53 CBL E3 ubiquitin protein ligase; UBA domain, dimer 99.17
3k9o_A201 Ubiquitin-conjugating enzyme E2 K; E2-25K, complex 99.12
2juj_A56 E3 ubiquitin-protein ligase CBL; alpha helix, UBA 99.06
2lbc_A126 Ubiquitin carboxyl-terminal hydrolase 13; tandem U 99.04
1wj7_A104 Hypothetical protein (RSGI RUH-015); UBA domain, u 99.01
2oo9_A46 E3 ubiquitin-protein ligase CBL; alpha-helical dom 98.97
4ae4_A118 Ubiquitin-associated protein 1; protein transport, 98.96
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 98.92
2qsf_X171 RAD23, UV excision repair protein RAD23; alpha-bet 98.86
2cp8_A54 NEXT to BRCA1 gene 1 protein; UBA domain, structur 98.85
3e46_A253 Ubiquitin-conjugating enzyme E2-25 kDa; huntington 98.73
2cos_A54 Serine/threonine protein kinase LATS2; UBA domain, 98.59
3ihp_A854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 98.12
2pwq_A216 Ubiquitin conjugating enzyme; structural genomics 98.06
1wgl_A59 TOLL-interacting protein; CUE domain, structural g 97.76
1otr_A49 Protein CUE2; protein-protein complex, cell cycle; 97.62
2cp9_A64 EF-TS, EF-TSMT, elongation factor TS, mitochondria 97.54
2dhy_A67 CUE domain-containing protein 1; structural genomi 97.38
3ihp_A 854 Ubiquitin carboxyl-terminal hydrolase 5; hydrolase 97.32
1tte_A215 Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiq 97.22
2di0_A71 Activating signal cointegrator 1 complex subunit 2 97.13
1v92_A46 NSFL1 cofactor P47; 3-helix bundle, recombination; 96.94
1q02_A52 Sequestosome 1; helical bundle, protein binding; N 96.84
1pve_A72 HHR23B, UV excision repair protein RAD23 homolog B 96.68
2dal_A62 Protein KIAA0794; FAS associted factor 1, UBA-like 96.6
2dam_A67 ETEA protein; KIAA0887, UBA-like domain, structura 96.21
2f4m_B61 UV excision repair protein RAD23 homolog B; glycop 96.12
2dzl_A66 Protein FAM100B; UBA-like domain, structural genom 96.11
4dbg_B162 Ring finger protein 31; ubiquitin fold, ubiquitina 95.94
1xb2_B 291 EF-TS, elongation factor TS, mitochondrial, EF-TSM 95.89
1tr8_A102 Conserved protein (MTH177); chaperones, nascent po 95.82
1aip_C 196 EF-TS, elongation factor TS; nucleotide exchange, 95.71
3e21_A45 HFAF1, FAS-associated factor 1; UBA, alternative s 95.18
2qsf_X 171 RAD23, UV excision repair protein RAD23; alpha-bet 94.85
1p3q_Q54 VPS9P, vacuolar protein sorting-associated protein 93.67
1ixs_A62 Holliday junction DNA helicase RUVA; heterodimeric 92.65
2qho_B53 E3 ubiquitin-protein ligase EDD1; protein-protein 92.0
1oai_A59 Nuclear RNA export factor; nuclear transport, nucl 90.64
1vdl_A80 Ubiquitin carboxyl-terminal hydrolase 25; UBA doma 90.35
1ufz_A83 Hypothetical protein BAB28515; HBS1-like domain, s 88.55
3bq3_A 270 Defective in cullin neddylation protein 1; ubiquit 86.22
3e7l_A63 Transcriptional regulator (NTRC family); sigma43 a 84.48
2jp7_A57 MRNA export factor MEX67; solution MEX67, UBA, tra 83.15
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 81.69
2ekf_A61 Ancient ubiquitous protein 1; CUE, ubiquitin ligas 81.29
2ejs_A58 Autocrine motility factor receptor, isoform 2; CUE 80.83
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
Probab=99.91  E-value=1.3e-25  Score=189.55  Aligned_cols=92  Identities=42%  Similarity=0.641  Sum_probs=78.0

Q ss_pred             CcccccCCCchHHHHHHHHHcCCChHHHHHHHHHhCCCHHHHHHHHHcCCCCCcCCCCCC---------------ccCCC
Q psy4260          31 AESTLLMGDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLITGIPAAVVGEEAP---------------VAANE   95 (129)
Q Consensus        31 ~~s~~~~g~~~ee~I~~L~eMGF~reqv~~ALras~~n~erAvE~L~~giP~~~~~~~~~---------------~a~~~   95 (129)
                      +.|++++|+.+++.|++|++|||+|++|++|||+++||+|||+||||+|||+..+...+.               .....
