Diaphorina citri psyllid: psy4275


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
MEDPIKSFTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDEDCIGCAKTGSGKTLAFALPILQKWCEDPYGIFALVLTPTRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKELAKKPHIVIATPGRLADHLDTCNTFSLNRIKFLVLDEADRLSLMTSLKFFFFFFFLKYYIPS
ccccccccccccccHHHHHHHHHcccccccHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHHHccccccccEEEEEcccHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHccccEEEEcccHHHHHHccccccccccccEEEEEcccccccccccccHHHHHHHHHHccc
****IKSFTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDEDCIGCAKTGSGKTLAFALPILQKWCEDPYGIFALVLTPTRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKELAKKPHIVIATPGRLADHLDTCNTFSLNRIKFLVLDEADRLSLMTSLKFFFFFFFLKYYIPS
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEDPIKSFTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDEDCIGCAKTGSGKTLAFALPILQKWCEDPYGIFALVLTPTRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKELAKKPHIVIATPGRLADHLDTCNTFSLNRIKFLVLDEADRLSLMTSLKFFFFFFFLKYYIPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
ATP-dependent RNA helicase DBP8 ATP-binding RNA helicase involved in 40S ribosomal subunit biogenesis and is required for the normal formation of 18S rRNAs through pre-rRNA processing at A0, A1 and A2 sites. Required for vegetative growth.confidentQ6BGU8
ATP-dependent RNA helicase DBP8 ATP-binding RNA helicase involved in 40S ribosomal subunit biogenesis and is required for the normal formation of 18S rRNAs through pre-rRNA processing at A0, A1 and A2 sites. Required for vegetative growth.confidentQ756G5
ATP-dependent RNA helicase DBP8 ATP-binding RNA helicase involved in 40S ribosomal subunit biogenesis and is required for the normal formation of 18S rRNAs through pre-rRNA processing at A0, A1 and A2 sites. Required for vegetative growth.confidentQ4I662

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0030687 [CC]preribosome, large subunit precursorprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0030686 [CC]90S preribosomeprobableGO:0032991, GO:0044464, GO:0030684, GO:0005623, GO:0030529, GO:0005575, GO:0044424, GO:0005622
GO:0071013 [CC]catalytic step 2 spliceosomeprobableGO:0005575, GO:0032991, GO:0043231, GO:0005634, GO:0044464, GO:0005623, GO:0030529, GO:0044446, GO:0043229, GO:0044428, GO:0044422, GO:0044424, GO:0005622, GO:0043227, GO:0043226, GO:0005681
GO:0071944 [CC]cell peripheryprobableGO:0005575, GO:0044464, GO:0005623
GO:0048856 [BP]anatomical structure developmentprobableGO:0032502, GO:0008150
GO:0043234 [CC]protein complexprobableGO:0005575, GO:0032991
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006364 [BP]rRNA processingprobableGO:0090304, GO:0034641, GO:0006807, GO:0034660, GO:1901360, GO:0006139, GO:0044260, GO:0042254, GO:0071704, GO:0010467, GO:0071840, GO:0022613, GO:0034470, GO:0009987, GO:0006725, GO:0008150, GO:0008152, GO:0046483, GO:0016070, GO:0044238, GO:0016072, GO:0044237, GO:0043170, GO:0044085, GO:0006396
GO:0090406 [CC]pollen tubeprobableGO:0005575, GO:0042995, GO:0044464, GO:0005623
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0004004 [MF]ATP-dependent RNA helicase activityprobableGO:0016787, GO:0016818, GO:0008026, GO:0042623, GO:0003824, GO:0017111, GO:0016817, GO:0004386, GO:0070035, GO:0003724, GO:0003674, GO:0016887, GO:0008186, GO:0016462
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0006915 [BP]apoptotic processprobableGO:0010259, GO:0009987, GO:0012501, GO:0044763, GO:0008150, GO:0007569, GO:0044699
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0003723 [MF]RNA bindingprobableGO:0097159, GO:0003674, GO:1901363, GO:0003676, GO:0005488
GO:0040008 [BP]regulation of growthprobableGO:0008150, GO:0065007, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3BER, chain A
Confidence level:very confident
Coverage over the Query: 4-173
View the alignment between query and template
View the model in PyMOL