T Consensus       158 ~~s~l~~g~~~~~~i~~l~~MGf~~~~~~~AL~a~~nn~~~A~e~L~~gip~~~~~~~~~~~~~~~~~~~~~~~~~~~~l  237 (368)
T 1oqy_A          158 AASTLVTGSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLTGIPGSPEPEHGSVQESQVSEQPATEAAGENPL  237 (368)
T ss_dssp             CCTTTCCTTTHHHHHHHHHTTTCCSHHHHHHHHHSCSSTTHHHHTTTTSSTTCSSCCCCCCCCCCSSCCCCSSCCSCCTT
T ss_pred             ccccccCCcchHHHHHHHHHcCCCHHHHHHHHHHcCCCHHHHHHHHHhCCCcccccccCCccccccccccCccccccchH
Confidence            468899999999999999999999999999999999999999999999999864421110               01233


Q ss_pred             CCCCCCCCccchhhhh------hhhhhhcCCce
Q psy4260          96 PQGNNIKQFSSVKEIE------IPNLMQGDNKV  122 (129)
Q Consensus        96 ~~~~n~PqF~~~r~~~------lp~llq~~~~~  122 (129)
                      .++||+|||++||++|      |+.|||+.++-
T Consensus       238 ~~Lr~~pqf~~lR~~vq~nP~~l~~~lq~l~~~  270 (368)
T 1oqy_A          238 EFLRDQPQFQNMRQVIQQNPALLPALLQQLGQE  270 (368)
T ss_dssp             HHHHHSHHHHHHHHSTTTCTTHHHHHHTTTTTT
T ss_pred             HHHhcChHHHHHHHHHHhChHHHHHHHHHHHhh
Confidence            4578999999999999      99999999863



>1ify_A HHR23A, UV excision repair protein RAD23 homolog A; ubiquitin associated domain, UBA domain, ubiquitin proteosome pathway, DNA binding protein; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2g3q_A Protein YBL047C; endocytosis, solution structure, UBA domain, endocytosis/signaling protein complex; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>1vej_A Riken cDNA 4931431F19; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1vg5_A RSGI RUH-014, rhomboid family protein; UBA domain, cDNA, structural genomics, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1wji_A Tudor domain containing protein 3; UBA domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1wgn_A UBAP1, ubiquitin associated protein; ubiquitin associated protein 1 (UBAP1), UBA domain, structural genomics; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2jy5_A Ubiquilin-1; UBA, alternative splicing, cytoplasm, nucleus, phosphoprotein, proteasome, signaling protein; NMR {Homo sapiens} PDB: 2jy6_B Back     alignment and structure
>2dak_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5, USP 5, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2knz_A Ubiquilin-4; cytoplasm, endoplasmic reticulum, nucleus, phosphoprotein, protein binding; NMR {Mus musculus} Back     alignment and structure
>1wiv_A UBP14, ubiquitin-specific protease 14; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>1veg_A NEDD8 ultimate buster-1; ubiquitin associated domain, UBA domain, three helix bundle, structural genomics; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2cpw_A CBL-interacting protein STS-1 variant; ubiquitin associated domain, UBA, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2bwb_A Ubiquitin-like protein DSK2; UBA, signaling protein; 2.3A {Saccharomyces cerevisiae} SCOP: a.5.2.1 PDB: 2bwe_A Back     alignment and structure
>2dag_A Ubiquitin carboxyl-terminal hydrolase 5; isopeptidase T, ubiquitin specific protease 5 (USP 5), UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crn_A Ubash3A protein; compact three-helix bundle, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>1whc_A RSGI RUH-027, UBA/UBX 33.3 kDa protein; UBA domain, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1z96_A DNA-damage, UBA-domain protein MUD1; ubiquitin, three-helix bundle, protein transport; 1.80A {Schizosaccharomyces pombe} SCOP: a.5.2.1 Back     alignment and structure
>1wr1_B Ubiquitin-like protein DSK2; UBA domain, UBA-ubiquitin complex, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 Back     alignment and structure
>2ekk_A UBA domain from E3 ubiquitin-protein ligase HUWE1; ubiquitin associated domain, compact three helix bundle, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dai_A Ubadc1, ubiquitin associated domain containing 1; UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1dv0_A DNA repair protein HHR23A; helical bundle, DNA binding protein; HET: DNA; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 1f4i_A Back     alignment and structure
>1vek_A UBP14, ubiquitin-specific protease 14, putative; UBA domain, three helix bundle, ubiquitin associated domain, structural genomics; NMR {Arabidopsis thaliana} SCOP: a.5.2.1 Back     alignment and structure
>2dna_A Unnamed protein product; ubiquitin associated domain, DSK2 protein, proteasome, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2dah_A Ubiquilin-3; UBA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2dkl_A Trinucleotide repeat containing 6C protein; TNRC6C, KIAA1582 protein, UBA domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>2cwb_A Chimera of immunoglobulin G binding protein G and ubiquitin-like protein SB132; helical bundle, protein binding; NMR {Streptococcus SP} PDB: 2den_A Back     alignment and structure
>2ooa_A E3 ubiquitin-protein ligase CBL-B; alpha-helical domain; 1.56A {Homo sapiens} PDB: 2oob_A 2jnh_A 2do6_A Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>2d9s_A CBL E3 ubiquitin protein ligase; UBA domain, dimer, protein binding, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3k9o_A Ubiquitin-conjugating enzyme E2 K; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 3k9p_A 1yla_A 2o25_A Back     alignment and structure
>2juj_A E3 ubiquitin-protein ligase CBL; alpha helix, UBA domain, calcium, cytoplasm, metal- binding, phosphorylation, proto-oncogene, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>2lbc_A Ubiquitin carboxyl-terminal hydrolase 13; tandem UBA of USP13; NMR {Homo sapiens} Back     alignment and structure
>1wj7_A Hypothetical protein (RSGI RUH-015); UBA domain, ubiquitin associated domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>2oo9_A E3 ubiquitin-protein ligase CBL; alpha-helical domain, homodimer; 2.10A {Homo sapiens} Back     alignment and structure
>4ae4_A Ubiquitin-associated protein 1; protein transport, endosomal sorting, tetherin, VPU, HIV-1, monoubiquitin; HET: NHE; 1.65A {Homo sapiens} PDB: 4ae4_B* Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>2cp8_A NEXT to BRCA1 gene 1 protein; UBA domain, structural genomics, human, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.5.2.1 Back     alignment and structure
>3e46_A Ubiquitin-conjugating enzyme E2-25 kDa; huntington interacting, ligase, alternative splicing, cytoplasm, UBL conjugation, UBL conjugation pathway; 1.86A {Homo sapiens} SCOP: a.5.2.1 d.20.1.1 PDB: 3f92_A* Back     alignment and structure
>2cos_A Serine/threonine protein kinase LATS2; UBA domain, structure genomics, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>2pwq_A Ubiquitin conjugating enzyme; structural genomics consortium, SGC, ligase; 1.90A {Plasmodium yoelii} Back     alignment and structure
>1wgl_A TOLL-interacting protein; CUE domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, immune system; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>1otr_A Protein CUE2; protein-protein complex, cell cycle; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.4 Back     alignment and structure
>2cp9_A EF-TS, EF-TSMT, elongation factor TS, mitochondrial; UBA, structural genomics, human, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.2 Back     alignment and structure
>2dhy_A CUE domain-containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ihp_A Ubiquitin carboxyl-terminal hydrolase 5; hydrolase, protease, thiol protease, UBL conjugation pathway, metal-binding, zinc-finger,structural genomics; 2.80A {Homo sapiens} Back     alignment and structure
>1tte_A Ubiquitin-conjugating enzyme E2-24 kDa; UBC1, ubiquitin-dependent degradation, ligase; NMR {Saccharomyces cerevisiae} SCOP: a.5.2.1 d.20.1.1 Back     alignment and structure
>2di0_A Activating signal cointegrator 1 complex subunit 2; ASCC2, CUE domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.5.2.4 Back     alignment and structure
>1v92_A NSFL1 cofactor P47; 3-helix bundle, recombination; NMR {Rattus norvegicus} SCOP: a.5.2.3 Back     alignment and structure
>1q02_A Sequestosome 1; helical bundle, protein binding; NMR {Homo sapiens} SCOP: a.5.2.1 PDB: 2jy7_A 2jy8_A 2k0b_X 2knv_A 2rru_A 3b0f_A Back     alignment and structure
>1pve_A HHR23B, UV excision repair protein RAD23 homolog B; XPC binding domain, solution structure, nucleotide excision repair, chaps, DNA binding protein; NMR {Homo sapiens} SCOP: a.189.1.1 Back     alignment and structure
>2dal_A Protein KIAA0794; FAS associted factor 1, UBA-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dam_A ETEA protein; KIAA0887, UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f4m_B UV excision repair protein RAD23 homolog B; glycoproteins, ubiquitin-dependent protein degradation, NUCL excision repair, peptide:N-glycanase; 1.85A {Mus musculus} SCOP: a.189.1.1 PDB: 2f4o_B* Back     alignment and structure
>2dzl_A Protein FAM100B; UBA-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4dbg_B Ring finger protein 31; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} Back     alignment and structure
>1xb2_B EF-TS, elongation factor TS, mitochondrial, EF-TSMT; protein-protein complex, translation; HET: MSE; 2.20A {Bos taurus} SCOP: a.5.2.2 d.43.1.1 d.43.1.1 Back     alignment and structure
>1tr8_A Conserved protein (MTH177); chaperones, nascent polypeptide-associated complex, ribosome domain, ubiquitin, chaperone; 2.27A {Methanothermobacter marburgensis} Back     alignment and structure
>1aip_C EF-TS, elongation factor TS; nucleotide exchange, GTP-binding, complex of two elongation factors; 3.00A {Thermus thermophilus} SCOP: a.5.2.2 d.43.1.1 Back     alignment and structure
>3e21_A HFAF1, FAS-associated factor 1; UBA, alternative splicing, apoptosis, nucleus, phosphoprotein; 1.73A {Homo sapiens} Back     alignment and structure
>1p3q_Q VPS9P, vacuolar protein sorting-associated protein VPS9; trafficking, post translational modification, mono- ubiquitination; 1.70A {Saccharomyces cerevisiae} SCOP: a.5.2.4 PDB: 1mn3_A Back     alignment and structure
>1ixs_A Holliday junction DNA helicase RUVA; heterodimeric protein complex, AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ANP; 3.20A {Thermus thermophilus} SCOP: a.5.1.1 Back     alignment and structure
>2qho_B E3 ubiquitin-protein ligase EDD1; protein-protein complex, protein binding/ligase complex; 1.85A {Homo sapiens} Back     alignment and structure
>1oai_A Nuclear RNA export factor; nuclear transport, nuclear transport factor; 1.0A {Homo sapiens} SCOP: a.5.2.3 Back     alignment and structure
>1vdl_A Ubiquitin carboxyl-terminal hydrolase 25; UBA domain, mouse cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: a.5.2.1 Back     alignment and structure
>1ufz_A Hypothetical protein BAB28515; HBS1-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, translatio; NMR {Mus musculus} SCOP: a.5.9.1 Back     alignment and structure
>3e7l_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; 2.25A {Aquifex aeolicus} PDB: 4fth_A Back     alignment and structure
>2jp7_A MRNA export factor MEX67; solution MEX67, UBA, translation; NMR {Saccharomyces cerevisiae} PDB: 2khh_A Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>2ekf_A Ancient ubiquitous protein 1; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ejs_A Autocrine motility factor receptor, isoform 2; CUE, ubiquitin ligase complex, ubiquitin-conjugating enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 129
d1oqya141 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Hum 5e-15
d1wjia_63 a.5.2.1 (A:) Tudor domain containing protein 3, TD 4e-10
d1wgna_63 a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 6e-10
d1wiva_73 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 6e-10
d1vg5a_73 a.5.2.1 (A:) Rhomboid family protein At3g58460 {Th 7e-08
d1whca_64 a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus 3e-05
d2crna151 a.5.2.1 (A:8-58) Suppressor of T-cell receptor sig 3e-04
d2cpwa151 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 0.001
d1veka_84 a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress 0.003
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Length = 41 Back     information, alignment and structure

class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: DNA repair protein Hhr23a
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 61.9 bits (151), Expect = 5e-15
 Identities = 26/41 (63%), Positives = 30/41 (73%)

Query: 38 GDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLIT 78
          G EY  M+  I+ MGYER  V  ALRAS+NNP RAVEYL+T
Sbjct: 1  GSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLT 41


>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 64 Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 51 Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 84 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query129
d1oqya141 DNA repair protein Hhr23a {Human (Homo sapiens) [T 99.71
d1vg5a_73 Rhomboid family protein At3g58460 {Thale cress (Ar 99.66
d1wjia_63 Tudor domain containing protein 3, TDRD3 {Human (H 99.64
d1wgna_63 Ubiquitin-associated protein 1, UBAP1 {Human (Homo 99.61
d1wiva_73 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.58
d1whca_64 UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [Ta 99.53
d2cpwa151 Cbl-interacting protein p70, STS1 {Human (Homo sap 99.47
d2crna151 Suppressor of T-cell receptor signaling 2 (STS-2) 99.42
d2g3qa143 Endocytic protein Ede1, YBL047C {Saccharomyces cer 99.38
d1veka_84 Ubiquitin isopeptidase T {Thale cress (Arabidopsis 99.34
d1veja161 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.06
d2bwba144 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.03
d2dnaa150 Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus 98.87
d2daha141 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 98.78
d3e46a142 Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal 98.69
d1oqya244 DNA repair protein Hhr23a {Human (Homo sapiens) [T 98.52
d1vega_83 NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculu 98.34
d1z96a138 UBA-domain protein mud1 {Schizosaccharomyces pombe 98.28
d1wj7a191 Ubiquitin-associated protein 2-like Ubap2l {Mouse 97.84
d1aipc152 Elongation factor Ts (EF-Ts), N-terminal domain {T 97.57
d1xb2b156 Elongation factor Ts (EF-Ts), N-terminal domain {C 97.49
d1ttea155 Ubiquitin-protein ligase ubc1 {Baker's yeast (Sacc 97.43
d1efub354 Elongation factor Ts (EF-Ts), N-terminal domain {E 97.4
d2cosa141 Serine/threonine protein kinase LATS2 {Mouse (Mus 97.24
d1wgla_59 Toll-interacting protein {Human (Homo sapiens) [Ta 97.13
d1v92a_46 NSFL1 (p97 ATPase) cofactor p47, UBA-like domain { 96.92
d2f4mb158 XPC-binding domain of Rad23 homolog B (Hhr23b) {Hu 96.86
d2dkla172 Trinucleotide repeat containing 6c protein, TNRC6C 96.56
d1mn3a_54 Vacuolar protein sorting-associated protein vps9 { 96.17
d2cp8a141 Migration-inducing protein 19 NBR1 {Human (Homo sa 94.85
d2k0bx152 Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [Tax 93.6
d2di0a163 Activating signal cointegrator 1 complex subunit 2 92.89
d1vdla_80 Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (M 92.82
d1oaia_59 FG-binding, C-terminal domain of TAP {Human (Homo 90.45
d1cuka148 DNA helicase RuvA subunit, C-terminal domain {Esch 89.83
d1umqa_60 Photosynthetic apparatus regulatory protein PprA ( 88.66
d1ufza_83 HBS1-like protein {Mouse (Mus musculus) [TaxId: 10 84.86
d1etxa_89 FIS protein {Escherichia coli [TaxId: 562]} 81.5
>d1oqya1 a.5.2.1 (A:160-200) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: RuvA C-terminal domain-like
superfamily: UBA-like
family: UBA domain
domain: DNA repair protein Hhr23a
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71  E-value=1.3e-18  Score=105.86  Aligned_cols=41  Identities=63%  Similarity=1.041  Sum_probs=39.3

Q ss_pred             CCchHHHHHHHHHcCCChHHHHHHHHHhCCCHHHHHHHHHc
Q psy4260          38 GDEYGRMVQNIVDMGYERSAVTEALRASFNNPDRAVEYLIT   78 (129)
Q Consensus        38 g~~~ee~I~~L~eMGF~reqv~~ALras~~n~erAvE~L~~   78 (129)
                      |+..|++|++|++|||+|++|++||++++||+|+|+||||+
T Consensus         1 G~~~e~~i~~L~~MGF~~~~a~~AL~~~~~N~e~A~~~LlS   41 (41)
T d1oqya1           1 GSEYETMLTEIMSMGYERERVVAALRASYNNPHRAVEYLLT   41 (41)
T ss_dssp             TTTHHHHHHHHHTTTCCSHHHHHHHHHSCSSTTHHHHTTTT
T ss_pred             ChhHHHHHHHHHHcCCCHHHHHHHHHHhCCCHHHHHHHHhC
Confidence            57889999999999999999999999999999999999985



>d1vg5a_ a.5.2.1 (A:) Rhomboid family protein At3g58460 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wjia_ a.5.2.1 (A:) Tudor domain containing protein 3, TDRD3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgna_ a.5.2.1 (A:) Ubiquitin-associated protein 1, UBAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiva_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1whca_ a.5.2.1 (A:) UBA/UBX 33.3 kDa protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpwa1 a.5.2.1 (A:8-58) Cbl-interacting protein p70, STS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crna1 a.5.2.1 (A:8-58) Suppressor of T-cell receptor signaling 2 (STS-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g3qa1 a.5.2.1 (A:1339-1381) Endocytic protein Ede1, YBL047C {Saccharomyces cerevisiae [TaxId: 4932]} Back     information, alignment and structure
>d1veka_ a.5.2.1 (A:) Ubiquitin isopeptidase T {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1veja1 a.5.2.1 (A:8-68) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwba1 a.5.2.1 (A:328-371) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2dnaa1 a.5.2.1 (A:12-61) Ubiquilin-like protein Ubqlnl {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2daha1 a.5.2.1 (A:8-48) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3e46a1 a.5.2.1 (A:157-198) Ubiquitin-conjugating enzyme E2-25 kDa, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oqya2 a.5.2.1 (A:317-360) DNA repair protein Hhr23a {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vega_ a.5.2.1 (A:) NEDD8 ultimate buster-1 (Nub1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z96a1 a.5.2.1 (A:295-332) UBA-domain protein mud1 {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1wj7a1 a.5.2.1 (A:8-98) Ubiquitin-associated protein 2-like Ubap2l {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1aipc1 a.5.2.2 (C:2-53) Elongation factor Ts (EF-Ts), N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xb2b1 a.5.2.2 (B:56-111) Elongation factor Ts (EF-Ts), N-terminal domain {Cow (Bos taurus), mitochondrial [TaxId: 9913]} Back     information, alignment and structure
>d1ttea1 a.5.2.1 (A:161-215) Ubiquitin-protein ligase ubc1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1efub3 a.5.2.2 (B:1-54) Elongation factor Ts (EF-Ts), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cosa1 a.5.2.1 (A:8-48) Serine/threonine protein kinase LATS2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgla_ a.5.2.4 (A:) Toll-interacting protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v92a_ a.5.2.3 (A:) NSFL1 (p97 ATPase) cofactor p47, UBA-like domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f4mb1 a.189.1.1 (B:275-332) XPC-binding domain of Rad23 homolog B (Hhr23b) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dkla1 a.5.2.1 (A:8-79) Trinucleotide repeat containing 6c protein, TNRC6C {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mn3a_ a.5.2.4 (A:) Vacuolar protein sorting-associated protein vps9 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cp8a1 a.5.2.1 (A:8-48) Migration-inducing protein 19 NBR1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2k0bx1 a.5.2.1 (X:1-52) Sequestosome 1 (Sqstm1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2di0a1 a.5.2.4 (A:8-70) Activating signal cointegrator 1 complex subunit 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdla_ a.5.2.1 (A:) Ubiquitin carboxyl-terminal hydrolase 25 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oaia_ a.5.2.3 (A:) FG-binding, C-terminal domain of TAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cuka1 a.5.1.1 (A:156-203) DNA helicase RuvA subunit, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1umqa_ a.4.1.12 (A:) Photosynthetic apparatus regulatory protein PprA (RegA), DNA-binding domain {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1ufza_ a.5.9.1 (A:) HBS1-like protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1etxa_ a.4.1.12 (A:) FIS protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure