Psyllid ID: psy4275
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 182 | ||||||
| 270005640 | 447 | hypothetical protein TcasGA2_TC007723 [T | 0.857 | 0.348 | 0.756 | 3e-66 | |
| 322796322 | 420 | hypothetical protein SINV_00745 [Solenop | 0.884 | 0.383 | 0.726 | 2e-65 | |
| 307167913 | 457 | Probable ATP-dependent RNA helicase DDX4 | 0.873 | 0.347 | 0.729 | 3e-65 | |
| 332016384 | 461 | Putative ATP-dependent RNA helicase DDX4 | 0.884 | 0.349 | 0.720 | 5e-65 | |
| 242005222 | 422 | DEAD box ATP-dependent RNA helicase, put | 0.857 | 0.369 | 0.705 | 4e-63 | |
| 156549811 | 456 | PREDICTED: probable ATP-dependent RNA he | 0.851 | 0.339 | 0.735 | 6e-62 | |
| 383851888 | 449 | PREDICTED: probable ATP-dependent RNA he | 0.851 | 0.345 | 0.716 | 2e-60 | |
| 346466157 | 487 | hypothetical protein [Amblyomma maculatu | 0.851 | 0.318 | 0.703 | 3e-60 | |
| 350415766 | 452 | PREDICTED: probable ATP-dependent RNA he | 0.851 | 0.342 | 0.716 | 6e-60 | |
| 380026593 | 452 | PREDICTED: probable ATP-dependent RNA he | 0.851 | 0.342 | 0.709 | 7e-60 |
| >gi|270005640|gb|EFA02088.1| hypothetical protein TcasGA2_TC007723 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 256 bits (654), Expect = 3e-66, Method: Compositional matrix adjust.
Identities = 118/156 (75%), Positives = 136/156 (87%)
Query: 6 KSFTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDEDCIGCAKTGSGKTLAFALPIL 65
KSF L+LNPW+IRQC TIGV++PT IQ IP +L DCIG AKTGSGKTLAFALPIL
Sbjct: 4 KSFDKLQLNPWIIRQCATIGVRSPTPIQTNCIPPILAGRDCIGAAKTGSGKTLAFALPIL 63
Query: 66 QKWCEDPYGIFALVLTPTRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKELAKKP 125
QK CEDPYGIFAL+LTPTRELA+QI DQF V+GKVMNLR +I GGMDMV QGK+LA+KP
Sbjct: 64 QKLCEDPYGIFALILTPTRELAFQIADQFAVIGKVMNLRHCVIVGGMDMVVQGKDLARKP 123
Query: 126 HIVIATPGRLADHLDTCNTFSLNRIKFLVLDEADRL 161
HIV+ATPGRLADHL++CNTF+ N+++FLVLDEADRL
Sbjct: 124 HIVVATPGRLADHLESCNTFNFNKLRFLVLDEADRL 159
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|322796322|gb|EFZ18887.1| hypothetical protein SINV_00745 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307167913|gb|EFN61290.1| Probable ATP-dependent RNA helicase DDX49 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332016384|gb|EGI57297.1| Putative ATP-dependent RNA helicase DDX49 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|242005222|ref|XP_002423470.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] gi|212506558|gb|EEB10732.1| DEAD box ATP-dependent RNA helicase, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|156549811|ref|XP_001606554.1| PREDICTED: probable ATP-dependent RNA helicase DDX49-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|383851888|ref|XP_003701463.1| PREDICTED: probable ATP-dependent RNA helicase DDX49-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|346466157|gb|AEO32923.1| hypothetical protein [Amblyomma maculatum] | Back alignment and taxonomy information |
|---|
| >gi|350415766|ref|XP_003490744.1| PREDICTED: probable ATP-dependent RNA helicase DDX49-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|380026593|ref|XP_003697032.1| PREDICTED: probable ATP-dependent RNA helicase DDX49-like [Apis florea] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 182 | ||||||
| RGD|1311124 | 480 | Ddx49 "DEAD (Asp-Glu-Ala-Asp) | 0.846 | 0.320 | 0.662 | 4.9e-53 | |
| UNIPROTKB|E2RBM7 | 488 | DDX49 "Uncharacterized protein | 0.846 | 0.315 | 0.662 | 1.3e-52 | |
| UNIPROTKB|Q9Y6V7 | 483 | DDX49 "Probable ATP-dependent | 0.846 | 0.318 | 0.662 | 1.3e-52 | |
| UNIPROTKB|F1S7D9 | 483 | DDX49 "Uncharacterized protein | 0.846 | 0.318 | 0.662 | 1.3e-52 | |
| ZFIN|ZDB-GENE-031030-3 | 468 | ddx49 "DEAD (Asp-Glu-Ala-Asp) | 0.851 | 0.331 | 0.638 | 2.1e-52 | |
| MGI|MGI:2136689 | 480 | Ddx49 "DEAD (Asp-Glu-Ala-Asp) | 0.846 | 0.320 | 0.649 | 5.6e-52 | |
| UNIPROTKB|F1NA53 | 402 | DDX49 "Uncharacterized protein | 0.851 | 0.385 | 0.632 | 6.5e-51 | |
| UNIPROTKB|F1NYX0 | 482 | DDX49 "Uncharacterized protein | 0.851 | 0.321 | 0.632 | 6.5e-51 | |
| POMBASE|SPBC543.06c | 453 | dbp8 "ATP-dependent RNA helica | 0.857 | 0.344 | 0.572 | 1.5e-44 | |
| FB|FBgn0010220 | 521 | Dbp45A "DEAD box protein 45A" | 0.846 | 0.295 | 0.564 | 1.9e-44 |
| RGD|1311124 Ddx49 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 49" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
Score = 549 (198.3 bits), Expect = 4.9e-53, P = 4.9e-53
Identities = 102/154 (66%), Positives = 123/154 (79%)
Query: 8 FTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDEDCIGCAKTGSGKTLAFALPILQK 67
F +L+L+ WL+ QC+ +G+K PT +Q IP +L DC+GCAKTGSGKT AF LPILQK
Sbjct: 4 FAELRLSSWLVEQCRQLGLKQPTPVQLGCIPAILEGRDCLGCAKTGSGKTAAFVLPILQK 63
Query: 68 WCEDPYGIFALVLTPTRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKELAKKPHI 127
EDPYGIF LVLTPTRELAYQI +QF VLGK + L+ II GGMDMV Q EL++KPH+
Sbjct: 64 LSEDPYGIFCLVLTPTRELAYQIAEQFRVLGKPLGLKDCIIVGGMDMVTQALELSRKPHV 123
Query: 128 VIATPGRLADHLDTCNTFSLNRIKFLVLDEADRL 161
VIATPGRLADHL + NTF++ +I+FLVLDEADRL
Sbjct: 124 VIATPGRLADHLRSSNTFNMKKIRFLVLDEADRL 157
|
|
| UNIPROTKB|E2RBM7 DDX49 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y6V7 DDX49 "Probable ATP-dependent RNA helicase DDX49" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S7D9 DDX49 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-031030-3 ddx49 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 49" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2136689 Ddx49 "DEAD (Asp-Glu-Ala-Asp) box polypeptide 49" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NA53 DDX49 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NYX0 DDX49 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| POMBASE|SPBC543.06c dbp8 "ATP-dependent RNA helicase Dbp8 (predicted)" [Schizosaccharomyces pombe (taxid:4896)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0010220 Dbp45A "DEAD box protein 45A" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 182 | |||
| cd00268 | 203 | cd00268, DEADc, DEAD-box helicases | 8e-66 | |
| COG0513 | 513 | COG0513, SrmB, Superfamily II DNA and RNA helicase | 2e-59 | |
| pfam00270 | 169 | pfam00270, DEAD, DEAD/DEAH box helicase | 6e-50 | |
| PRK11776 | 460 | PRK11776, PRK11776, ATP-dependent RNA helicase Dbp | 7e-41 | |
| PRK11192 | 434 | PRK11192, PRK11192, ATP-dependent RNA helicase Srm | 7e-39 | |
| smart00487 | 201 | smart00487, DEXDc, DEAD-like helicases superfamily | 6e-36 | |
| PRK10590 | 456 | PRK10590, PRK10590, ATP-dependent RNA helicase Rhl | 2e-34 | |
| PRK11634 | 629 | PRK11634, PRK11634, ATP-dependent RNA helicase Dea | 1e-33 | |
| cd00046 | 144 | cd00046, DEXDc, DEAD-like helicases superfamily | 9e-33 | |
| PTZ00110 | 545 | PTZ00110, PTZ00110, helicase; Provisional | 1e-31 | |
| PLN00206 | 518 | PLN00206, PLN00206, DEAD-box ATP-dependent RNA hel | 7e-29 | |
| PRK01297 | 475 | PRK01297, PRK01297, ATP-dependent RNA helicase Rhl | 2e-27 | |
| PTZ00424 | 401 | PTZ00424, PTZ00424, helicase 45; Provisional | 6e-27 | |
| PRK04537 | 572 | PRK04537, PRK04537, ATP-dependent RNA helicase Rhl | 1e-26 | |
| PRK04837 | 423 | PRK04837, PRK04837, ATP-dependent RNA helicase Rhl | 1e-22 | |
| COG1201 | 814 | COG1201, Lhr, Lhr-like helicases [General function | 8e-16 | |
| COG1204 | 766 | COG1204, COG1204, Superfamily II helicase [General | 9e-13 | |
| COG1205 | 851 | COG1205, COG1205, Distinct helicase family with a | 1e-10 | |
| PRK13767 | 876 | PRK13767, PRK13767, ATP-dependent helicase; Provis | 1e-07 | |
| TIGR04121 | 803 | TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA | 1e-05 | |
| TIGR03817 | 742 | TIGR03817, DECH_helic, helicase/secretion neighbor | 2e-05 | |
| COG1061 | 442 | COG1061, SSL2, DNA or RNA helicases of superfamily | 9e-05 | |
| TIGR00643 | 630 | TIGR00643, recG, ATP-dependent DNA helicase RecG | 0.004 |
| >gnl|CDD|238167 cd00268, DEADc, DEAD-box helicases | Back alignment and domain information |
|---|
Score = 200 bits (510), Expect = 8e-66
Identities = 75/156 (48%), Positives = 100/156 (64%), Gaps = 3/156 (1%)
Query: 8 FTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDEDCIGCAKTGSGKTLAFALPILQK 67
F +L L+P L+R +G + PT IQ IP +L+ D IG A+TGSGKT AF +PIL+K
Sbjct: 1 FEELGLSPELLRGIYALGFEKPTPIQARAIPPLLSGRDVIGQAQTGSGKTAAFLIPILEK 60
Query: 68 W--CEDPYGIFALVLTPTRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKELAKKP 125
G AL+L PTRELA QI + LGK NL+V +I GG + Q ++L + P
Sbjct: 61 LDPSPKKDGPQALILAPTRELALQIAEVARKLGKHTNLKVVVIYGGTSIDKQIRKLKRGP 120
Query: 126 HIVIATPGRLADHLDTCNTFSLNRIKFLVLDEADRL 161
HIV+ATPGRL D L+ L+++K+LVLDEADR+
Sbjct: 121 HIVVATPGRLLDLLER-GKLDLSKVKYLVLDEADRM 155
|
A diverse family of proteins involved in ATP-dependent RNA unwinding, needed in a variety of cellular processes including splicing, ribosome biogenesis and RNA degradation. The name derives from the sequence of the Walker B motif (motif II). This domain contains the ATP- binding region. Length = 203 |
| >gnl|CDD|223587 COG0513, SrmB, Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|215832 pfam00270, DEAD, DEAD/DEAH box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|236977 PRK11776, PRK11776, ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236877 PRK11192, PRK11192, ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|214692 smart00487, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|236722 PRK10590, PRK10590, ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236941 PRK11634, PRK11634, ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238005 cd00046, DEXDc, DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >gnl|CDD|240273 PTZ00110, PTZ00110, helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215103 PLN00206, PLN00206, DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234938 PRK01297, PRK01297, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|185609 PTZ00424, PTZ00424, helicase 45; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235307 PRK04537, PRK04537, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|235314 PRK04837, PRK04837, ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224122 COG1201, Lhr, Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224125 COG1204, COG1204, Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|224126 COG1205, COG1205, Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|237497 PRK13767, PRK13767, ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|234478 TIGR04121, DEXH_lig_assoc, DEXH box helicase, DNA ligase-associated | Back alignment and domain information |
|---|
| >gnl|CDD|234365 TIGR03817, DECH_helic, helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >gnl|CDD|223989 COG1061, SSL2, DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >gnl|CDD|233069 TIGR00643, recG, ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 182 | |||
| KOG0330|consensus | 476 | 100.0 | ||
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| PTZ00110 | 545 | helicase; Provisional | 100.0 | |
| PLN00206 | 518 | DEAD-box ATP-dependent RNA helicase; Provisional | 100.0 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 100.0 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 100.0 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 100.0 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 99.98 | |
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 99.98 | |
| KOG0331|consensus | 519 | 99.97 | ||
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 99.97 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 99.97 | |
| KOG0338|consensus | 691 | 99.97 | ||
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 99.97 | |
| KOG0340|consensus | 442 | 99.97 | ||
| KOG0348|consensus | 708 | 99.97 | ||
| PTZ00424 | 401 | helicase 45; Provisional | 99.97 | |
| PRK02362 | 737 | ski2-like helicase; Provisional | 99.96 | |
| KOG0345|consensus | 567 | 99.96 | ||
| KOG0339|consensus | 731 | 99.96 | ||
| KOG0328|consensus | 400 | 99.95 | ||
| KOG0343|consensus | 758 | 99.95 | ||
| KOG0342|consensus | 543 | 99.95 | ||
| KOG0346|consensus | 569 | 99.95 | ||
| TIGR03817 | 742 | DECH_helic helicase/secretion neighborhood putativ | 99.95 | |
| KOG0335|consensus | 482 | 99.95 | ||
| PRK00254 | 720 | ski2-like helicase; Provisional | 99.95 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 99.95 | |
| KOG0333|consensus | 673 | 99.95 | ||
| KOG0347|consensus | 731 | 99.95 | ||
| PRK01172 | 674 | ski2-like helicase; Provisional | 99.94 | |
| KOG0350|consensus | 620 | 99.94 | ||
| KOG0326|consensus | 459 | 99.94 | ||
| KOG0334|consensus | 997 | 99.93 | ||
| COG1201 | 814 | Lhr Lhr-like helicases [General function predictio | 99.93 | |
| PRK13767 | 876 | ATP-dependent helicase; Provisional | 99.92 | |
| KOG0341|consensus | 610 | 99.92 | ||
| COG1205 | 851 | Distinct helicase family with a unique C-terminal | 99.91 | |
| COG1204 | 766 | Superfamily II helicase [General function predicti | 99.91 | |
| KOG0336|consensus | 629 | 99.9 | ||
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 99.9 | |
| KOG0329|consensus | 387 | 99.89 | ||
| KOG0327|consensus | 397 | 99.89 | ||
| KOG0332|consensus | 477 | 99.89 | ||
| PLN03137 | 1195 | ATP-dependent DNA helicase; Q4-like; Provisional | 99.89 | |
| KOG4284|consensus | 980 | 99.89 | ||
| KOG0337|consensus | 529 | 99.89 | ||
| TIGR01389 | 591 | recQ ATP-dependent DNA helicase RecQ. The ATP-depe | 99.88 | |
| PRK11057 | 607 | ATP-dependent DNA helicase RecQ; Provisional | 99.88 | |
| PRK09401 | 1176 | reverse gyrase; Reviewed | 99.87 | |
| KOG0952|consensus | 1230 | 99.87 | ||
| PRK12899 | 970 | secA preprotein translocase subunit SecA; Reviewed | 99.87 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 99.87 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 99.86 | |
| COG1202 | 830 | Superfamily II helicase, archaea-specific [General | 99.86 | |
| PRK14701 | 1638 | reverse gyrase; Provisional | 99.86 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 99.86 | |
| TIGR02621 | 844 | cas3_GSU0051 CRISPR-associated helicase Cas3, Anae | 99.86 | |
| TIGR01054 | 1171 | rgy reverse gyrase. Generally, these gyrases are e | 99.85 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 99.84 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 99.83 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 99.83 | |
| PRK09751 | 1490 | putative ATP-dependent helicase Lhr; Provisional | 99.83 | |
| PRK13766 | 773 | Hef nuclease; Provisional | 99.82 | |
| KOG0344|consensus | 593 | 99.82 | ||
| COG1111 | 542 | MPH1 ERCC4-like helicases [DNA replication, recomb | 99.81 | |
| TIGR03714 | 762 | secA2 accessory Sec system translocase SecA2. Memb | 99.78 | |
| KOG0354|consensus | 746 | 99.78 | ||
| TIGR03158 | 357 | cas3_cyano CRISPR-associated helicase, Cyano-type. | 99.77 | |
| TIGR00963 | 745 | secA preprotein translocase, SecA subunit. The pro | 99.77 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 99.74 | |
| PRK09200 | 790 | preprotein translocase subunit SecA; Reviewed | 99.74 | |
| COG1061 | 442 | SSL2 DNA or RNA helicases of superfamily II [Trans | 99.74 | |
| PRK12898 | 656 | secA preprotein translocase subunit SecA; Reviewed | 99.73 | |
| TIGR00603 | 732 | rad25 DNA repair helicase rad25. All proteins in t | 99.73 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 99.73 | |
| PRK13104 | 896 | secA preprotein translocase subunit SecA; Reviewed | 99.72 | |
| COG0514 | 590 | RecQ Superfamily II DNA helicase [DNA replication, | 99.71 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 99.7 | |
| COG4581 | 1041 | Superfamily II RNA helicase [DNA replication, reco | 99.69 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 99.66 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 99.66 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 99.66 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 99.65 | |
| KOG0951|consensus | 1674 | 99.64 | ||
| TIGR01407 | 850 | dinG_rel DnaQ family exonuclease/DinG family helic | 99.64 | |
| TIGR01587 | 358 | cas3_core CRISPR-associated helicase Cas3. This mo | 99.64 | |
| PRK12904 | 830 | preprotein translocase subunit SecA; Reviewed | 99.63 | |
| PRK11448 | 1123 | hsdR type I restriction enzyme EcoKI subunit R; Pr | 99.6 | |
| KOG0353|consensus | 695 | 99.59 | ||
| KOG0352|consensus | 641 | 99.59 | ||
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 99.58 | |
| COG1110 | 1187 | Reverse gyrase [DNA replication, recombination, an | 99.58 | |
| PRK13107 | 908 | preprotein translocase subunit SecA; Reviewed | 99.56 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 99.55 | |
| PRK07246 | 820 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.55 | |
| KOG0949|consensus | 1330 | 99.53 | ||
| PRK09694 | 878 | helicase Cas3; Provisional | 99.51 | |
| KOG0947|consensus | 1248 | 99.51 | ||
| TIGR03117 | 636 | cas_csf4 CRISPR-associated DEAD/DEAH-box helicase | 99.5 | |
| KOG0351|consensus | 941 | 99.48 | ||
| PRK08074 | 928 | bifunctional ATP-dependent DNA helicase/DNA polyme | 99.47 | |
| TIGR00348 | 667 | hsdR type I site-specific deoxyribonuclease, HsdR | 99.46 | |
| COG4096 | 875 | HsdR Type I site-specific restriction-modification | 99.45 | |
| KOG0349|consensus | 725 | 99.45 | ||
| PF00176 | 299 | SNF2_N: SNF2 family N-terminal domain; InterPro: I | 99.45 | |
| PRK13103 | 913 | secA preprotein translocase subunit SecA; Reviewed | 99.44 | |
| smart00488 | 289 | DEXDc2 DEAD-like helicases superfamily. | 99.42 | |
| smart00489 | 289 | DEXDc3 DEAD-like helicases superfamily. | 99.42 | |
| KOG0948|consensus | 1041 | 99.41 | ||
| PLN03142 | 1033 | Probable chromatin-remodeling complex ATPase chain | 99.4 | |
| PF07517 | 266 | SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011 | 99.38 | |
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 99.38 | |
| PRK12906 | 796 | secA preprotein translocase subunit SecA; Reviewed | 99.35 | |
| KOG0951|consensus | 1674 | 99.35 | ||
| KOG0385|consensus | 971 | 99.34 | ||
| PRK12326 | 764 | preprotein translocase subunit SecA; Reviewed | 99.33 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 99.32 | |
| PRK11747 | 697 | dinG ATP-dependent DNA helicase DinG; Provisional | 99.31 | |
| KOG0950|consensus | 1008 | 99.31 | ||
| PRK04914 | 956 | ATP-dependent helicase HepA; Validated | 99.3 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 99.26 | |
| KOG0389|consensus | 941 | 99.25 | ||
| KOG0391|consensus | 1958 | 99.24 | ||
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 99.21 | |
| PRK12902 | 939 | secA preprotein translocase subunit SecA; Reviewed | 99.2 | |
| TIGR00604 | 705 | rad3 DNA repair helicase (rad3). All proteins in t | 99.19 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 99.17 | |
| KOG0387|consensus | 923 | 99.14 | ||
| CHL00122 | 870 | secA preprotein translocase subunit SecA; Validate | 99.12 | |
| KOG1123|consensus | 776 | 99.12 | ||
| COG1199 | 654 | DinG Rad3-related DNA helicases [Transcription / D | 99.1 | |
| KOG0920|consensus | 924 | 99.09 | ||
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 99.09 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 99.08 | |
| KOG0952|consensus | 1230 | 99.07 | ||
| KOG0922|consensus | 674 | 99.04 | ||
| KOG1802|consensus | 935 | 98.99 | ||
| KOG0390|consensus | 776 | 98.97 | ||
| PRK12903 | 925 | secA preprotein translocase subunit SecA; Reviewed | 98.96 | |
| KOG4439|consensus | 901 | 98.95 | ||
| COG1203 | 733 | CRISPR-associated helicase Cas3 [Defense mechanism | 98.93 | |
| COG4889 | 1518 | Predicted helicase [General function prediction on | 98.9 | |
| PRK14873 | 665 | primosome assembly protein PriA; Provisional | 98.89 | |
| KOG0384|consensus | 1373 | 98.89 | ||
| KOG0388|consensus | 1185 | 98.88 | ||
| KOG1000|consensus | 689 | 98.88 | ||
| COG0610 | 962 | Type I site-specific restriction-modification syst | 98.87 | |
| KOG1002|consensus | 791 | 98.86 | ||
| PRK15483 | 986 | type III restriction-modification system StyLTI en | 98.84 | |
| KOG0392|consensus | 1549 | 98.82 | ||
| KOG0925|consensus | 699 | 98.77 | ||
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 98.76 | |
| PRK12900 | 1025 | secA preprotein translocase subunit SecA; Reviewed | 98.74 | |
| KOG0923|consensus | 902 | 98.74 | ||
| KOG0386|consensus | 1157 | 98.73 | ||
| KOG0926|consensus | 1172 | 98.71 | ||
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 98.68 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 98.67 | |
| PRK12901 | 1112 | secA preprotein translocase subunit SecA; Reviewed | 98.61 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 98.58 | |
| KOG0924|consensus | 1042 | 98.53 | ||
| KOG1803|consensus | 649 | 98.49 | ||
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 98.45 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 98.44 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 98.43 | |
| COG0553 | 866 | HepA Superfamily II DNA/RNA helicases, SNF2 family | 98.39 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 98.38 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 98.38 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 98.3 | |
| KOG1805|consensus | 1100 | 98.3 | ||
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 98.23 | |
| PF12340 | 229 | DUF3638: Protein of unknown function (DUF3638); In | 98.21 | |
| PF13872 | 303 | AAA_34: P-loop containing NTP hydrolase pore-1 | 98.21 | |
| COG3587 | 985 | Restriction endonuclease [Defense mechanisms] | 98.2 | |
| KOG1132|consensus | 945 | 98.18 | ||
| KOG1131|consensus | 755 | 98.18 | ||
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 98.14 | |
| COG0653 | 822 | SecA Preprotein translocase subunit SecA (ATPase, | 98.13 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 98.11 | |
| KOG0989|consensus | 346 | 98.04 | ||
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 97.92 | |
| KOG1001|consensus | 674 | 97.87 | ||
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 97.85 | |
| TIGR02562 | 1110 | cas3_yersinia CRISPR-associated helicase Cas3. The | 97.84 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 97.83 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 97.82 | |
| PRK11054 | 684 | helD DNA helicase IV; Provisional | 97.81 | |
| COG1875 | 436 | NYN ribonuclease and ATPase of PhoH family domains | 97.79 | |
| COG2805 | 353 | PilT Tfp pilus assembly protein, pilus retraction | 97.77 | |
| PRK10919 | 672 | ATP-dependent DNA helicase Rep; Provisional | 97.75 | |
| COG0556 | 663 | UvrB Helicase subunit of the DNA excision repair c | 97.72 | |
| PHA02533 | 534 | 17 large terminase protein; Provisional | 97.7 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 97.68 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 97.68 | |
| KOG0953|consensus | 700 | 97.61 | ||
| TIGR01075 | 715 | uvrD DNA helicase II. Designed to identify uvrD me | 97.59 | |
| PRK06526 | 254 | transposase; Provisional | 97.59 | |
| KOG1015|consensus | 1567 | 97.58 | ||
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 97.58 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.56 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.56 | |
| PF05621 | 302 | TniB: Bacterial TniB protein; InterPro: IPR008868 | 97.54 | |
| PRK11773 | 721 | uvrD DNA-dependent helicase II; Provisional | 97.51 | |
| TIGR01074 | 664 | rep ATP-dependent DNA helicase Rep. Designed to id | 97.44 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 97.43 | |
| PRK08181 | 269 | transposase; Validated | 97.4 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 97.39 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 97.35 | |
| PRK11331 | 459 | 5-methylcytosine-specific restriction enzyme subun | 97.29 | |
| TIGR01073 | 726 | pcrA ATP-dependent DNA helicase PcrA. Designed to | 97.27 | |
| PF14617 | 252 | CMS1: U3-containing 90S pre-ribosomal complex subu | 97.27 | |
| KOG0298|consensus | 1394 | 97.23 | ||
| KOG0991|consensus | 333 | 97.22 | ||
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 97.16 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 97.14 | |
| PHA03333 | 752 | putative ATPase subunit of terminase; Provisional | 97.13 | |
| TIGR02785 | 1232 | addA_Gpos recombination helicase AddA, Firmicutes | 97.13 | |
| TIGR01547 | 396 | phage_term_2 phage terminase, large subunit, PBSX | 97.11 | |
| PF05127 | 177 | Helicase_RecD: Helicase; InterPro: IPR007807 This | 97.1 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 97.1 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 97.09 | |
| PF03354 | 477 | Terminase_1: Phage Terminase ; InterPro: IPR005021 | 97.09 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 97.09 | |
| COG3973 | 747 | Superfamily I DNA and RNA helicases [General funct | 97.09 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 97.08 | |
| PRK05298 | 652 | excinuclease ABC subunit B; Provisional | 97.06 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 97.06 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 97.06 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 97.04 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 97.03 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 97.03 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 97.01 | |
| KOG4150|consensus | 1034 | 96.98 | ||
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 96.97 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 96.96 | |
| KOG0333|consensus | 673 | 96.96 | ||
| PRK06995 | 484 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.93 | |
| PRK05707 | 328 | DNA polymerase III subunit delta'; Validated | 96.92 | |
| PF05876 | 557 | Terminase_GpA: Phage terminase large subunit (GpA) | 96.88 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 96.87 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 96.84 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 96.82 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 96.81 | |
| PRK14960 | 702 | DNA polymerase III subunits gamma and tau; Provisi | 96.81 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 96.8 | |
| KOG2340|consensus | 698 | 96.79 | ||
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 96.79 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.79 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 96.78 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 96.78 | |
| COG1444 | 758 | Predicted P-loop ATPase fused to an acetyltransfer | 96.75 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 96.73 | |
| PRK14958 | 509 | DNA polymerase III subunits gamma and tau; Provisi | 96.71 | |
| KOG0921|consensus | 1282 | 96.71 | ||
| COG3421 | 812 | Uncharacterized protein conserved in bacteria [Fun | 96.7 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 96.7 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 96.7 | |
| COG4962 | 355 | CpaF Flp pilus assembly protein, ATPase CpaF [Intr | 96.7 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 96.7 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 96.69 | |
| PRK07764 | 824 | DNA polymerase III subunits gamma and tau; Validat | 96.67 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 96.65 | |
| PRK06645 | 507 | DNA polymerase III subunits gamma and tau; Validat | 96.61 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 96.58 | |
| PRK07003 | 830 | DNA polymerase III subunits gamma and tau; Validat | 96.57 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 96.57 | |
| PRK05563 | 559 | DNA polymerase III subunits gamma and tau; Validat | 96.57 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 96.57 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 96.56 | |
| COG1474 | 366 | CDC6 Cdc6-related protein, AAA superfamily ATPase | 96.55 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 96.55 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 96.54 | |
| PRK12323 | 700 | DNA polymerase III subunits gamma and tau; Provisi | 96.53 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 96.49 | |
| PRK08691 | 709 | DNA polymerase III subunits gamma and tau; Validat | 96.48 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 96.47 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.47 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 96.45 | |
| PF03237 | 384 | Terminase_6: Terminase-like family; InterPro: IPR0 | 96.43 | |
| PHA03368 | 738 | DNA packaging terminase subunit 1; Provisional | 96.42 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.42 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 96.42 | |
| PRK14951 | 618 | DNA polymerase III subunits gamma and tau; Provisi | 96.41 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 96.41 | |
| PTZ00112 | 1164 | origin recognition complex 1 protein; Provisional | 96.39 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.38 | |
| COG4626 | 546 | Phage terminase-like protein, large subunit [Gener | 96.36 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 96.35 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 96.35 | |
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 96.33 | |
| KOG1016|consensus | 1387 | 96.31 | ||
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 96.31 | |
| PRK14952 | 584 | DNA polymerase III subunits gamma and tau; Provisi | 96.31 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 96.3 | |
| COG1435 | 201 | Tdk Thymidine kinase [Nucleotide transport and met | 96.29 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 96.29 | |
| COG1197 | 1139 | Mfd Transcription-repair coupling factor (superfam | 96.29 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 96.27 | |
| PRK08116 | 268 | hypothetical protein; Validated | 96.26 | |
| PRK14963 | 504 | DNA polymerase III subunits gamma and tau; Provisi | 96.23 | |
| PRK07994 | 647 | DNA polymerase III subunits gamma and tau; Validat | 96.23 | |
| PF13177 | 162 | DNA_pol3_delta2: DNA polymerase III, delta subunit | 96.22 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 96.21 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 96.19 | |
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 96.19 | |
| PRK14965 | 576 | DNA polymerase III subunits gamma and tau; Provisi | 96.17 | |
| PRK08451 | 535 | DNA polymerase III subunits gamma and tau; Validat | 96.17 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 96.17 | |
| KOG0331|consensus | 519 | 96.15 | ||
| COG0470 | 325 | HolB ATPase involved in DNA replication [DNA repli | 96.15 | |
| PRK14957 | 546 | DNA polymerase III subunits gamma and tau; Provisi | 96.14 | |
| PF02456 | 369 | Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR | 96.13 | |
| PRK14959 | 624 | DNA polymerase III subunits gamma and tau; Provisi | 96.12 | |
| TIGR00678 | 188 | holB DNA polymerase III, delta' subunit. At positi | 96.11 | |
| PRK14955 | 397 | DNA polymerase III subunits gamma and tau; Provisi | 96.11 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 96.11 | |
| KOG1133|consensus | 821 | 96.11 | ||
| PRK06647 | 563 | DNA polymerase III subunits gamma and tau; Validat | 96.11 | |
| PRK08769 | 319 | DNA polymerase III subunit delta'; Validated | 96.11 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 96.09 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.07 | |
| PRK09111 | 598 | DNA polymerase III subunits gamma and tau; Validat | 96.04 | |
| PRK10689 | 1147 | transcription-repair coupling factor; Provisional | 96.03 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 96.0 | |
| TIGR00580 | 926 | mfd transcription-repair coupling factor (mfd). Al | 95.98 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 95.98 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 95.97 | |
| PRK14969 | 527 | DNA polymerase III subunits gamma and tau; Provisi | 95.97 | |
| PF06733 | 174 | DEAD_2: DEAD_2; InterPro: IPR010614 This represent | 95.96 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 95.91 | |
| PRK05896 | 605 | DNA polymerase III subunits gamma and tau; Validat | 95.9 | |
| PRK14954 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 95.87 | |
| PRK14950 | 585 | DNA polymerase III subunits gamma and tau; Provisi | 95.86 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 95.85 | |
| PTZ00293 | 211 | thymidine kinase; Provisional | 95.83 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 95.79 | |
| COG5008 | 375 | PilU Tfp pilus assembly protein, ATPase PilU [Cell | 95.79 | |
| KOG2373|consensus | 514 | 95.78 | ||
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 95.77 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 95.75 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 95.75 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 95.75 | |
| PRK06964 | 342 | DNA polymerase III subunit delta'; Validated | 95.74 | |
| PRK13764 | 602 | ATPase; Provisional | 95.73 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.72 | |
| TIGR02688 | 449 | conserved hypothetical protein TIGR02688. Members | 95.71 | |
| PRK07993 | 334 | DNA polymerase III subunit delta'; Validated | 95.71 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 95.7 | |
| COG0210 | 655 | UvrD Superfamily I DNA and RNA helicases [DNA repl | 95.7 | |
| COG1702 | 348 | PhoH Phosphate starvation-inducible protein PhoH, | 95.68 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 95.67 | |
| TIGR02397 | 355 | dnaX_nterm DNA polymerase III, subunit gamma and t | 95.64 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 95.56 | |
| TIGR03600 | 421 | phage_DnaB phage replicative helicase, DnaB family | 95.55 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 95.54 | |
| PRK14948 | 620 | DNA polymerase III subunits gamma and tau; Provisi | 95.54 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 95.53 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 95.52 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 95.51 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 95.51 | |
| PRK07471 | 365 | DNA polymerase III subunit delta'; Validated | 95.49 | |
| KOG0341|consensus | 610 | 95.44 | ||
| TIGR00763 | 775 | lon ATP-dependent protease La. This protein is ind | 95.39 | |
| KOG0739|consensus | 439 | 95.38 | ||
| PHA00012 | 361 | I assembly protein | 95.38 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 95.35 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 95.33 | |
| PRK13700 | 732 | conjugal transfer protein TraD; Provisional | 95.3 | |
| PF02572 | 172 | CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase | 95.28 | |
| PRK13341 | 725 | recombination factor protein RarA/unknown domain f | 95.25 | |
| PRK14953 | 486 | DNA polymerase III subunits gamma and tau; Provisi | 95.24 | |
| PF05729 | 166 | NACHT: NACHT domain | 95.24 | |
| PHA00350 | 399 | putative assembly protein | 95.23 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 95.22 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 95.21 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 95.21 | |
| COG0513 | 513 | SrmB Superfamily II DNA and RNA helicases [DNA rep | 95.2 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 95.18 | |
| TIGR02640 | 262 | gas_vesic_GvpN gas vesicle protein GvpN. Members o | 95.18 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 95.17 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 95.16 | |
| PRK04328 | 249 | hypothetical protein; Provisional | 95.16 | |
| PRK04537 | 572 | ATP-dependent RNA helicase RhlB; Provisional | 95.14 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 95.14 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 95.13 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 95.1 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 95.08 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 95.08 | |
| PF06862 | 442 | DUF1253: Protein of unknown function (DUF1253); In | 95.07 | |
| COG1221 | 403 | PspF Transcriptional regulators containing an AAA- | 95.07 | |
| cd01126 | 384 | TraG_VirD4 The TraG/TraD/VirD4 family are bacteria | 95.05 | |
| PRK05748 | 448 | replicative DNA helicase; Provisional | 95.04 | |
| PRK08699 | 325 | DNA polymerase III subunit delta'; Validated | 95.01 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 95.0 | |
| cd01123 | 235 | Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of r | 94.99 | |
| PRK09376 | 416 | rho transcription termination factor Rho; Provisio | 94.99 | |
| cd01128 | 249 | rho_factor Transcription termination factor rho is | 94.94 | |
| COG0468 | 279 | RecA RecA/RadA recombinase [DNA replication, recom | 94.92 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 94.9 | |
| PF08423 | 256 | Rad51: Rad51; InterPro: IPR013632 This domain is f | 94.87 | |
| PF02534 | 469 | T4SS-DNA_transf: Type IV secretory system Conjugat | 94.87 | |
| TIGR03743 | 634 | SXT_TraD conjugative coupling factor TraD, SXT/TOL | 94.86 | |
| PRK12377 | 248 | putative replication protein; Provisional | 94.84 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 94.82 | |
| TIGR00665 | 434 | DnaB replicative DNA helicase. This model describe | 94.77 | |
| TIGR00596 | 814 | rad1 DNA repair protein (rad1). This family is bas | 94.75 | |
| PRK06731 | 270 | flhF flagellar biosynthesis regulator FlhF; Valida | 94.71 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 94.65 | |
| COG1074 | 1139 | RecB ATP-dependent exoDNAse (exonuclease V) beta s | 94.62 | |
| PRK11192 | 434 | ATP-dependent RNA helicase SrmB; Provisional | 94.59 | |
| KOG0058|consensus | 716 | 94.58 | ||
| PRK10590 | 456 | ATP-dependent RNA helicase RhlE; Provisional | 94.56 | |
| PF01580 | 205 | FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR00 | 94.53 | |
| TIGR02784 | 1141 | addA_alphas double-strand break repair helicase Ad | 94.52 | |
| COG1132 | 567 | MdlB ABC-type multidrug transport system, ATPase a | 94.51 | |
| PRK09112 | 351 | DNA polymerase III subunit delta'; Validated | 94.51 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 94.5 | |
| KOG2228|consensus | 408 | 94.46 | ||
| PRK08006 | 471 | replicative DNA helicase; Provisional | 94.46 | |
| PRK06904 | 472 | replicative DNA helicase; Validated | 94.45 | |
| PF03969 | 362 | AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 | 94.45 | |
| PRK10263 | 1355 | DNA translocase FtsK; Provisional | 94.43 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 94.4 | |
| PRK13897 | 606 | type IV secretion system component VirD4; Provisio | 94.4 | |
| PRK08506 | 472 | replicative DNA helicase; Provisional | 94.39 | |
| PF14516 | 331 | AAA_35: AAA-like domain | 94.38 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 94.37 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 94.33 | |
| PF01935 | 229 | DUF87: Domain of unknown function DUF87; InterPro: | 94.32 | |
| PF01637 | 234 | Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 | 94.26 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 94.26 | |
| TIGR03754 | 643 | conj_TOL_TraD conjugative coupling factor TraD, TO | 94.26 | |
| PRK04837 | 423 | ATP-dependent RNA helicase RhlB; Provisional | 94.24 | |
| COG1219 | 408 | ClpX ATP-dependent protease Clp, ATPase subunit [P | 94.23 | |
| PRK07004 | 460 | replicative DNA helicase; Provisional | 94.23 | |
| KOG1807|consensus | 1025 | 94.22 | ||
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 94.21 | |
| PRK14971 | 614 | DNA polymerase III subunits gamma and tau; Provisi | 94.19 | |
| PRK06305 | 451 | DNA polymerase III subunits gamma and tau; Validat | 94.17 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 94.14 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 94.13 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 94.1 | |
| PF12775 | 272 | AAA_7: P-loop containing dynein motor region D3; P | 94.05 | |
| PF02283 | 167 | CobU: Cobinamide kinase / cobinamide phosphate gua | 94.0 | |
| TIGR02868 | 529 | CydC thiol reductant ABC exporter, CydC subunit. T | 93.99 | |
| PRK06871 | 325 | DNA polymerase III subunit delta'; Validated | 93.97 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 93.93 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 93.9 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.89 | |
| PRK13695 | 174 | putative NTPase; Provisional | 93.88 | |
| COG2812 | 515 | DnaX DNA polymerase III, gamma/tau subunits [DNA r | 93.87 | |
| PRK06090 | 319 | DNA polymerase III subunit delta'; Validated | 93.87 | |
| PRK08058 | 329 | DNA polymerase III subunit delta'; Validated | 93.87 | |
| CHL00176 | 638 | ftsH cell division protein; Validated | 93.85 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 93.85 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 93.74 | |
| PF05894 | 333 | Podovirus_Gp16: Podovirus DNA encapsidation protei | 93.73 | |
| COG1222 | 406 | RPT1 ATP-dependent 26S proteasome regulatory subun | 93.71 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 93.7 | |
| PRK08840 | 464 | replicative DNA helicase; Provisional | 93.68 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 93.63 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 93.61 | |
| PTZ00110 | 545 | helicase; Provisional | 93.59 | |
| PRK05595 | 444 | replicative DNA helicase; Provisional | 93.56 | |
| COG3598 | 402 | RepA RecA-family ATPase [DNA replication, recombin | 93.56 | |
| PF00158 | 168 | Sigma54_activat: Sigma-54 interaction domain; Inte | 93.54 | |
| COG1200 | 677 | RecG RecG-like helicase [DNA replication, recombin | 93.54 | |
| PRK11776 | 460 | ATP-dependent RNA helicase DbpA; Provisional | 93.51 | |
| PRK09165 | 497 | replicative DNA helicase; Provisional | 93.5 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 93.5 | |
| KOG1806|consensus | 1320 | 93.47 | ||
| TIGR00609 | 1087 | recB exodeoxyribonuclease V, beta subunit. All pro | 93.43 | |
| KOG0344|consensus | 593 | 93.4 | ||
| PRK13850 | 670 | type IV secretion system protein VirD4; Provisiona | 93.29 | |
| PRK12608 | 380 | transcription termination factor Rho; Provisional | 93.28 | |
| PF07728 | 139 | AAA_5: AAA domain (dynein-related subfamily); Inte | 93.25 | |
| PHA00149 | 331 | DNA encapsidation protein | 93.04 | |
| PRK08760 | 476 | replicative DNA helicase; Provisional | 93.02 | |
| TIGR00643 | 630 | recG ATP-dependent DNA helicase RecG. | 93.0 | |
| PRK13822 | 641 | conjugal transfer coupling protein TraG; Provision | 92.99 | |
| KOG0328|consensus | 400 | 92.98 | ||
| TIGR00602 | 637 | rad24 checkpoint protein rad24. This family is bas | 92.93 | |
| PRK11634 | 629 | ATP-dependent RNA helicase DeaD; Provisional | 92.92 | |
| TIGR00614 | 470 | recQ_fam ATP-dependent DNA helicase, RecQ family. | 92.88 | |
| PRK01297 | 475 | ATP-dependent RNA helicase RhlB; Provisional | 92.87 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 92.86 | |
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 92.86 | |
| ) proteins. It has been suggested that torsins play a role in effectively managing protein folding and that possible breakdown in a neuroprotective mechanism that is, in part, mediated by torsins may be responsible for the neuronal dysfunction associated with dystonia [].; GO: 0005524 ATP binding, 0051085 chaperone mediated protein folding requiring cofactor" target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=PF06309">PF06309 | 127 | Torsin: Torsin; InterPro: IPR010448 This family co | 92.85 | |
| PHA03372 | 668 | DNA packaging terminase subunit 1; Provisional | 92.76 | |
| COG0466 | 782 | Lon ATP-dependent Lon protease, bacterial type [Po | 92.76 | |
| PLN03186 | 342 | DNA repair protein RAD51 homolog; Provisional | 92.75 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 92.7 | |
| COG2109 | 198 | BtuR ATP:corrinoid adenosyltransferase [Coenzyme m | 92.7 | |
| TIGR00631 | 655 | uvrb excinuclease ABC, B subunit. This family is b | 92.68 | |
| TIGR02759 | 566 | TraD_Ftype type IV conjugative transfer system cou | 92.67 | |
| KOG0744|consensus | 423 | 92.65 | ||
| PRK05636 | 505 | replicative DNA helicase; Provisional | 92.65 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 92.64 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 92.39 |
| >KOG0330|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.7e-33 Score=213.61 Aligned_cols=173 Identities=54% Similarity=0.820 Sum_probs=163.1
Q ss_pred CccCCccCCCCCHHHHHHHHHCCCCCChHHHHhhhhhhhCCCcEEEECCCCChHHHHHHHHHHHhhccCCCCeeEEEEcC
Q psy4275 3 DPIKSFTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDEDCIGCAKTGSGKTLAFALPILQKWCEDPYGIFALVLTP 82 (182)
Q Consensus 3 ~~~~~~~~~~l~~~i~~~l~~~~~~~~~~~Q~~~~~~~~~~~~~li~~~tg~GKT~~~~~~~~~~~~~~~~~~~~lil~p 82 (182)
+...+|.+|++.+++.+++...++..|+++|.+++|.++.|++++..+.||||||.+|++|+++.+++++..++++|++|
T Consensus 58 e~~~sf~dLgv~~~L~~ac~~l~~~~PT~IQ~~aiP~~L~g~dvIglAeTGSGKT~afaLPIl~~LL~~p~~~~~lVLtP 137 (476)
T KOG0330|consen 58 ESFKSFADLGVHPELLEACQELGWKKPTKIQSEAIPVALGGRDVIGLAETGSGKTGAFALPILQRLLQEPKLFFALVLTP 137 (476)
T ss_pred hhhcchhhcCcCHHHHHHHHHhCcCCCchhhhhhcchhhCCCcEEEEeccCCCchhhhHHHHHHHHHcCCCCceEEEecC
Confidence 34578999999999999999999999999999999999999999999999999999999999999999988899999999
Q ss_pred CHHHHHHHHHHHHHhhccCCceEEEEEcCCchhhhhHHhcCCCcEEEEChHHHHHHHhcCCCCCCCCccEEEEecccccc
Q psy4275 83 TRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKELAKKPHIVIATPGRLADHLDTCNTFSLNRIKFLVLDEADRLS 162 (182)
Q Consensus 83 ~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ilv~T~~~l~~~~~~~~~~~~~~~~~iI~DE~h~~~ 162 (182)
+++|+.|+++.++.++...|++++.+.|+.....+...+..+++|+|+||+.+.+++...+.++++.++++|+||||.++
T Consensus 138 tRELA~QI~e~fe~Lg~~iglr~~~lvGG~~m~~q~~~L~kkPhilVaTPGrL~dhl~~Tkgf~le~lk~LVlDEADrlL 217 (476)
T KOG0330|consen 138 TRELAQQIAEQFEALGSGIGLRVAVLVGGMDMMLQANQLSKKPHILVATPGRLWDHLENTKGFSLEQLKFLVLDEADRLL 217 (476)
T ss_pred cHHHHHHHHHHHHHhccccCeEEEEEecCchHHHHHHHhhcCCCEEEeCcHHHHHHHHhccCccHHHhHHHhhchHHhhh
Confidence 99999999999999999999999999999999888888899999999999999999998799999999999999999999
Q ss_pred ccCChhHHHHHHH
Q psy4275 163 LMTSLKFFFFFFF 175 (182)
Q Consensus 163 ~~~~~~~~~~~~~ 175 (182)
++.+-..++.+.+
T Consensus 218 d~dF~~~ld~ILk 230 (476)
T KOG0330|consen 218 DMDFEEELDYILK 230 (476)
T ss_pred hhhhHHHHHHHHH
Confidence 9988766555443
|
|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PLN00206 DEAD-box ATP-dependent RNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >KOG0338|consensus | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >KOG0340|consensus | Back alignment and domain information |
|---|
| >KOG0348|consensus | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >PRK02362 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0345|consensus | Back alignment and domain information |
|---|
| >KOG0339|consensus | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >KOG0343|consensus | Back alignment and domain information |
|---|
| >KOG0342|consensus | Back alignment and domain information |
|---|
| >KOG0346|consensus | Back alignment and domain information |
|---|
| >TIGR03817 DECH_helic helicase/secretion neighborhood putative DEAH-box helicase | Back alignment and domain information |
|---|
| >KOG0335|consensus | Back alignment and domain information |
|---|
| >PRK00254 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >KOG0347|consensus | Back alignment and domain information |
|---|
| >PRK01172 ski2-like helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0350|consensus | Back alignment and domain information |
|---|
| >KOG0326|consensus | Back alignment and domain information |
|---|
| >KOG0334|consensus | Back alignment and domain information |
|---|
| >COG1201 Lhr Lhr-like helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13767 ATP-dependent helicase; Provisional | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >COG1205 Distinct helicase family with a unique C-terminal domain including a metal-binding cysteine cluster [General function prediction only] | Back alignment and domain information |
|---|
| >COG1204 Superfamily II helicase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0336|consensus | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >KOG0329|consensus | Back alignment and domain information |
|---|
| >KOG0327|consensus | Back alignment and domain information |
|---|
| >KOG0332|consensus | Back alignment and domain information |
|---|
| >PLN03137 ATP-dependent DNA helicase; Q4-like; Provisional | Back alignment and domain information |
|---|
| >KOG4284|consensus | Back alignment and domain information |
|---|
| >KOG0337|consensus | Back alignment and domain information |
|---|
| >TIGR01389 recQ ATP-dependent DNA helicase RecQ | Back alignment and domain information |
|---|
| >PRK11057 ATP-dependent DNA helicase RecQ; Provisional | Back alignment and domain information |
|---|
| >PRK09401 reverse gyrase; Reviewed | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >PRK12899 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >COG1202 Superfamily II helicase, archaea-specific [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14701 reverse gyrase; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR02621 cas3_GSU0051 CRISPR-associated helicase Cas3, Anaes-subtype | Back alignment and domain information |
|---|
| >TIGR01054 rgy reverse gyrase | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK09751 putative ATP-dependent helicase Lhr; Provisional | Back alignment and domain information |
|---|
| >PRK13766 Hef nuclease; Provisional | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >COG1111 MPH1 ERCC4-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >TIGR03714 secA2 accessory Sec system translocase SecA2 | Back alignment and domain information |
|---|
| >KOG0354|consensus | Back alignment and domain information |
|---|
| >TIGR03158 cas3_cyano CRISPR-associated helicase, Cyano-type | Back alignment and domain information |
|---|
| >TIGR00963 secA preprotein translocase, SecA subunit | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK09200 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG1061 SSL2 DNA or RNA helicases of superfamily II [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12898 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00603 rad25 DNA repair helicase rad25 | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PRK13104 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >COG0514 RecQ Superfamily II DNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >COG4581 Superfamily II RNA helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >TIGR01407 dinG_rel DnaQ family exonuclease/DinG family helicase, putative | Back alignment and domain information |
|---|
| >TIGR01587 cas3_core CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >PRK12904 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11448 hsdR type I restriction enzyme EcoKI subunit R; Provisional | Back alignment and domain information |
|---|
| >KOG0353|consensus | Back alignment and domain information |
|---|
| >KOG0352|consensus | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >COG1110 Reverse gyrase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK13107 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK07246 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >KOG0949|consensus | Back alignment and domain information |
|---|
| >PRK09694 helicase Cas3; Provisional | Back alignment and domain information |
|---|
| >KOG0947|consensus | Back alignment and domain information |
|---|
| >TIGR03117 cas_csf4 CRISPR-associated DEAD/DEAH-box helicase Csf4 | Back alignment and domain information |
|---|
| >KOG0351|consensus | Back alignment and domain information |
|---|
| >PRK08074 bifunctional ATP-dependent DNA helicase/DNA polymerase III subunit epsilon; Validated | Back alignment and domain information |
|---|
| >TIGR00348 hsdR type I site-specific deoxyribonuclease, HsdR family | Back alignment and domain information |
|---|
| >COG4096 HsdR Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG0349|consensus | Back alignment and domain information |
|---|
| >PF00176 SNF2_N: SNF2 family N-terminal domain; InterPro: IPR000330 This domain is found in proteins involved in a variety of processes including transcription regulation (e | Back alignment and domain information |
|---|
| >PRK13103 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >smart00488 DEXDc2 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >smart00489 DEXDc3 DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >KOG0948|consensus | Back alignment and domain information |
|---|
| >PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional | Back alignment and domain information |
|---|
| >PF07517 SecA_DEAD: SecA DEAD-like domain; InterPro: IPR011115 SecA protein binds to the plasma membrane where it interacts with proOmpA to support translocation of proOmpA through the membrane | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK12906 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0951|consensus | Back alignment and domain information |
|---|
| >KOG0385|consensus | Back alignment and domain information |
|---|
| >PRK12326 preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PRK11747 dinG ATP-dependent DNA helicase DinG; Provisional | Back alignment and domain information |
|---|
| >KOG0950|consensus | Back alignment and domain information |
|---|
| >PRK04914 ATP-dependent helicase HepA; Validated | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >KOG0389|consensus | Back alignment and domain information |
|---|
| >KOG0391|consensus | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PRK12902 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00604 rad3 DNA repair helicase (rad3) | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0387|consensus | Back alignment and domain information |
|---|
| >CHL00122 secA preprotein translocase subunit SecA; Validated | Back alignment and domain information |
|---|
| >KOG1123|consensus | Back alignment and domain information |
|---|
| >COG1199 DinG Rad3-related DNA helicases [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0920|consensus | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG0952|consensus | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >KOG1802|consensus | Back alignment and domain information |
|---|
| >KOG0390|consensus | Back alignment and domain information |
|---|
| >PRK12903 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG4439|consensus | Back alignment and domain information |
|---|
| >COG1203 CRISPR-associated helicase Cas3 [Defense mechanisms] | Back alignment and domain information |
|---|
| >COG4889 Predicted helicase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14873 primosome assembly protein PriA; Provisional | Back alignment and domain information |
|---|
| >KOG0384|consensus | Back alignment and domain information |
|---|
| >KOG0388|consensus | Back alignment and domain information |
|---|
| >KOG1000|consensus | Back alignment and domain information |
|---|
| >COG0610 Type I site-specific restriction-modification system, R (restriction) subunit and related helicases [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1002|consensus | Back alignment and domain information |
|---|
| >PRK15483 type III restriction-modification system StyLTI enzyme res; Provisional | Back alignment and domain information |
|---|
| >KOG0392|consensus | Back alignment and domain information |
|---|
| >KOG0925|consensus | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PRK12900 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >KOG0923|consensus | Back alignment and domain information |
|---|
| >KOG0386|consensus | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >PRK12901 secA preprotein translocase subunit SecA; Reviewed | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >KOG1803|consensus | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0553 HepA Superfamily II DNA/RNA helicases, SNF2 family [Transcription / DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >KOG1805|consensus | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >PF12340 DUF3638: Protein of unknown function (DUF3638); InterPro: IPR022099 This domain family is found in eukaryotes, and is approximately 230 amino acids in length | Back alignment and domain information |
|---|
| >PF13872 AAA_34: P-loop containing NTP hydrolase pore-1 | Back alignment and domain information |
|---|
| >COG3587 Restriction endonuclease [Defense mechanisms] | Back alignment and domain information |
|---|
| >KOG1132|consensus | Back alignment and domain information |
|---|
| >KOG1131|consensus | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >COG0653 SecA Preprotein translocase subunit SecA (ATPase, RNA helicase) [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >KOG0989|consensus | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >KOG1001|consensus | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >TIGR02562 cas3_yersinia CRISPR-associated helicase Cas3 | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK11054 helD DNA helicase IV; Provisional | Back alignment and domain information |
|---|
| >COG1875 NYN ribonuclease and ATPase of PhoH family domains [General function prediction only] | Back alignment and domain information |
|---|
| >COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10919 ATP-dependent DNA helicase Rep; Provisional | Back alignment and domain information |
|---|
| >COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PHA02533 17 large terminase protein; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >TIGR01075 uvrD DNA helicase II | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >KOG1015|consensus | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF05621 TniB: Bacterial TniB protein; InterPro: IPR008868 This family consists of several bacterial TniB NTP-binding proteins | Back alignment and domain information |
|---|
| >PRK11773 uvrD DNA-dependent helicase II; Provisional | Back alignment and domain information |
|---|
| >TIGR01074 rep ATP-dependent DNA helicase Rep | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11331 5-methylcytosine-specific restriction enzyme subunit McrB; Provisional | Back alignment and domain information |
|---|
| >TIGR01073 pcrA ATP-dependent DNA helicase PcrA | Back alignment and domain information |
|---|
| >PF14617 CMS1: U3-containing 90S pre-ribosomal complex subunit | Back alignment and domain information |
|---|
| >KOG0298|consensus | Back alignment and domain information |
|---|
| >KOG0991|consensus | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PHA03333 putative ATPase subunit of terminase; Provisional | Back alignment and domain information |
|---|
| >TIGR02785 addA_Gpos recombination helicase AddA, Firmicutes type | Back alignment and domain information |
|---|
| >TIGR01547 phage_term_2 phage terminase, large subunit, PBSX family | Back alignment and domain information |
|---|
| >PF05127 Helicase_RecD: Helicase; InterPro: IPR007807 This domain is about 350 amino acid residues long and appears to have a P-loop motif, suggesting this is an ATPase | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PF03354 Terminase_1: Phage Terminase ; InterPro: IPR005021 This entry is represented by Lactococcus phage bIL285, Orf41 (terminase) | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >COG3973 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK05298 excinuclease ABC subunit B; Provisional | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >KOG4150|consensus | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >KOG0333|consensus | Back alignment and domain information |
|---|
| >PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PRK05707 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF05876 Terminase_GpA: Phage terminase large subunit (GpA); InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK14960 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >KOG2340|consensus | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >COG1444 Predicted P-loop ATPase fused to an acetyltransferase [General function prediction only] | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14958 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >KOG0921|consensus | Back alignment and domain information |
|---|
| >COG3421 Uncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >COG4962 CpaF Flp pilus assembly protein, ATPase CpaF [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK07764 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK06645 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PRK07003 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05563 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >PRK12323 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PRK08691 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PF03237 Terminase_6: Terminase-like family; InterPro: IPR004921 The terminase is a component of the molecular motor that translocates genomic DNA into empty capsids during DNA packaging [] | Back alignment and domain information |
|---|
| >PHA03368 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >PRK14951 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PTZ00112 origin recognition complex 1 protein; Provisional | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG4626 Phage terminase-like protein, large subunit [General function prediction only] | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG1016|consensus | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK14952 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG1197 Mfd Transcription-repair coupling factor (superfamily II helicase) [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14963 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK07994 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PF13177 DNA_pol3_delta2: DNA polymerase III, delta subunit; PDB: 1NJF_B 3GLG_G 1XXH_I 1NJG_A 3GLF_B 3GLI_G 1IQP_E 2GNO_A 1SXJ_E 1A5T_A | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >PRK14965 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08451 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >KOG0331|consensus | Back alignment and domain information |
|---|
| >COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14957 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF02456 Adeno_IVa2: Adenovirus IVa2 protein; InterPro: IPR003389 Va2 protein can interact with the adenoviral packaging signal and this interaction involves DNA sequences that have previously been demonstrated to be required for packaging [] | Back alignment and domain information |
|---|
| >PRK14959 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00678 holB DNA polymerase III, delta' subunit | Back alignment and domain information |
|---|
| >PRK14955 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >KOG1133|consensus | Back alignment and domain information |
|---|
| >PRK06647 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK08769 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK09111 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK10689 transcription-repair coupling factor; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00580 mfd transcription-repair coupling factor (mfd) | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PRK14969 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF06733 DEAD_2: DEAD_2; InterPro: IPR010614 This represents a conserved region within a number of RAD3-like DNA-binding helicases that are seemingly ubiquitous - members include proteins of eukaryotic, bacterial and archaeal origin | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >PRK05896 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >PRK14954 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK14950 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >PTZ00293 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >COG5008 PilU Tfp pilus assembly protein, ATPase PilU [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >KOG2373|consensus | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >PRK06964 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR02688 conserved hypothetical protein TIGR02688 | Back alignment and domain information |
|---|
| >PRK07993 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG1702 PhoH Phosphate starvation-inducible protein PhoH, predicted ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR02397 dnaX_nterm DNA polymerase III, subunit gamma and tau | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR03600 phage_DnaB phage replicative helicase, DnaB family, HK022 subfamily | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >PRK14948 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK07471 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >KOG0341|consensus | Back alignment and domain information |
|---|
| >TIGR00763 lon ATP-dependent protease La | Back alignment and domain information |
|---|
| >KOG0739|consensus | Back alignment and domain information |
|---|
| >PHA00012 I assembly protein | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PRK13700 conjugal transfer protein TraD; Provisional | Back alignment and domain information |
|---|
| >PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 | Back alignment and domain information |
|---|
| >PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed | Back alignment and domain information |
|---|
| >PRK14953 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >COG0513 SrmB Superfamily II DNA and RNA helicases [DNA replication, recombination, and repair / Transcription / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK04537 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PF06862 DUF1253: Protein of unknown function (DUF1253); InterPro: IPR010678 This family is defined by a C-terminal region of approximately 500 residues, Digestive organ expansion factor (DEF) is thought to Regulate the p53 pathway to control the expansion growth of digestive organs and is required for the expansion growth of intestine, liver and exocrine pancreas, but not endocrine pancreas [, ] | Back alignment and domain information |
|---|
| >COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01126 TraG_VirD4 The TraG/TraD/VirD4 family are bacterial conjugation proteins involved in type IV secretion | Back alignment and domain information |
|---|
| >PRK05748 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK08699 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >cd01123 Rad51_DMC1_radA Rad51_DMC1_radA,B | Back alignment and domain information |
|---|
| >PRK09376 rho transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase | Back alignment and domain information |
|---|
| >COG0468 RecA RecA/RadA recombinase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF08423 Rad51: Rad51; InterPro: IPR013632 This domain is found at the C terminus of the DNA repair and recombination protein Rad51 | Back alignment and domain information |
|---|
| >PF02534 T4SS-DNA_transf: Type IV secretory system Conjugative DNA transfer; InterPro: IPR003688 This entry represents TraG proteins and their homologues | Back alignment and domain information |
|---|
| >TIGR03743 SXT_TraD conjugative coupling factor TraD, SXT/TOL subfamily | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >TIGR00665 DnaB replicative DNA helicase | Back alignment and domain information |
|---|
| >TIGR00596 rad1 DNA repair protein (rad1) | Back alignment and domain information |
|---|
| >PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK11192 ATP-dependent RNA helicase SrmB; Provisional | Back alignment and domain information |
|---|
| >KOG0058|consensus | Back alignment and domain information |
|---|
| >PRK10590 ATP-dependent RNA helicase RhlE; Provisional | Back alignment and domain information |
|---|
| >PF01580 FtsK_SpoIIIE: FtsK/SpoIIIE family; InterPro: IPR002543 The FtsK/SpoIIIE domain is found extensively in a wide variety of proteins from prokaryotes and plasmids [] some of which contain up to three copies | Back alignment and domain information |
|---|
| >TIGR02784 addA_alphas double-strand break repair helicase AddA, alphaproteobacterial type | Back alignment and domain information |
|---|
| >COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] | Back alignment and domain information |
|---|
| >PRK09112 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >KOG2228|consensus | Back alignment and domain information |
|---|
| >PRK08006 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK06904 replicative DNA helicase; Validated | Back alignment and domain information |
|---|
| >PF03969 AFG1_ATPase: AFG1-like ATPase; InterPro: IPR005654 ATPase family gene 1 (AFG1) ATPase is a 377 amino acid putative protein with an ATPase motif typical of the protein family including SEC18p PAS1, CDC48-VCP and TBP | Back alignment and domain information |
|---|
| >PRK10263 DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >PRK13897 type IV secretion system component VirD4; Provisional | Back alignment and domain information |
|---|
| >PRK08506 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF14516 AAA_35: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PF01935 DUF87: Domain of unknown function DUF87; InterPro: IPR002789 The function of this domain is unknown | Back alignment and domain information |
|---|
| >PF01637 Arch_ATPase: Archaeal ATPase; InterPro: IPR011579 This domain has been found in a number of bacterial and archaeal proteins, all of which contain a conserved P-loop motif that is involved in binding ATP | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >TIGR03754 conj_TOL_TraD conjugative coupling factor TraD, TOL family | Back alignment and domain information |
|---|
| >PRK04837 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >COG1219 ClpX ATP-dependent protease Clp, ATPase subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK07004 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >KOG1807|consensus | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >PRK14971 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06305 DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >PF12775 AAA_7: P-loop containing dynein motor region D3; PDB: 4AKI_A 4AI6_B 4AKH_A 4AKG_A 3QMZ_A 3VKH_A 3VKG_A | Back alignment and domain information |
|---|
| >PF02283 CobU: Cobinamide kinase / cobinamide phosphate guanyltransferase; InterPro: IPR003203 This family is composed of a group of bifunctional cobalbumin biosynthesis enzymes which display cobinamide kinase and cobinamide phosphate guanyltransferase activity | Back alignment and domain information |
|---|
| >TIGR02868 CydC thiol reductant ABC exporter, CydC subunit | Back alignment and domain information |
|---|
| >PRK06871 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK06090 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >PRK08058 DNA polymerase III subunit delta'; Validated | Back alignment and domain information |
|---|
| >CHL00176 ftsH cell division protein; Validated | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PF05894 Podovirus_Gp16: Podovirus DNA encapsidation protein (Gp16); InterPro: IPR008784 This family consists of several DNA encapsidation protein (Gp16) sequences from the phi-29-like viruses | Back alignment and domain information |
|---|
| >COG1222 RPT1 ATP-dependent 26S proteasome regulatory subunit [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK08840 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >PTZ00110 helicase; Provisional | Back alignment and domain information |
|---|
| >PRK05595 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF00158 Sigma54_activat: Sigma-54 interaction domain; InterPro: IPR002078 Some bacterial regulatory proteins activate the expression of genes from promoters recognised by core RNA polymerase associated with the alternative sigma-54 factor | Back alignment and domain information |
|---|
| >COG1200 RecG RecG-like helicase [DNA replication, recombination, and repair / Transcription] | Back alignment and domain information |
|---|
| >PRK11776 ATP-dependent RNA helicase DbpA; Provisional | Back alignment and domain information |
|---|
| >PRK09165 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >KOG1806|consensus | Back alignment and domain information |
|---|
| >TIGR00609 recB exodeoxyribonuclease V, beta subunit | Back alignment and domain information |
|---|
| >KOG0344|consensus | Back alignment and domain information |
|---|
| >PRK13850 type IV secretion system protein VirD4; Provisional | Back alignment and domain information |
|---|
| >PRK12608 transcription termination factor Rho; Provisional | Back alignment and domain information |
|---|
| >PF07728 AAA_5: AAA domain (dynein-related subfamily); InterPro: IPR011704 The ATPases Associated to a variety of cellular Activities (AAA) are a family distinguished by a highly conserved module of 230 amino acids [] | Back alignment and domain information |
|---|
| >PHA00149 DNA encapsidation protein | Back alignment and domain information |
|---|
| >PRK08760 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >TIGR00643 recG ATP-dependent DNA helicase RecG | Back alignment and domain information |
|---|
| >PRK13822 conjugal transfer coupling protein TraG; Provisional | Back alignment and domain information |
|---|
| >KOG0328|consensus | Back alignment and domain information |
|---|
| >TIGR00602 rad24 checkpoint protein rad24 | Back alignment and domain information |
|---|
| >PRK11634 ATP-dependent RNA helicase DeaD; Provisional | Back alignment and domain information |
|---|
| >TIGR00614 recQ_fam ATP-dependent DNA helicase, RecQ family | Back alignment and domain information |
|---|
| >PRK01297 ATP-dependent RNA helicase RhlB; Provisional | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >PF06309 Torsin: Torsin; InterPro: IPR010448 This family consists of several eukaryotic torsin proteins | Back alignment and domain information |
|---|
| >PHA03372 DNA packaging terminase subunit 1; Provisional | Back alignment and domain information |
|---|
| >COG0466 Lon ATP-dependent Lon protease, bacterial type [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PLN03186 DNA repair protein RAD51 homolog; Provisional | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >TIGR00631 uvrb excinuclease ABC, B subunit | Back alignment and domain information |
|---|
| >TIGR02759 TraD_Ftype type IV conjugative transfer system coupling protein TraD | Back alignment and domain information |
|---|
| >KOG0744|consensus | Back alignment and domain information |
|---|
| >PRK05636 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 182 | ||||
| 3ber_A | 249 | Human Dead-Box Rna-Helicase Ddx47, Conserved Domain | 8e-43 | ||
| 1hv8_A | 367 | Crystal Structure Of A Dead Box Protein From The Hy | 2e-27 | ||
| 2db3_A | 434 | Structural Basis For Rna Unwinding By The Dead-Box | 3e-27 | ||
| 1wrb_A | 253 | Crystal Structure Of The N-Terminal Reca-Like Domai | 6e-25 | ||
| 2pl3_A | 236 | Human Dead-Box Rna Helicase Ddx10, Dead Domain In C | 7e-25 | ||
| 2gxq_A | 207 | Hera N-Terminal Domain In Complex With Amp, Crystal | 2e-24 | ||
| 3mwj_A | 207 | Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Ap | 4e-24 | ||
| 2i4i_A | 417 | Crystal Structure Of Human Dead-Box Rna Helicase Dd | 3e-23 | ||
| 3bor_A | 237 | Crystal Structure Of The Deadc Domain Of Human Tran | 3e-21 | ||
| 3eiq_A | 414 | Crystal Structure Of Pdcd4-eif4a Length = 414 | 4e-21 | ||
| 2zu6_A | 388 | Crystal Structure Of The Eif4a-Pdcd4 Complex Length | 6e-21 | ||
| 1q0u_A | 219 | Crystal Structure Of The Bstdead N-Terminal Domain | 1e-20 | ||
| 1xtk_A | 390 | Structure Of Decd To Dead Mutation Of Human Uap56 L | 1e-20 | ||
| 1t6n_A | 220 | Crystal Structure Of The N-Terminal Domain Of Human | 3e-20 | ||
| 1xti_A | 391 | Structure Of Wildtype Human Uap56 Length = 391 | 5e-20 | ||
| 1xtj_A | 386 | Structure Of Human Uap56 In Complex With Adp Length | 6e-20 | ||
| 3ly5_A | 262 | Ddx18 Dead-Domain Length = 262 | 9e-20 | ||
| 2g9n_A | 221 | Structure Of The Dead Domain Of Human Eukaryotic In | 1e-19 | ||
| 2z0m_A | 337 | Crystal Structure Of Hypothetical Atp-Dependent Rna | 2e-19 | ||
| 3fe2_A | 242 | Human Dead-Box Rna Helicase Ddx5 (P68), Conserved D | 3e-19 | ||
| 2j0q_A | 410 | The Crystal Structure Of The Exon Junction Complex | 3e-19 | ||
| 4a4d_A | 253 | Crystal Structure Of The N-Terminal Domain Of The H | 3e-19 | ||
| 2xb2_A | 411 | Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar | 3e-19 | ||
| 2hyi_C | 413 | Structure Of The Human Exon Junction Complex With A | 4e-19 | ||
| 2hxy_A | 391 | Crystal Structure Of Human Apo-Eif4aiii Length = 39 | 4e-19 | ||
| 1qva_A | 223 | Yeast Initiation Factor 4a N-Terminal Domain Length | 4e-19 | ||
| 1qde_A | 224 | Crystal Structure Of The Atpase Domain Of Translati | 7e-19 | ||
| 2vso_A | 395 | Crystal Structure Of A Translation Initiation Compl | 7e-19 | ||
| 2j0u_A | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 8e-19 | ||
| 2j0u_B | 374 | The Crystal Structure Of Eif4aiii-Barentsz Complex | 8e-19 | ||
| 1s2m_A | 400 | Crystal Structure Of The Dead Box Protein Dhh1p Len | 1e-18 | ||
| 1vec_A | 206 | Crystal Structure Of The N-Terminal Domain Of RckP5 | 1e-17 | ||
| 3dkp_A | 245 | Human Dead-Box Rna-Helicase Ddx52, Conserved Domain | 1e-17 | ||
| 1fuu_A | 394 | Yeast Initiation Factor 4a Length = 394 | 6e-17 | ||
| 3iuy_A | 228 | Crystal Structure Of Ddx53 Dead-Box Domain Length = | 7e-16 | ||
| 3sqw_A | 579 | Structure Of Mss116p (Nte Deletion) Bound To Ssrna | 9e-16 | ||
| 3sqx_A | 512 | Structure Of Mss116p (Nte And C-Tail Double Deletio | 9e-16 | ||
| 3i5x_A | 563 | Structure Of Mss116p Bound To Ssrna And Amp-Pnp Len | 1e-15 | ||
| 3fhc_B | 235 | Crystal Structure Of Human Dbp5 In Complex With Nup | 6e-15 | ||
| 3fmo_B | 300 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 7e-15 | ||
| 3ews_A | 445 | Human Dead-Box Rna-Helicase Ddx19 In Complex With A | 1e-14 | ||
| 3g0h_A | 424 | Human Dead-box Rna Helicase Ddx19, In Complex With | 1e-14 | ||
| 3fht_A | 412 | Crystal Structure Of Human Dbp5 In Complex With Amp | 1e-14 | ||
| 3fmp_B | 479 | Crystal Structure Of The Nucleoporin Nup214 In Comp | 1e-14 | ||
| 2kbe_A | 226 | Solution Structure Of Amino-Terminal Domain Of Dbp5 | 1e-13 | ||
| 3pey_A | 395 | S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length | 2e-13 | ||
| 3pew_A | 395 | S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 | 2e-13 | ||
| 2oxc_A | 230 | Human Dead-Box Rna Helicase Ddx20, Dead Domain In C | 2e-12 | ||
| 3fho_B | 508 | Structure Of S. Pombe Dbp5 Length = 508 | 1e-10 | ||
| 1wp9_A | 494 | Crystal Structure Of Pyrococcus Furiosus Hef Helica | 4e-04 |
| >pdb|3BER|A Chain A, Human Dead-Box Rna-Helicase Ddx47, Conserved Domain I In Complex With Amp Length = 249 | Back alignment and structure |
|
| >pdb|1HV8|A Chain A, Crystal Structure Of A Dead Box Protein From The Hyperthermophile Methanococcus Jannaschii Length = 367 | Back alignment and structure |
| >pdb|2DB3|A Chain A, Structural Basis For Rna Unwinding By The Dead-Box Protein Drosophila Vasa Length = 434 | Back alignment and structure |
| >pdb|1WRB|A Chain A, Crystal Structure Of The N-Terminal Reca-Like Domain Of Djvlgb, A Pranarian Vasa-Like Rna Helicase Length = 253 | Back alignment and structure |
| >pdb|2PL3|A Chain A, Human Dead-Box Rna Helicase Ddx10, Dead Domain In Complex With Adp Length = 236 | Back alignment and structure |
| >pdb|2GXQ|A Chain A, Hera N-Terminal Domain In Complex With Amp, Crystal Form 1 Length = 207 | Back alignment and structure |
| >pdb|3MWJ|A Chain A, Q28e Mutant Of Hera N-Terminal Reca-Like Domain, Apo Form Length = 207 | Back alignment and structure |
| >pdb|2I4I|A Chain A, Crystal Structure Of Human Dead-Box Rna Helicase Ddx3x Length = 417 | Back alignment and structure |
| >pdb|3BOR|A Chain A, Crystal Structure Of The Deadc Domain Of Human Translation Initiation Factor 4a-2 Length = 237 | Back alignment and structure |
| >pdb|3EIQ|A Chain A, Crystal Structure Of Pdcd4-eif4a Length = 414 | Back alignment and structure |
| >pdb|2ZU6|A Chain A, Crystal Structure Of The Eif4a-Pdcd4 Complex Length = 388 | Back alignment and structure |
| >pdb|1Q0U|A Chain A, Crystal Structure Of The Bstdead N-Terminal Domain Length = 219 | Back alignment and structure |
| >pdb|1XTK|A Chain A, Structure Of Decd To Dead Mutation Of Human Uap56 Length = 390 | Back alignment and structure |
| >pdb|1T6N|A Chain A, Crystal Structure Of The N-Terminal Domain Of Human Uap56 Length = 220 | Back alignment and structure |
| >pdb|1XTI|A Chain A, Structure Of Wildtype Human Uap56 Length = 391 | Back alignment and structure |
| >pdb|1XTJ|A Chain A, Structure Of Human Uap56 In Complex With Adp Length = 386 | Back alignment and structure |
| >pdb|3LY5|A Chain A, Ddx18 Dead-Domain Length = 262 | Back alignment and structure |
| >pdb|2G9N|A Chain A, Structure Of The Dead Domain Of Human Eukaryotic Initiation Factor 4a, Eif4a Length = 221 | Back alignment and structure |
| >pdb|2Z0M|A Chain A, Crystal Structure Of Hypothetical Atp-Dependent Rna Helicase From Sulfolobus Tokodaii Length = 337 | Back alignment and structure |
| >pdb|3FE2|A Chain A, Human Dead-Box Rna Helicase Ddx5 (P68), Conserved Domain I In Complex With Adp Length = 242 | Back alignment and structure |
| >pdb|2J0Q|A Chain A, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 410 | Back alignment and structure |
| >pdb|4A4D|A Chain A, Crystal Structure Of The N-Terminal Domain Of The Human Dead-Box Rna Helicase Ddx5 (P68) Length = 253 | Back alignment and structure |
| >pdb|2XB2|A Chain A, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 411 | Back alignment and structure |
| >pdb|2HYI|C Chain C, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 413 | Back alignment and structure |
| >pdb|2HXY|A Chain A, Crystal Structure Of Human Apo-Eif4aiii Length = 391 | Back alignment and structure |
| >pdb|1QVA|A Chain A, Yeast Initiation Factor 4a N-Terminal Domain Length = 223 | Back alignment and structure |
| >pdb|1QDE|A Chain A, Crystal Structure Of The Atpase Domain Of Translation Initiation Factor 4a From Saccharomyces Cerevisiae-The Prototype Of The Dead Box Protein Family Length = 224 | Back alignment and structure |
| >pdb|2VSO|A Chain A, Crystal Structure Of A Translation Initiation Complex Length = 395 | Back alignment and structure |
| >pdb|2J0U|A Chain A, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|2J0U|B Chain B, The Crystal Structure Of Eif4aiii-Barentsz Complex At 3.0 A Resolution Length = 374 | Back alignment and structure |
| >pdb|1S2M|A Chain A, Crystal Structure Of The Dead Box Protein Dhh1p Length = 400 | Back alignment and structure |
| >pdb|1VEC|A Chain A, Crystal Structure Of The N-Terminal Domain Of RckP54, A Human Dead-Box Protein Length = 206 | Back alignment and structure |
| >pdb|3DKP|A Chain A, Human Dead-Box Rna-Helicase Ddx52, Conserved Domain I In Complex With Adp Length = 245 | Back alignment and structure |
| >pdb|1FUU|A Chain A, Yeast Initiation Factor 4a Length = 394 | Back alignment and structure |
| >pdb|3IUY|A Chain A, Crystal Structure Of Ddx53 Dead-Box Domain Length = 228 | Back alignment and structure |
| >pdb|3SQW|A Chain A, Structure Of Mss116p (Nte Deletion) Bound To Ssrna And Amp-Pnp Length = 579 | Back alignment and structure |
| >pdb|3SQX|A Chain A, Structure Of Mss116p (Nte And C-Tail Double Deletion) Bound To Ssrna And Amp-Pnp Length = 512 | Back alignment and structure |
| >pdb|3I5X|A Chain A, Structure Of Mss116p Bound To Ssrna And Amp-Pnp Length = 563 | Back alignment and structure |
| >pdb|3FHC|B Chain B, Crystal Structure Of Human Dbp5 In Complex With Nup214 Length = 235 | Back alignment and structure |
| >pdb|3FMO|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 300 | Back alignment and structure |
| >pdb|3EWS|A Chain A, Human Dead-Box Rna-Helicase Ddx19 In Complex With Adp Length = 445 | Back alignment and structure |
| >pdb|3G0H|A Chain A, Human Dead-box Rna Helicase Ddx19, In Complex With An Atp-analogue And Rna Length = 424 | Back alignment and structure |
| >pdb|3FHT|A Chain A, Crystal Structure Of Human Dbp5 In Complex With Amppnp And Rna Length = 412 | Back alignment and structure |
| >pdb|3FMP|B Chain B, Crystal Structure Of The Nucleoporin Nup214 In Complex With The Dead- Box Helicase Ddx19 Length = 479 | Back alignment and structure |
| >pdb|2KBE|A Chain A, Solution Structure Of Amino-Terminal Domain Of Dbp5p Length = 226 | Back alignment and structure |
| >pdb|3PEY|A Chain A, S. Cerevisiae Dbp5 Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|3PEW|A Chain A, S. Cerevisiae Dbp5 L327v Bound To Rna And Adp Bef3 Length = 395 | Back alignment and structure |
| >pdb|2OXC|A Chain A, Human Dead-Box Rna Helicase Ddx20, Dead Domain In Complex With Adp Length = 230 | Back alignment and structure |
| >pdb|1WP9|A Chain A, Crystal Structure Of Pyrococcus Furiosus Hef Helicase Domain Length = 494 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 182 | |||
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 6e-86 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 1e-68 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 1e-67 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 9e-60 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 6e-59 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 9e-59 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 3e-58 | |
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 2e-57 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 5e-57 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 5e-56 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 5e-56 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 1e-55 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 6e-55 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 1e-54 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 1e-54 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 5e-54 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 6e-54 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 7e-54 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 4e-53 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 4e-53 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 6e-53 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 1e-52 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 2e-52 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 2e-51 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 3e-50 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 1e-47 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 1e-47 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 5e-47 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 9e-46 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 2e-45 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 8e-45 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 6e-18 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 6e-15 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 1e-13 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 2e-13 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 2e-13 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 3e-13 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 4e-13 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 7e-13 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 1e-12 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 5e-12 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 5e-08 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 1e-06 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 9e-06 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 2e-05 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 6e-05 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 7e-05 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 1e-04 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 5e-04 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 7e-04 |
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} Length = 249 | Back alignment and structure |
|---|
Score = 252 bits (645), Expect = 6e-86
Identities = 84/160 (52%), Positives = 107/160 (66%)
Query: 2 EDPIKSFTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDEDCIGCAKTGSGKTLAFA 61
E+ K+F DL + L C +G PT+IQ IP L D IG A+TGSGKT AFA
Sbjct: 39 EEETKTFKDLGVTDVLCEACDQLGWTKPTKIQIEAIPLALQGRDIIGLAETGSGKTGAFA 98
Query: 62 LPILQKWCEDPYGIFALVLTPTRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKEL 121
LPIL E P +FALVLTPTRELA+QI +QF LG + ++ ++I GG+D + Q L
Sbjct: 99 LPILNALLETPQRLFALVLTPTRELAFQISEQFEALGSSIGVQSAVIVGGIDSMSQSLAL 158
Query: 122 AKKPHIVIATPGRLADHLDTCNTFSLNRIKFLVLDEADRL 161
AKKPHI+IATPGRL DHL+ F+L +K+LV+DEADR+
Sbjct: 159 AKKPHIIIATPGRLIDHLENTKGFNLRALKYLVMDEADRI 198
|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} Length = 236 | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} Length = 262 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* Length = 563 | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} Length = 245 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 Length = 219 | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 Length = 253 | Back alignment and structure |
|---|
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} Length = 242 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} Length = 434 | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 Length = 367 | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A Length = 207 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} Length = 337 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A Length = 410 | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A Length = 400 | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} Length = 228 | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* Length = 394 | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 Length = 206 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A Length = 224 | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* Length = 237 | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 Length = 220 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} Length = 417 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} Length = 414 | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* Length = 230 | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A Length = 391 | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B Length = 412 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} Length = 300 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} Length = 479 | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* Length = 395 | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* Length = 414 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 Length = 494 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* Length = 556 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* Length = 696 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} Length = 797 | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} Length = 555 | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} Length = 715 | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} Length = 936 | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} Length = 216 | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A Length = 702 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* Length = 720 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4a92_A* 1cu1_A 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A 8ohm_A 2f55_A 1jr6_A 1onb_A Length = 666 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* Length = 472 | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* Length = 440 | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 Length = 237 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A Length = 451 | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* Length = 1054 | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* Length = 620 | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} Length = 1108 | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} Length = 1010 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 182 | |||
| 3fe2_A | 242 | Probable ATP-dependent RNA helicase DDX5; DEAD, AD | 100.0 | |
| 3ber_A | 249 | Probable ATP-dependent RNA helicase DDX47; DEAD, A | 100.0 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 100.0 | |
| 1q0u_A | 219 | Bstdead; DEAD protein, RNA binding protein; 1.85A | 100.0 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 100.0 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 100.0 | |
| 2oxc_A | 230 | Probable ATP-dependent RNA helicase DDX20; DEAD, s | 100.0 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 100.0 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 100.0 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 100.0 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 100.0 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 100.0 | |
| 3fmo_B | 300 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 100.0 | |
| 2gxq_A | 207 | Heat resistant RNA dependent ATPase; RNA helicase, | 100.0 | |
| 3dkp_A | 245 | Probable ATP-dependent RNA helicase DDX52; DEAD, A | 100.0 | |
| 3ly5_A | 262 | ATP-dependent RNA helicase DDX18; alpha-beta, stru | 100.0 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 100.0 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 99.98 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 99.97 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 99.97 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 99.97 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 99.97 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 99.97 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 99.96 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 99.96 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 99.96 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 99.96 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 99.95 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 99.95 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 99.94 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 99.94 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 99.93 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 99.93 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 99.93 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 99.93 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.93 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 99.93 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 99.93 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 99.93 | |
| 3b6e_A | 216 | Interferon-induced helicase C domain-containing P; | 99.92 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.92 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.91 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 99.91 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 99.9 | |
| 4f92_B | 1724 | U5 small nuclear ribonucleoprotein 200 kDa helica; | 99.9 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 99.89 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 99.88 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 99.88 | |
| 1tf5_A | 844 | Preprotein translocase SECA subunit; ATPase, helic | 99.88 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 99.88 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 99.87 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 99.87 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 99.87 | |
| 2fsf_A | 853 | Preprotein translocase SECA subunit; ATPase, DNA-R | 99.85 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 99.85 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 99.85 | |
| 1nkt_A | 922 | Preprotein translocase SECA 1 subunit; preprotein | 99.85 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 99.83 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 99.83 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 99.82 | |
| 2ipc_A | 997 | Preprotein translocase SECA subunit; nucleotide bi | 99.82 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 99.82 | |
| 3crv_A | 551 | XPD/RAD3 related DNA helicase; XPD helicase DNA re | 99.75 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 99.73 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 99.73 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 99.72 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 99.71 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 99.71 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 99.7 | |
| 2vl7_A | 540 | XPD; helicase, unknown function; 2.25A {Sulfolobus | 99.67 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 99.66 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 99.65 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 99.63 | |
| 1z3i_X | 644 | Similar to RAD54-like; recombination ATPase helica | 99.63 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 99.62 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 99.58 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 99.57 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 99.57 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 99.51 | |
| 3jux_A | 822 | Protein translocase subunit SECA; protein transloc | 99.35 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 99.18 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 99.0 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 98.94 | |
| 2gk6_A | 624 | Regulator of nonsense transcripts 1; UPF1, helicas | 98.86 | |
| 2xzl_A | 802 | ATP-dependent helicase NAM7; hydrolase-RNA complex | 98.77 | |
| 2wjy_A | 800 | Regulator of nonsense transcripts 1; nonsense medi | 98.75 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 98.66 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 98.63 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 97.98 | |
| 2o0j_A | 385 | Terminase, DNA packaging protein GP17; nucleotide- | 97.88 | |
| 1uaa_A | 673 | REP helicase, protein (ATP-dependent DNA helicase | 97.79 | |
| 3cpe_A | 592 | Terminase, DNA packaging protein GP17; large termi | 97.79 | |
| 1pjr_A | 724 | PCRA; DNA repair, DNA replication, SOS response, h | 97.69 | |
| 3u4q_A | 1232 | ATP-dependent helicase/nuclease subunit A; helicas | 97.6 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 97.43 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 97.32 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 97.31 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 97.24 | |
| 3te6_A | 318 | Regulatory protein SIR3; heterochromatin, gene sil | 97.19 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 97.18 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.14 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 97.08 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 96.97 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 96.94 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 96.93 | |
| 1d2n_A | 272 | N-ethylmaleimide-sensitive fusion protein; hexamer | 96.89 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.85 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.79 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 96.73 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 96.72 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 96.66 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 96.62 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 96.61 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 96.53 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 96.51 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 96.45 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 96.32 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.3 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 96.28 | |
| 2zpa_A | 671 | Uncharacterized protein YPFI; RNA modification enz | 96.27 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 96.18 | |
| 2hjv_A | 163 | ATP-dependent RNA helicase DBPA; parallel alpha-be | 96.17 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 96.16 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 96.14 | |
| 2qby_B | 384 | CDC6 homolog 3, cell division control protein 6 ho | 96.09 | |
| 2rb4_A | 175 | ATP-dependent RNA helicase DDX25; rossmann fold, s | 96.08 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 95.94 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 95.93 | |
| 1fuk_A | 165 | Eukaryotic initiation factor 4A; helicase, DEAD-bo | 95.88 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 95.87 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 95.87 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 95.85 | |
| 2q6t_A | 444 | DNAB replication FORK helicase; hydrolase; 2.90A { | 95.8 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 95.75 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 95.74 | |
| 2p6n_A | 191 | ATP-dependent RNA helicase DDX41; DEAD, structural | 95.71 | |
| 3eaq_A | 212 | Heat resistant RNA dependent ATPase; DEAD box RNA | 95.71 | |
| 1t5i_A | 172 | C_terminal domain of A probable ATP-dependent RNA | 95.51 | |
| 3i5x_A | 563 | ATP-dependent RNA helicase MSS116; protein-RNA com | 95.49 | |
| 2fna_A | 357 | Conserved hypothetical protein; structural genomic | 95.47 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 95.43 | |
| 3hjh_A | 483 | Transcription-repair-coupling factor; MFD, mutatio | 95.32 | |
| 4b4t_M | 434 | 26S protease regulatory subunit 6A; hydrolase, AAA | 95.27 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 95.25 | |
| 2jgn_A | 185 | DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosp | 95.1 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 95.01 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 94.91 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 94.85 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 94.83 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 94.75 | |
| 3co5_A | 143 | Putative two-component system transcriptional RES | 94.71 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 94.69 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 94.68 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 94.45 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 94.37 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 94.3 | |
| 3hws_A | 363 | ATP-dependent CLP protease ATP-binding subunit CL; | 94.25 | |
| 3i32_A | 300 | Heat resistant RNA dependent ATPase; RNA helicase, | 94.24 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 94.16 | |
| 1w36_B | 1180 | RECB, exodeoxyribonuclease V beta chain; recombina | 94.05 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 93.93 | |
| 2v1x_A | 591 | ATP-dependent DNA helicase Q1; DNA strand annealin | 93.81 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 93.73 | |
| 4b4t_J | 405 | 26S protease regulatory subunit 8 homolog; hydrola | 93.68 | |
| 4b4t_H | 467 | 26S protease regulatory subunit 7 homolog; hydrola | 93.65 | |
| 1p9r_A | 418 | General secretion pathway protein E; bacterial typ | 93.58 | |
| 4b4t_L | 437 | 26S protease subunit RPT4; hydrolase, AAA-atpases, | 93.57 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 93.55 | |
| 3u4q_B | 1166 | ATP-dependent helicase/deoxyribonuclease subunit; | 93.4 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 93.34 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 93.3 | |
| 3fht_A | 412 | ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box | 93.24 | |
| 4b4t_K | 428 | 26S protease regulatory subunit 6B homolog; hydrol | 93.21 | |
| 3cf0_A | 301 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 93.21 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 93.14 | |
| 2d7d_A | 661 | Uvrabc system protein B; helicase, protein-DNA-ADP | 93.11 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.09 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 92.97 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 92.93 | |
| 2i1q_A | 322 | DNA repair and recombination protein RADA; ATPase, | 92.92 | |
| 3b85_A | 208 | Phosphate starvation-inducible protein; PHOH2, ATP | 92.91 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 92.9 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 92.85 | |
| 3nbx_X | 500 | ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu | 92.84 | |
| 2x8a_A | 274 | Nuclear valosin-containing protein-like; nuclear p | 92.61 | |
| 2r44_A | 331 | Uncharacterized protein; putative ATPase, structur | 92.6 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 92.59 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 92.5 | |
| 2bjv_A | 265 | PSP operon transcriptional activator; AAA, transcr | 92.44 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 92.39 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 92.36 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 92.28 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 92.26 | |
| 3eie_A | 322 | Vacuolar protein sorting-associated protein 4; AAA | 92.21 | |
| 1oyw_A | 523 | RECQ helicase, ATP-dependent DNA helicase; winged | 92.19 | |
| 1tue_A | 212 | Replication protein E1; helicase, replication, E1E | 92.18 | |
| 4b4t_I | 437 | 26S protease regulatory subunit 4 homolog; hydrola | 92.12 | |
| 2yjt_D | 170 | ATP-dependent RNA helicase SRMB, regulator of ribo | 91.33 | |
| 1c9k_A | 180 | COBU, adenosylcobinamide kinase; alpha/beta struct | 92.0 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 91.95 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 91.8 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 91.73 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 91.71 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 91.69 | |
| 1c4o_A | 664 | DNA nucleotide excision repair enzyme UVRB; uvrabc | 91.68 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 91.67 | |
| 3vkg_A | 3245 | Dynein heavy chain, cytoplasmic; AAA+ protein, mol | 91.67 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 91.64 | |
| 2iut_A | 574 | DNA translocase FTSK; nucleotide-binding, chromoso | 91.56 | |
| 1lvg_A | 198 | Guanylate kinase, GMP kinase; transferase; HET: AD | 91.51 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 91.51 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 91.44 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 91.43 | |
| 1u0j_A | 267 | DNA replication protein; AAA+ protein, P-loop atpa | 91.43 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 91.4 | |
| 1ixz_A | 254 | ATP-dependent metalloprotease FTSH; AAA domain fol | 91.39 | |
| 2ius_A | 512 | DNA translocase FTSK; nucleotide-binding, chromoso | 91.34 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 91.29 | |
| 2gza_A | 361 | Type IV secretion system protein VIRB11; ATPase, h | 91.27 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 91.23 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 91.17 | |
| 1ojl_A | 304 | Transcriptional regulatory protein ZRAR; response | 91.11 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 91.05 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 91.04 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 91.01 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 91.0 | |
| 1v5w_A | 343 | DMC1, meiotic recombination protein DMC1/LIM15 hom | 90.99 | |
| 2eyq_A | 1151 | TRCF, transcription-repair coupling factor; MFD, S | 90.97 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 90.96 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 90.96 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 90.91 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 90.9 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 90.87 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 90.82 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 90.73 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 90.72 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 90.65 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 90.64 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 90.63 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 90.6 | |
| 1lv7_A | 257 | FTSH; alpha/beta domain, four helix bundle, hydrol | 90.58 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 90.48 | |
| 1sxj_D | 353 | Activator 1 41 kDa subunit; clamp loader, processi | 90.48 | |
| 2qp9_X | 355 | Vacuolar protein sorting-associated protein 4; ATP | 90.46 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 90.39 | |
| 2qmh_A | 205 | HPR kinase/phosphorylase; V267F mutation, ATP-bind | 90.27 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 90.25 | |
| 1iy2_A | 278 | ATP-dependent metalloprotease FTSH; AAA domain fol | 90.18 | |
| 2c9o_A | 456 | RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- | 90.13 | |
| 3t15_A | 293 | Ribulose bisphosphate carboxylase/oxygenase activ | 90.1 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 90.09 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 90.08 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 89.9 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 89.9 | |
| 4a15_A | 620 | XPD helicase, ATP-dependent DNA helicase TA0057; h | 89.81 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 89.76 | |
| 1z6g_A | 218 | Guanylate kinase; structural genomics, SGC, struct | 89.73 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 89.71 | |
| 2pt7_A | 330 | CAG-ALFA; ATPase, protein-protein complex, type IV | 89.65 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 89.43 | |
| 2r62_A | 268 | Cell division protease FTSH homolog; ATPase domain | 89.41 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 89.41 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 89.39 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 89.23 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 89.18 | |
| 1s96_A | 219 | Guanylate kinase, GMP kinase; E.coli, dimer, SAD, | 89.12 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 89.06 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 89.03 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 89.01 | |
| 3ney_A | 197 | 55 kDa erythrocyte membrane protein; structural ge | 88.99 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 88.99 | |
| 3f9v_A | 595 | Minichromosome maintenance protein MCM; replicativ | 88.95 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 88.9 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 88.86 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 88.82 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 88.77 | |
| 3d8b_A | 357 | Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s | 88.74 | |
| 2xau_A | 773 | PRE-mRNA-splicing factor ATP-dependent RNA helica; | 88.72 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 88.64 | |
| 4fcw_A | 311 | Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 | 88.63 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 88.55 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 88.5 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 88.48 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 88.46 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 88.4 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 88.39 | |
| 1zuh_A | 168 | Shikimate kinase; alpha-beta protein, transferase; | 88.26 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 88.19 | |
| 3cf2_A | 806 | TER ATPase, transitional endoplasmic reticulum ATP | 88.16 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 88.12 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 88.11 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 88.06 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 88.01 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 87.88 | |
| 2zan_A | 444 | Vacuolar protein sorting-associating protein 4B; S | 87.6 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 87.54 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 87.54 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 87.54 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 87.43 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 87.42 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 87.41 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 87.33 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 87.29 | |
| 1g8p_A | 350 | Magnesium-chelatase 38 kDa subunit; parallel beta | 87.23 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 87.15 | |
| 3k1j_A | 604 | LON protease, ATP-dependent protease LON; ATP-bind | 87.14 | |
| 2iyv_A | 184 | Shikimate kinase, SK; transferase, aromatic amino | 87.1 | |
| 2qt1_A | 207 | Nicotinamide riboside kinase 1; non-protein kinase | 87.07 | |
| 1pzn_A | 349 | RAD51, DNA repair and recombination protein RAD51, | 87.06 | |
| 3pxg_A | 468 | Negative regulator of genetic competence CLPC/MEC; | 87.04 | |
| 3lnc_A | 231 | Guanylate kinase, GMP kinase; ALS collaborative cr | 87.01 | |
| 3d3q_A | 340 | TRNA delta(2)-isopentenylpyrophosphate transferase | 86.92 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 86.92 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 86.91 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 86.88 | |
| 4anj_A | 1052 | Unconventional myosin-VI, green fluorescent prote; | 86.87 | |
| 3dl0_A | 216 | Adenylate kinase; phosphotransferase, zinc coordin | 86.81 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 86.72 | |
| 1e6c_A | 173 | Shikimate kinase; phosphoryl transfer, ADP, shikim | 86.67 | |
| 3tlx_A | 243 | Adenylate kinase 2; structural genomics, structura | 86.33 | |
| 2v9p_A | 305 | Replication protein E1; AAA+ molecular motor, DNA | 86.22 | |
| 3nwj_A | 250 | ATSK2; P loop, shikimate, nucleoside monophosphate | 86.12 | |
| 1f2t_A | 149 | RAD50 ABC-ATPase; DNA double-strand break repair, | 86.12 | |
| 1ye8_A | 178 | Protein THEP1, hypothetical UPF0334 kinase-like pr | 86.11 | |
| 1zd8_A | 227 | GTP:AMP phosphotransferase mitochondrial; ATP:AMP | 86.09 | |
| 1tev_A | 196 | UMP-CMP kinase; ploop, NMP binding region, LID reg | 86.08 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 86.04 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 85.95 | |
| 1gvn_B | 287 | Zeta; postsegregational killing system, plasmid; 1 | 85.93 | |
| 1q57_A | 503 | DNA primase/helicase; dntpase, DNA replication, tr | 85.85 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 85.81 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 85.71 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 85.71 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 85.57 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 85.53 | |
| 1cke_A | 227 | CK, MSSA, protein (cytidine monophosphate kinase); | 85.5 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 85.37 | |
| 1qf9_A | 194 | UMP/CMP kinase, protein (uridylmonophosphate/cytid | 85.33 | |
| 1ak2_A | 233 | Adenylate kinase isoenzyme-2; nucleoside monophosp | 85.33 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 85.32 | |
| 3lda_A | 400 | DNA repair protein RAD51; DNA binding protein, ATP | 85.27 | |
| 2cdn_A | 201 | Adenylate kinase; phosphoryl transfer, associative | 85.24 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 85.16 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 85.15 | |
| 1g41_A | 444 | Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep | 85.11 | |
| 3nwn_A | 359 | Kinesin-like protein KIF9; motor domain, ADP, stru | 85.09 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 85.02 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 84.99 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 84.92 | |
| 2i3b_A | 189 | HCR-ntpase, human cancer-related ntpase; AAA, ross | 84.91 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 84.88 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 84.83 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 84.77 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 84.7 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 84.69 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 84.67 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 84.66 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 84.52 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 84.41 | |
| 2pt5_A | 168 | Shikimate kinase, SK; aromatic amino acid biosynth | 84.27 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 84.26 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 84.15 | |
| 1bg2_A | 325 | Kinesin; motor protein, ATPase, microtubule associ | 84.05 | |
| 3asz_A | 211 | Uridine kinase; cytidine phosphorylation, transfer | 84.04 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 83.99 | |
| 3m6a_A | 543 | ATP-dependent protease LA 1; alpha, beta, ATP-bind | 83.97 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 83.95 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 83.87 | |
| 4db1_A | 783 | Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb | 83.79 | |
| 1f9v_A | 347 | Kinesin-like protein KAR3; kinesin-related protein | 83.72 | |
| 3bs4_A | 260 | Uncharacterized protein PH0321; structural genomic | 83.7 | |
| 1g8x_A | 1010 | Myosin II heavy chain fused to alpha-actinin 3; mo | 83.64 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 83.58 | |
| 3dc4_A | 344 | Kinesin-like protein NOD; catalytic domain, ATPase | 83.56 | |
| 1lkx_A | 697 | Myosin IE heavy chain; myosin motor domain, lever | 83.55 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 83.53 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 83.51 | |
| 4etp_A | 403 | Kinesin-like protein KAR3; kinesin motor protein, | 83.46 | |
| 1ls1_A | 295 | Signal recognition particle protein; FFH, SRP54, S | 83.45 | |
| 2vli_A | 183 | Antibiotic resistance protein; transferase, tunica | 83.42 | |
| 3t0q_A | 349 | AGR253WP; kinesin, alpha and beta proteins, P-loop | 83.39 | |
| 3sr0_A | 206 | Adenylate kinase; phosphoryl transfer analogue, AL | 83.39 | |
| 1w7j_A | 795 | Myosin VA; motor protein, unconventional myosin, m | 83.31 | |
| 2ce7_A | 476 | Cell division protein FTSH; metalloprotease; HET: | 83.28 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 83.26 | |
| 1w9i_A | 770 | Myosin II heavy chain; molecular motor, ATPase, mo | 83.19 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 83.17 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 83.16 | |
| 2vvg_A | 350 | Kinesin-2; motor protein, nucleotide-binding, micr | 83.13 | |
| 3tqc_A | 321 | Pantothenate kinase; biosynthesis of cofactors, pr | 83.09 | |
| 3lre_A | 355 | Kinesin-like protein KIF18A; motor protein, nucleo | 83.06 | |
| 2zfi_A | 366 | Kinesin-like protein KIF1A, kinesin heavy chain is | 82.91 | |
| 2y65_A | 365 | Kinesin, kinesin heavy chain; motor protein; HET: | 82.9 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 82.88 | |
| 3qf7_A | 365 | RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. | 82.86 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 82.82 | |
| 2h58_A | 330 | Kinesin-like protein KIFC3 variant; motor domain, | 82.76 | |
| 4a14_A | 344 | Kinesin, kinesin-like protein KIF7; motor protein, | 82.72 | |
| 4akg_A | 2695 | Glutathione S-transferase class-MU 26 kDa isozyme | 82.66 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 82.62 | |
| 1v8k_A | 410 | Kinesin-like protein KIF2C; microtubule destabiliz | 82.6 | |
| 2cbz_A | 237 | Multidrug resistance-associated protein 1; ABC pro | 82.58 | |
| 1goj_A | 355 | Kinesin, kinesin heavy chain; motor protein, ATPas | 82.51 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 82.51 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 82.48 | |
| 3tqf_A | 181 | HPR(Ser) kinase; transferase, hydrolase; 2.80A {Co | 82.39 | |
| 3b6u_A | 372 | Kinesin-like protein KIF3B; structural genomics co | 82.3 | |
| 3qks_A | 203 | DNA double-strand break repair RAD50 ATPase; RECA- | 82.3 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 82.28 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 82.18 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 82.17 | |
| 2dfs_A | 1080 | Myosin-5A; myosin-V, inhibited state, cryoelectron | 82.17 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 82.17 | |
| 3gbj_A | 354 | KIF13B protein; kinesin, motor domain, ADP, struct | 82.1 | |
| 1sgw_A | 214 | Putative ABC transporter; structural genomics, P p | 82.05 | |
| 2nr8_A | 358 | Kinesin-like protein KIF9; motor domain, ADP, stru | 81.89 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 81.72 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 81.7 | |
| 2heh_A | 387 | KIF2C protein; kinesin, motor domain, ADP, structu | 81.65 | |
| 1x88_A | 359 | Kinesin-like protein KIF11; switch II, motor domai | 81.63 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 81.63 | |
| 1t5c_A | 349 | CENP-E protein, centromeric protein E; kinesin mot | 81.62 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 81.6 | |
| 2pcj_A | 224 | ABC transporter, lipoprotein-releasing system ATP- | 81.58 | |
| 1tf7_A | 525 | KAIC; homohexamer, hexamer, circadian clock protei | 81.55 | |
| 1kk8_A | 837 | Myosin heavy chain, striated muscle; actin-detache | 81.55 | |
| 3auy_A | 371 | DNA double-strand break repair RAD50 ATPase; DNA r | 81.46 | |
| 1ry6_A | 360 | Internal kinesin; kinesin motor domain, nucleotide | 81.46 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 81.45 | |
| 1ypw_A | 806 | Transitional endoplasmic reticulum ATPase; AAA, P9 | 81.44 | |
| 2owm_A | 443 | Nckin3-434, related to kinesin-like protein KIF1C; | 81.39 | |
| 2pjz_A | 263 | Hypothetical protein ST1066; ATP binding protein, | 81.38 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 81.37 | |
| 1z5z_A | 271 | Helicase of the SNF2/RAD54 family; hydrolase, reco | 81.34 | |
| 3gfo_A | 275 | Cobalt import ATP-binding protein CBIO 1; structur | 81.32 | |
| 2ycu_A | 995 | Non muscle myosin 2C, alpha-actinin; motor protein | 81.29 | |
| 3pxi_A | 758 | Negative regulator of genetic competence CLPC/MEC; | 81.29 | |
| 2ffh_A | 425 | Protein (FFH); SRP54, signal recognition particle, | 81.28 | |
| 2p5t_B | 253 | PEZT; postsegregational killing system, phosphoryl | 81.26 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 81.24 | |
| 3u06_A | 412 | Protein claret segregational; motor domain, stalk | 81.23 | |
| 2pze_A | 229 | Cystic fibrosis transmembrane conductance regulat; | 81.21 | |
| 2ff7_A | 247 | Alpha-hemolysin translocation ATP-binding protein | 81.1 | |
| 2grj_A | 192 | Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosp | 81.08 | |
| 1g6h_A | 257 | High-affinity branched-chain amino acid transport | 81.07 | |
| 1ji0_A | 240 | ABC transporter; ATP binding protein, structural g | 81.02 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 81.01 | |
| 1b0u_A | 262 | Histidine permease; ABC transporter, transport pro | 80.97 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 80.8 | |
| 2d2e_A | 250 | SUFC protein; ABC-ATPase, SUF protein, 310-helix, | 80.79 | |
| 2wbe_C | 373 | Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit | 80.73 | |
| 1r6b_X | 758 | CLPA protein; AAA+, N-terminal domain, CLPS, cryst | 80.72 | |
| 2ghi_A | 260 | Transport protein; multidrug resistance protein, M | 80.63 | |
| 2qi9_C | 249 | Vitamin B12 import ATP-binding protein BTUD; inner | 80.6 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 80.48 | |
| 3bfn_A | 388 | Kinesin-like protein KIF22; limited proteolysis, s | 80.33 | |
| 3cob_A | 369 | Kinesin heavy chain-like protein; motor, switch II | 80.31 | |
| 2rep_A | 376 | Kinesin-like protein KIFC1; structural genomics co | 80.29 | |
| 2v26_A | 784 | Myosin VI; calmodulin-binding, nucleotide-binding, | 80.27 | |
| 1mv5_A | 243 | LMRA, multidrug resistance ABC transporter ATP-bin | 80.21 | |
| 4g1u_C | 266 | Hemin import ATP-binding protein HMUV; membrane tr | 80.2 | |
| 1svm_A | 377 | Large T antigen; AAA+ fold, viral protein; HET: AT | 80.18 | |
| 1vpl_A | 256 | ABC transporter, ATP-binding protein; TM0544, stru | 80.01 |
| >3fe2_A Probable ATP-dependent RNA helicase DDX5; DEAD, ADP, ATP-binding, hydrolase, nucleotide- RNA-binding, methylation, mRNA processing, mRNA S nucleus; HET: ADP; 2.60A {Homo sapiens} PDB: 4a4d_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.4e-34 Score=214.90 Aligned_cols=172 Identities=34% Similarity=0.439 Sum_probs=154.6
Q ss_pred CCCccCCccCCCCCHHHHHHHHHCCCCCChHHHHhhhhhhhCCCcEEEECCCCChHHHHHHHHHHHhhccC-----CCCe
Q psy4275 1 MEDPIKSFTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDEDCIGCAKTGSGKTLAFALPILQKWCED-----PYGI 75 (182)
Q Consensus 1 ~~~~~~~~~~~~l~~~i~~~l~~~~~~~~~~~Q~~~~~~~~~~~~~li~~~tg~GKT~~~~~~~~~~~~~~-----~~~~ 75 (182)
.|+++.+|+++++++.+.+.+.+.|+..|+++|.++++.+.+|+++++++|||+|||.+++++++..+... ..++
T Consensus 24 ~p~~~~~f~~~~l~~~l~~~l~~~g~~~~~~~Q~~~i~~~~~g~~~l~~apTGsGKT~~~~l~~l~~l~~~~~~~~~~~~ 103 (242)
T 3fe2_A 24 CPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGP 103 (242)
T ss_dssp CCCCCSSTTTTTCCHHHHHHHHTTTCCSCCHHHHHHHHHHHHTCCEEEEECTTSCHHHHHHHHHHHHHHTSCCCCTTCCC
T ss_pred CCCccCCHhhcCCCHHHHHHHHHCCCCCCCHHHHHHHHHHhCCCCEEEECCCcCHHHHHHHHHHHHHHHhccccccCCCC
Confidence 37889999999999999999999999999999999999999999999999999999999999999887643 2467
Q ss_pred eEEEEcCCHHHHHHHHHHHHHhhccCCceEEEEEcCCchhhhhHHhcCCCcEEEEChHHHHHHHhcCCCCCCCCccEEEE
Q psy4275 76 FALVLTPTRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKELAKKPHIVIATPGRLADHLDTCNTFSLNRIKFLVL 155 (182)
Q Consensus 76 ~~lil~p~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ilv~T~~~l~~~~~~~~~~~~~~~~~iI~ 155 (182)
+++|++|+++|+.|+++.++.+.+..++++..++|+.........+.++++|+|+||+++.+++.. ....+++++++|+
T Consensus 104 ~~lil~Pt~~L~~Q~~~~~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~I~v~Tp~~l~~~l~~-~~~~~~~~~~lVi 182 (242)
T 3fe2_A 104 ICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEC-GKTNLRRTTYLVL 182 (242)
T ss_dssp SEEEECSSHHHHHHHHHHHHHHHHHTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHH-TSCCCTTCCEEEE
T ss_pred EEEEEeCcHHHHHHHHHHHHHHHhhcCceEEEEECCCChHHHHHHhcCCCCEEEECHHHHHHHHHc-CCCCcccccEEEE
Confidence 899999999999999999999999999999999999988777777777899999999999999987 5567889999999
Q ss_pred eccccccccCChhHHHHH
Q psy4275 156 DEADRLSLMTSLKFFFFF 173 (182)
Q Consensus 156 DE~h~~~~~~~~~~~~~~ 173 (182)
||||++.++++......+
T Consensus 183 DEah~l~~~~~~~~~~~i 200 (242)
T 3fe2_A 183 DEADRMLDMGFEPQIRKI 200 (242)
T ss_dssp TTHHHHHHTTCHHHHHHH
T ss_pred eCHHHHhhhCcHHHHHHH
Confidence 999999998866554433
|
| >3ber_A Probable ATP-dependent RNA helicase DDX47; DEAD, AMP, structural genomics, structural GEN consortium, SGC, ATP-binding, hydrolase; HET: AMP PGE; 1.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1q0u_A Bstdead; DEAD protein, RNA binding protein; 1.85A {Geobacillus stearothermophilus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >2oxc_A Probable ATP-dependent RNA helicase DDX20; DEAD, structural genomics, structural genomics consortium, SGC, hydrolase; HET: ADP; 1.30A {Homo sapiens} PDB: 3b7g_A* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3fmo_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 2.51A {Homo sapiens} | Back alignment and structure |
|---|
| >2gxq_A Heat resistant RNA dependent ATPase; RNA helicase, atomic resolution, AMP complex, ribosome biogenesis, thermophilic, hydrolase; HET: AMP; 1.20A {Thermus thermophilus HB27} PDB: 2gxs_A* 2gxu_A 3mwj_A 3mwk_A* 3mwl_A* 3nbf_A* 3nej_A | Back alignment and structure |
|---|
| >3dkp_A Probable ATP-dependent RNA helicase DDX52; DEAD, ADP, structural genomics, structural GEN consortium, SGC, rRNA, ATP-binding, hydrolase; HET: ADP; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3ly5_A ATP-dependent RNA helicase DDX18; alpha-beta, structural genomics, structural genomics consort ATP-binding, hydrolase, nucleotide-binding, RNA-B; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3b6e_A Interferon-induced helicase C domain-containing P; DECH, DEXD/H RNA-binding helicase, innate immunity, IFIH1, S genomics; 1.60A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4f92_B U5 small nuclear ribonucleoprotein 200 kDa helica; RNP remodeling, PRE-mRNA splicing, spliceosome catalytic ACT DEXD/H-box RNA helicase; HET: SAN; 2.66A {Homo sapiens} PDB: 4f93_B* 4f91_B | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >1tf5_A Preprotein translocase SECA subunit; ATPase, helicase, translocation, secretion, protein transport; 2.18A {Bacillus subtilis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1tf2_A 3iqy_A 1m6n_A 1m74_A* 3iqm_A 3jv2_A* 2ibm_A* 3dl8_A 1sx0_A 1sx1_A 1tm6_A | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >2fsf_A Preprotein translocase SECA subunit; ATPase, DNA-RNA helicase, protein translocation, protein transport; 2.00A {Escherichia coli} PDB: 2fsg_A* 2fsh_A* 2fsi_A* 2vda_A 3bxz_A* | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1nkt_A Preprotein translocase SECA 1 subunit; preprotein translocation, ATPase, transmembrane transport, helicase-like motor domain; HET: ADP; 2.60A {Mycobacterium tuberculosis} SCOP: a.162.1.1 a.172.1.1 c.37.1.19 c.37.1.19 PDB: 1nl3_A | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >2ipc_A Preprotein translocase SECA subunit; nucleotide binding fold, ATPase, parallel dimer; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3crv_A XPD/RAD3 related DNA helicase; XPD helicase DNA repair cancer aging, hydrolase; HET: FLC; 2.00A {Sulfolobus acidocaldarius} PDB: 3crw_1* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >2vl7_A XPD; helicase, unknown function; 2.25A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1z3i_X Similar to RAD54-like; recombination ATPase helicase, recombination-DNA binding COM; 3.00A {Danio rerio} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >3jux_A Protein translocase subunit SECA; protein translocation, ATPase, conformational change, peptide binding, ATP-binding, cell inner membrane; HET: ADP; 3.10A {Thermotoga maritima} PDB: 3din_A* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A | Back alignment and structure |
|---|
| >2xzl_A ATP-dependent helicase NAM7; hydrolase-RNA complex, NMD, RNA degradation, allosteric REGU; HET: ADP 1PE; 2.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2wjy_A Regulator of nonsense transcripts 1; nonsense mediated decay, zinc-finger, ATP-binding, metal-BIN UPF2, UPF1, helicase, hydrolase; 2.50A {Homo sapiens} PDB: 2wjv_A 2iyk_A | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >2o0j_A Terminase, DNA packaging protein GP17; nucleotide-binding fold, hydrolase; HET: DNA ADP; 1.80A {Enterobacteria phage T4} PDB: 2o0h_A* 2o0k_A* | Back alignment and structure |
|---|
| >1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3cpe_A Terminase, DNA packaging protein GP17; large terminase, alternative initiation, ATP-binding, DNA- binding, hydrolase, nuclease; HET: DNA; 2.80A {Bacteriophage T4} PDB: 3ezk_A* | Back alignment and structure |
|---|
| >1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* | Back alignment and structure |
|---|
| >3u4q_A ATP-dependent helicase/nuclease subunit A; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >2zpa_A Uncharacterized protein YPFI; RNA modification enzyme, RNA helicase, acetyltransferase, GCN5 acetyltransferase; HET: ACO ADP; 2.35A {Escherichia coli K12} | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2hjv_A ATP-dependent RNA helicase DBPA; parallel alpha-beta, hydrolase; 1.95A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2rb4_A ATP-dependent RNA helicase DDX25; rossmann fold, structural genomics, structural consortium, SGC, alternative initiation, ATP-binding, devel protein; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1fuk_A Eukaryotic initiation factor 4A; helicase, DEAD-box protein, translation; 1.75A {Saccharomyces cerevisiae} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >2p6n_A ATP-dependent RNA helicase DDX41; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3eaq_A Heat resistant RNA dependent ATPase; DEAD box RNA helicase, dimer, ATP-binding, helicase, hydrolase, nucleotide-binding; 2.30A {Thermus thermophilus} PDB: 3ear_A 3eas_A | Back alignment and structure |
|---|
| >1t5i_A C_terminal domain of A probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; 1.90A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3i5x_A ATP-dependent RNA helicase MSS116; protein-RNA complex, RNA helicase, DEAD-BOX, ATP-binding, HE hydrolase, mitochondrion; HET: ANP; 1.90A {Saccharomyces cerevisiae} PDB: 3i5y_A* 3i61_A* 3i62_A* 3sqx_A* 4db2_A 4db4_A | Back alignment and structure |
|---|
| >2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >3hjh_A Transcription-repair-coupling factor; MFD, mutation frequency decline, ATP-binding, DNA DAMA repair, DNA-binding, helicase, hydrolase; 1.95A {Escherichia coli} PDB: 2b2n_A* 4dfc_A | Back alignment and structure |
|---|
| >4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2jgn_A DBX, DDX3, ATP-dependent RNA helicase DDX3X; phosphorylation, nucleotide-binding, hydrolase, RNA-binding, ATP-binding, DNA-binding, nuclear protein; 1.91A {Homo sapiens} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A | Back alignment and structure |
|---|
| >3i32_A Heat resistant RNA dependent ATPase; RNA helicase, dimer, RNA recognition motif, ATP-BIND helicase, nucleotide-binding; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2v1x_A ATP-dependent DNA helicase Q1; DNA strand annealing, mismatch repair, nucleotide-binding, DNA-binding, polymorphism, nuclear protein, ATPase; HET: ADP; 2.00A {Homo sapiens} PDB: 2wwy_A* | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* | Back alignment and structure |
|---|
| >4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >3u4q_B ATP-dependent helicase/deoxyribonuclease subunit; helicase, nuclease, double strand DNA repair, protein-DNA CO hydrolase-DNA complex; HET: DNA; 2.80A {Bacillus subtilis} PDB: 3u44_B* | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3fht_A ATP-dependent RNA helicase DDX19B; DBP5, DEAD-box helicase, RNA dependent ATPase, mRNA export, nucleocytoplasmic transport, NUP214, CAN; HET: ANP; 2.20A {Homo sapiens} PDB: 3ews_A* 3g0h_A* 3fhc_B | Back alignment and structure |
|---|
| >4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2d7d_A Uvrabc system protein B; helicase, protein-DNA-ADP ternary complex, hydrolase/DNA complex; HET: ADP; 2.10A {Bacillus subtilis} PDB: 2nmv_A* 2fdc_A* 1t5l_A 3uwx_B 1d9z_A* 1d9x_A 2d7d_B* 2nmv_B* | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* | Back alignment and structure |
|---|
| >3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} | Back alignment and structure |
|---|
| >2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C | Back alignment and structure |
|---|
| >1oyw_A RECQ helicase, ATP-dependent DNA helicase; winged helix, helix-turn-helix, ATP binding, Zn(2+) binding, hydrolase; 1.80A {Escherichia coli} SCOP: a.4.5.43 c.37.1.19 c.37.1.19 PDB: 1oyy_A* | Back alignment and structure |
|---|
| >1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2yjt_D ATP-dependent RNA helicase SRMB, regulator of ribonuclease activity A; hydrolase inhibitor-hydrolase complex, DEAD box RNA helicase; 2.90A {Escherichia coli} | Back alignment and structure |
|---|
| >1c9k_A COBU, adenosylcobinamide kinase; alpha/beta structure rossmann fold P-loop, transferase; HET: 5GP; 2.20A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1cbu_A | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >1c4o_A DNA nucleotide excision repair enzyme UVRB; uvrabc, helicase, hypertherm protein, replication; HET: DNA BOG; 1.50A {Thermus thermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1d2m_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* | Back alignment and structure |
|---|
| >1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* | Back alignment and structure |
|---|
| >2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ojl_A Transcriptional regulatory protein ZRAR; response regulator, two component system, AAA domain, NTRC family, DNA-binding; HET: ATP; 3.0A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A | Back alignment and structure |
|---|
| >2eyq_A TRCF, transcription-repair coupling factor; MFD, SF2 ATPase, hydrolase; HET: EPE; 3.20A {Escherichia coli} SCOP: b.34.18.1 c.37.1.19 c.37.1.19 c.37.1.19 c.37.1.19 d.315.1.1 | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* | Back alignment and structure |
|---|
| >3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >4a15_A XPD helicase, ATP-dependent DNA helicase TA0057; hydrolase, nucleotide excision repair,; 2.20A {Thermoplasma acidophilum} PDB: 2vsf_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >1zuh_A Shikimate kinase; alpha-beta protein, transferase; 1.80A {Helicobacter pylori} PDB: 1zui_A* 3hr7_A 3muf_A* 3mrs_A 3n2e_A* | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} | Back alignment and structure |
|---|
| >2iyv_A Shikimate kinase, SK; transferase, aromatic amino acid biosynthesis, P-loop kinase, metal- binding, shikimate pathway; HET: ADP; 1.35A {Mycobacterium tuberculosis} SCOP: c.37.1.2 PDB: 2iyr_A* 2iyq_A* 2iyt_A 2iyu_A* 2iys_A* 2iyw_A* 2iyx_A* 2iyy_A* 2iyz_A* 2g1k_A* 1l4y_A* 1u8a_A* 1we2_A* 1zyu_A* 2dfn_A* 2dft_A* 2g1j_A 1l4u_A* 3baf_A* | Back alignment and structure |
|---|
| >2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* | Back alignment and structure |
|---|
| >1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 | Back alignment and structure |
|---|
| >3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} | Back alignment and structure |
|---|
| >3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} | Back alignment and structure |
|---|
| >3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >1e6c_A Shikimate kinase; phosphoryl transfer, ADP, shikimate pathway, P-loop protein, transferase; 1.8A {Erwinia chrysanthemi} SCOP: c.37.1.2 PDB: 1shk_A 2shk_A* | Back alignment and structure |
|---|
| >3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* | Back alignment and structure |
|---|
| >3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* | Back alignment and structure |
|---|
| >1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >1zd8_A GTP:AMP phosphotransferase mitochondrial; ATP:AMP phosphotransferase, myokinase, structural genomics, structural genomics consortium, SGC; 1.48A {Homo sapiens} PDB: 2ak3_A* | Back alignment and structure |
|---|
| >1tev_A UMP-CMP kinase; ploop, NMP binding region, LID region, conformational changes, transferase; 2.10A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* | Back alignment and structure |
|---|
| >1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >1cke_A CK, MSSA, protein (cytidine monophosphate kinase); nucleotide monophosphate kinase,, transferase; 1.75A {Escherichia coli} SCOP: c.37.1.1 PDB: 1kdo_A* 1kdp_A* 1kdr_A* 1kdt_A* 2cmk_A* 2fem_A 2feo_A* | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >1qf9_A UMP/CMP kinase, protein (uridylmonophosphate/cytidylmonophosphate kinase); nucleoside monophosphate kinase, NMP kinase; HET: ADP C5P; 1.70A {Dictyostelium discoideum} SCOP: c.37.1.1 PDB: 1uke_A* 2ukd_A* 3ukd_A* 4ukd_A* 5ukd_A* | Back alignment and structure |
|---|
| >1ak2_A Adenylate kinase isoenzyme-2; nucleoside monophosphate kinase, phosphotransferase; 1.92A {Bos taurus} SCOP: c.37.1.1 g.41.2.1 PDB: 2ak2_A 2c9y_A* | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* | Back alignment and structure |
|---|
| >2cdn_A Adenylate kinase; phosphoryl transfer, associative mechanism, ATP-binding, nucleotide biosynthesis, nucleotide-binding, transferase; HET: ADP; 1.9A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1p4s_A | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* | Back alignment and structure |
|---|
| >3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2pt5_A Shikimate kinase, SK; aromatic amino acid biosynthesis, P-loop kinase, SHI kinase, shikimate pathway; 2.10A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* | Back alignment and structure |
|---|
| >3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* | Back alignment and structure |
|---|
| >1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* | Back alignment and structure |
|---|
| >3bs4_A Uncharacterized protein PH0321; structural genomics, unknown function, PSI-2, protein struct initiative; 1.60A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* | Back alignment and structure |
|---|
| >1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* | Back alignment and structure |
|---|
| >2vli_A Antibiotic resistance protein; transferase, tunicamycin, phosphotransferase; 1.95A {Deinococcus radiodurans} | Back alignment and structure |
|---|
| >3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} | Back alignment and structure |
|---|
| >3sr0_A Adenylate kinase; phosphoryl transfer analogue, ALF4, transferase (phosphotran phosphoryl transfer, nucleotide-binding; HET: ADP AMP; 1.56A {Aquifex aeolicus} PDB: 2rh5_A 2rgx_A* | Back alignment and structure |
|---|
| >1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A | Back alignment and structure |
|---|
| >2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} | Back alignment and structure |
|---|
| >3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 | Back alignment and structure |
|---|
| >2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* | Back alignment and structure |
|---|
| >2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} | Back alignment and structure |
|---|
| >4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* | Back alignment and structure |
|---|
| >4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* | Back alignment and structure |
|---|
| >2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} | Back alignment and structure |
|---|
| >1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3tqf_A HPR(Ser) kinase; transferase, hydrolase; 2.80A {Coxiella burnetii} | Back alignment and structure |
|---|
| >3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* | Back alignment and structure |
|---|
| >3qks_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATPase, exonuclease, endonucle binding, DNA binding; HET: DNA; 2.10A {Pyrococcus furiosus} PDB: 3qkr_A* | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* | Back alignment and structure |
|---|
| >1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A | Back alignment and structure |
|---|
| >1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* | Back alignment and structure |
|---|
| >1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... | Back alignment and structure |
|---|
| >3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* | Back alignment and structure |
|---|
| >1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} | Back alignment and structure |
|---|
| >2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >1z5z_A Helicase of the SNF2/RAD54 family; hydrolase, recombination, hydrolase-recombination complex; 2.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} | Back alignment and structure |
|---|
| >2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* | Back alignment and structure |
|---|
| >3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A | Back alignment and structure |
|---|
| >2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* | Back alignment and structure |
|---|
| >2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A | Back alignment and structure |
|---|
| >2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* | Back alignment and structure |
|---|
| >2grj_A Dephospho-COA kinase; TM1387, EC 2.7.1.24, dephosphocoenzyme kinase, structural genomics, joint center for structural GE JCSG; HET: ADP COD; 2.60A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* | Back alignment and structure |
|---|
| >1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* | Back alignment and structure |
|---|
| >2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* | Back alignment and structure |
|---|
| >2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} | Back alignment and structure |
|---|
| >2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* | Back alignment and structure |
|---|
| >2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* | Back alignment and structure |
|---|
| >1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 | Back alignment and structure |
|---|
| >4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} | Back alignment and structure |
|---|
| >1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A | Back alignment and structure |
|---|
| >1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 182 | ||||
| d1hv8a1 | 208 | c.37.1.19 (A:3-210) Putative DEAD box RNA helicase | 8e-33 | |
| d2g9na1 | 218 | c.37.1.19 (A:21-238) Initiation factor 4a {Human ( | 8e-27 | |
| d2j0sa1 | 222 | c.37.1.19 (A:22-243) Probable ATP-dependent RNA he | 1e-26 | |
| d1wrba1 | 238 | c.37.1.19 (A:164-401) putative ATP-dependent RNA h | 2e-25 | |
| d1qdea_ | 212 | c.37.1.19 (A:) Initiation factor 4a {Baker's yeast | 7e-25 | |
| d1t6na_ | 207 | c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP5 | 4e-24 | |
| d1gkub1 | 237 | c.37.1.16 (B:1-250) Helicase-like "domain" of reve | 2e-23 | |
| d1veca_ | 206 | c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Huma | 1e-22 | |
| d1s2ma1 | 206 | c.37.1.19 (A:46-251) Putative ATP-dependent RNA he | 5e-21 | |
| d2bmfa2 | 305 | c.37.1.14 (A:178-482) Dengue virus helicase {Dengu | 1e-16 | |
| d1oywa2 | 206 | c.37.1.19 (A:1-206) RecQ helicase domain {Escheric | 4e-16 | |
| d2p6ra3 | 202 | c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus | 1e-14 | |
| d1q0ua_ | 209 | c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR | 8e-14 | |
| d1wp9a1 | 200 | c.37.1.19 (A:1-200) putative ATP-dependent RNA hel | 2e-08 | |
| d1a1va1 | 136 | c.37.1.14 (A:190-325) HCV helicase domain {Human h | 7e-05 |
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 208 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Putative DEAD box RNA helicase species: Archaeon Methanococcus jannaschii [TaxId: 2190]
Score = 114 bits (286), Expect = 8e-33
Identities = 63/156 (40%), Positives = 99/156 (63%), Gaps = 4/156 (2%)
Query: 7 SFTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDE-DCIGCAKTGSGKTLAFALPIL 65
+F +L L+ ++ + G + PT+IQ +IP LNDE + + A+TGSGKT +FA+P++
Sbjct: 5 NFNELNLSDNILNAIRNKGFEKPTDIQMKVIPLFLNDEYNIVAQARTGSGKTASFAIPLI 64
Query: 66 QKWCEDPYGIFALVLTPTRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKELAKKP 125
+ + GI A++LTPTRELA Q+ D+ L NL+++ I GG + Q K L K
Sbjct: 65 ELVN-ENNGIEAIILTPTRELAIQVADEIESLKGNKNLKIAKIYGGKAIYPQIKAL-KNA 122
Query: 126 HIVIATPGRLADHLDTCNTFSLNRIKFLVLDEADRL 161
+IV+ TPGR+ DH++ T +L +K+ +LDEAD +
Sbjct: 123 NIVVGTPGRILDHINR-GTLNLKNVKYFILDEADEM 157
|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} Length = 218 | Back information, alignment and structure |
|---|
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} Length = 222 | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} Length = 238 | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} Length = 207 | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 237 | Back information, alignment and structure |
|---|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} Length = 206 | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 206 | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} Length = 305 | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} Length = 206 | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} Length = 209 | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} Length = 136 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 182 | |||
| d2j0sa1 | 222 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 100.0 | |
| d1veca_ | 206 | DEAD box RNA helicase rck/p54 {Human (Homo sapiens | 100.0 | |
| d2g9na1 | 218 | Initiation factor 4a {Human (Homo sapiens) [TaxId: | 100.0 | |
| d1qdea_ | 212 | Initiation factor 4a {Baker's yeast (Saccharomyces | 100.0 | |
| d1t6na_ | 207 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 100.0 | |
| d1wrba1 | 238 | putative ATP-dependent RNA helicase VlgB {Flatworm | 100.0 | |
| d1hv8a1 | 208 | Putative DEAD box RNA helicase {Archaeon Methanoco | 100.0 | |
| d1s2ma1 | 206 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 100.0 | |
| d1q0ua_ | 209 | Probable DEAD box RNA helicase YqfR {Bacillus stea | 99.97 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 99.94 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 99.94 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 99.93 | |
| d1oywa2 | 206 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 99.93 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 99.83 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 99.83 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 99.82 | |
| d1gm5a3 | 264 | RecG helicase domain {Thermotoga maritima [TaxId: | 99.82 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 99.73 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 99.7 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 99.65 | |
| d1z3ix2 | 298 | Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxI | 99.51 | |
| d1z63a1 | 230 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 99.41 | |
| d1tf5a3 | 273 | Translocation ATPase SecA, nucleotide-binding doma | 99.32 | |
| d1nkta3 | 288 | Translocation ATPase SecA, nucleotide-binding doma | 99.25 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 98.59 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 98.4 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 98.2 | |
| g1qhh.1 | 623 | DEXX box DNA helicase {Bacillus stearothermophilus | 97.97 | |
| d1a5ta2 | 207 | delta prime subunit of DNA polymerase III, N-domai | 97.81 | |
| d2eyqa5 | 211 | Transcription-repair coupling factor, TRCF {Escher | 97.4 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 97.34 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 97.27 | |
| d1sxje2 | 252 | Replication factor C5 {Baker's yeast (Saccharomyce | 97.26 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 97.23 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 97.19 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 97.19 | |
| d1c4oa2 | 174 | Nucleotide excision repair enzyme UvrB {Thermus th | 97.07 | |
| d1sxjb2 | 224 | Replication factor C4 {Baker's yeast (Saccharomyce | 97.05 | |
| d1iqpa2 | 231 | Replication factor C {Archaeon Pyrococcus furiosus | 97.02 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 97.0 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 96.88 | |
| d1t5la1 | 413 | Nucleotide excision repair enzyme UvrB {Bacillus c | 96.85 | |
| d1t5la2 | 181 | Nucleotide excision repair enzyme UvrB {Bacillus c | 96.81 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 96.66 | |
| d1fuka_ | 162 | Initiation factor 4a {Baker's yeast (Saccharomyces | 96.59 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 96.45 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 96.36 | |
| d1s2ma2 | 171 | Putative ATP-dependent RNA helicase DHH1 {Baker's | 96.33 | |
| d1t5ia_ | 168 | Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo | 96.17 | |
| d1w36b1 | 485 | Exodeoxyribonuclease V beta chain (RecB), N-termin | 96.17 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 96.12 | |
| d2rb4a1 | 168 | ATP-dependent RNA helicase DDX25 {Human (Homo sapi | 96.09 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.02 | |
| d1oywa3 | 200 | RecQ helicase domain {Escherichia coli [TaxId: 562 | 95.98 | |
| d1um8a_ | 364 | ClpX {Helicobacter pylori [TaxId: 210]} | 95.94 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 95.94 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 95.85 | |
| d2j0sa2 | 168 | Probable ATP-dependent RNA helicase DDX48 {Human ( | 95.76 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 95.74 | |
| d1fnna2 | 276 | CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T | 95.52 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 95.37 | |
| d1hv8a2 | 155 | Putative DEAD box RNA helicase {Archaeon Methanoco | 95.3 | |
| d1c4oa1 | 408 | Nucleotide excision repair enzyme UvrB {Thermus th | 95.21 | |
| d1ixsb2 | 239 | Holliday junction helicase RuvB {Thermus thermophi | 94.96 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 94.95 | |
| d1ixza_ | 247 | AAA domain of cell division protein FtsH {Thermus | 94.94 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.92 | |
| d1jbka_ | 195 | ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | 94.9 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 94.78 | |
| d1g41a_ | 443 | HslU {Haemophilus influenzae [TaxId: 727]} | 94.63 | |
| d1jr6a_ | 138 | HCV helicase domain {Human hepatitis C virus (HCV) | 94.55 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 94.54 | |
| d1yksa2 | 299 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 94.5 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 94.45 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 94.3 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 94.15 | |
| d1gm5a4 | 206 | RecG helicase domain {Thermotoga maritima [TaxId: | 94.13 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 94.0 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 93.96 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 93.92 | |
| d2fnaa2 | 283 | Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ | 93.89 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 93.88 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 93.84 | |
| d1r6bx2 | 268 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 93.67 | |
| d1svma_ | 362 | Papillomavirus large T antigen helicase domain {Si | 93.54 | |
| d1gvnb_ | 273 | Plasmid maintenance system epsilon/zeta, toxin zet | 93.42 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.18 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 93.14 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 93.12 | |
| d1d2na_ | 246 | Hexamerization domain of N-ethylmalemide-sensitive | 93.05 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 93.03 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 93.02 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 92.86 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 92.76 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 92.51 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 92.41 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 92.25 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 92.24 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 92.03 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 91.96 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 91.92 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 91.89 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 91.81 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 91.75 | |
| d1ny5a2 | 247 | Transcriptional activator sigm54 (NtrC1), C-termin | 91.63 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 91.6 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 91.39 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 91.34 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 91.29 | |
| d1v5wa_ | 258 | Meiotic recombination protein DMC1/LIM15 homolog { | 91.25 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 91.24 | |
| d1yj5a2 | 172 | 5' polynucleotide kinase-3' phosphatase, C-termina | 91.12 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 91.07 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 91.06 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 90.99 | |
| d1r7ra3 | 265 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 90.82 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 90.82 | |
| d1wp9a2 | 286 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 90.77 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 90.71 | |
| d1w5sa2 | 287 | CDC6-like protein APE0152, N-terminal domain {Aero | 90.41 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 90.11 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 90.07 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 90.03 | |
| d1g8pa_ | 333 | ATPase subunit of magnesium chelatase, BchI {Rhodo | 90.0 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 89.92 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 89.81 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 89.69 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 89.52 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 89.41 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 89.3 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 89.23 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 88.83 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 88.42 | |
| d1a1va2 | 299 | HCV helicase domain {Human hepatitis C virus (HCV) | 87.81 | |
| d1jj7a_ | 251 | Peptide transporter Tap1, C-terminal ABC domain {H | 87.62 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 87.46 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 87.34 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 87.23 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 87.15 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 86.66 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 86.46 | |
| d1r6bx3 | 315 | ClpA, an Hsp100 chaperone, AAA+ modules {Escherich | 86.42 | |
| d1d0xa2 | 712 | Myosin S1, motor domain {Dictyostelium discoideum | 86.4 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 86.32 | |
| d1uj2a_ | 213 | Uridine-cytidine kinase 2 {Human (Homo sapiens) [T | 86.22 | |
| d1c9ka_ | 180 | Adenosylcobinamide kinase/adenosylcobinamide phosp | 86.04 | |
| d1kkma_ | 176 | HPr kinase HprK C-terminal domain {Lactobacillus c | 85.89 | |
| d1z5za1 | 244 | Helicase of the SNF2/Rad54 hamily {Sulfolobus solf | 85.86 | |
| d1knxa2 | 177 | HPr kinase HprK C-terminal domain {Mycoplasma pneu | 85.81 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 85.67 | |
| d1lkxa_ | 684 | Myosin S1, motor domain {Dictyostelium discoideum, | 85.22 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 84.99 | |
| d2pmka1 | 241 | Haemolysin B ATP-binding protein {Escherichia coli | 84.89 | |
| d1q3ta_ | 223 | CMP kinase {Streptococcus pneumoniae [TaxId: 1313] | 84.75 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 84.45 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 84.22 | |
| d1ko7a2 | 169 | HPr kinase HprK C-terminal domain {Staphylococcus | 84.12 | |
| d1br2a2 | 710 | Myosin S1, motor domain {Chicken (Gallus gallus), | 83.82 | |
| d3b60a1 | 253 | Multidrug resistance ABC transporter MsbA, C-termi | 83.82 | |
| d1odfa_ | 286 | Hypothetical protein Ygr205W {Baker's yeast (Sacch | 83.72 | |
| d2hyda1 | 255 | Putative multidrug export ATP-binding/permease pro | 83.54 | |
| d1kk8a2 | 789 | Myosin S1, motor domain {Bay scallop (Aequipecten | 83.53 | |
| d1l2ta_ | 230 | MJ0796 {Archaeon Methanococcus jannaschii [TaxId: | 83.35 | |
| d1qvra3 | 315 | ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 | 83.33 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 83.33 | |
| d1w7ja2 | 730 | Myosin S1, motor domain {Chicken (Gallus gallus), | 83.31 | |
| d2p6ra4 | 201 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 83.03 | |
| d1mv5a_ | 242 | Multidrug resistance ABC transporter LmrA, C-termi | 82.79 | |
| d1r0wa_ | 281 | Cystic fibrosis transmembrane conductance regulato | 82.7 | |
| d1goja_ | 354 | Kinesin {Neurospora crassa [TaxId: 5141]} | 82.58 | |
| d1gkub2 | 248 | Helicase-like "domain" of reverse gyrase {Archaeon | 82.31 | |
| d2mysa2 | 794 | Myosin S1, motor domain {Chicken (Gallus gallus), | 82.23 | |
| d1sq5a_ | 308 | Pantothenate kinase PanK {Escherichia coli [TaxId: | 82.16 | |
| d2awna2 | 232 | Maltose transport protein MalK, N-terminal domain | 81.88 | |
| d1g2912 | 240 | Maltose transport protein MalK, N-terminal domain | 81.8 | |
| d2vp4a1 | 197 | Deoxyribonucleoside kinase {Fruit fly (Drosophila | 81.7 | |
| d1bg2a_ | 323 | Kinesin {Human (Homo sapiens) [TaxId: 9606]} | 81.66 | |
| d1ihua1 | 296 | Arsenite-translocating ATPase ArsA {Escherichia co | 80.91 | |
| d1uf9a_ | 191 | Dephospho-CoA kinase {Thermus thermophilus [TaxId: | 80.72 | |
| d3dhwc1 | 240 | Methionine import ATP-binding protein MetN {Escher | 80.68 | |
| d1v43a3 | 239 | Hypothetical protein PH0022, N-terminal domain {Py | 80.66 | |
| d1tuea_ | 205 | Replication protein E1 helicase domain {Human papi | 80.46 | |
| d3d31a2 | 229 | Sulfate/molybdate ABC transporter, ATP-binding pro | 80.14 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 80.03 |
| >d2j0sa1 c.37.1.19 (A:22-243) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Tandem AAA-ATPase domain domain: Probable ATP-dependent RNA helicase DDX48 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=8.3e-37 Score=222.04 Aligned_cols=175 Identities=32% Similarity=0.491 Sum_probs=159.6
Q ss_pred CccCCccCCCCCHHHHHHHHHCCCCCChHHHHhhhhhhhCCCcEEEECCCCChHHHHHHHHHHHhhccCCCCeeEEEEcC
Q psy4275 3 DPIKSFTDLKLNPWLIRQCQTIGVKTPTEIQKAIIPHVLNDEDCIGCAKTGSGKTLAFALPILQKWCEDPYGIFALVLTP 82 (182)
Q Consensus 3 ~~~~~~~~~~l~~~i~~~l~~~~~~~~~~~Q~~~~~~~~~~~~~li~~~tg~GKT~~~~~~~~~~~~~~~~~~~~lil~p 82 (182)
+...+|+++++++.+.+++.+.|+..|+|.|.+++|.+++|+|++++++||+|||.+|++++++.+.....+++++|++|
T Consensus 14 ~~~~sF~~l~L~~~l~~~L~~~g~~~pt~IQ~~aIp~il~g~dvi~~a~TGSGKTlayllPil~~l~~~~~~~~~lil~P 93 (222)
T d2j0sa1 14 DVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAP 93 (222)
T ss_dssp CCCCSGGGGCCCHHHHHHHHHHTCCSCCHHHHHHHHHHHTTCCEEEECCTTSSHHHHHHHHHHHTCCTTSCSCCEEEECS
T ss_pred CCCCCHHHCCCCHHHHHHHHHCCCCCCCHHHHHHHHHHHCCCCeEEEcCcchhhhhhhcccccccccccccCceeEEecc
Confidence 45678999999999999999999999999999999999999999999999999999999999999988877889999999
Q ss_pred CHHHHHHHHHHHHHhhccCCceEEEEEcCCchhhhhHHhcCCCcEEEEChHHHHHHHhcCCCCCCCCccEEEEecccccc
Q psy4275 83 TRELAYQIGDQFLVLGKVMNLRVSIITGGMDMVDQGKELAKKPHIVIATPGRLADHLDTCNTFSLNRIKFLVLDEADRLS 162 (182)
Q Consensus 83 ~~~l~~q~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Ilv~T~~~l~~~~~~~~~~~~~~~~~iI~DE~h~~~ 162 (182)
+++|+.|+++.++.+.+..++++..+.|+.........+..+++|+|+||+++.+++.. +...+++++++|+||||.|.
T Consensus 94 treLa~Qi~~~~~~l~~~~~i~~~~~~g~~~~~~~~~~l~~~~~Ilv~TPgrl~~~~~~-~~~~~~~l~~lVlDEaD~ll 172 (222)
T d2j0sa1 94 TRELAVQIQKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIRR-RSLRTRAIKMLVLDEADEML 172 (222)
T ss_dssp SHHHHHHHHHHHHHHTTTTTCCEEEECTTSCHHHHHHHHHHCCSEEEECHHHHHHHHHT-TSSCCTTCCEEEEETHHHHT
T ss_pred hHHHHHHHHHHHHHHhCccceeEEEEeecccchhhHHHhccCCeEEeCCCCcHHhcccc-cccccccceeeeecchhHhh
Confidence 99999999999999999999999999999988877777778899999999999999988 66789999999999999999
Q ss_pred ccCChhHHHHHHHHhhcCC
Q psy4275 163 LMTSLKFFFFFFFLKYYIP 181 (182)
Q Consensus 163 ~~~~~~~~~~~~~~~~~~~ 181 (182)
+.++... +..+.+.+|
T Consensus 173 ~~~f~~~---i~~I~~~l~ 188 (222)
T d2j0sa1 173 NKGFKEQ---IYDVYRYLP 188 (222)
T ss_dssp STTTHHH---HHHHHTTSC
T ss_pred hcCcHHH---HHHHHHhCC
Confidence 9987654 444455554
|
| >d1veca_ c.37.1.19 (A:) DEAD box RNA helicase rck/p54 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2g9na1 c.37.1.19 (A:21-238) Initiation factor 4a {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qdea_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t6na_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wrba1 c.37.1.19 (A:164-401) putative ATP-dependent RNA helicase VlgB {Flatworm (Dugesia japonica) [TaxId: 6161]} | Back information, alignment and structure |
|---|
| >d1hv8a1 c.37.1.19 (A:3-210) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1s2ma1 c.37.1.19 (A:46-251) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1q0ua_ c.37.1.19 (A:) Probable DEAD box RNA helicase YqfR {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1oywa2 c.37.1.19 (A:1-206) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1gm5a3 c.37.1.19 (A:286-549) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1z3ix2 c.37.1.19 (X:92-389) Rad54-like, Rad54L {Zebra fish (Danio rerio) [TaxId: 7955]} | Back information, alignment and structure |
|---|
| >d1z63a1 c.37.1.19 (A:432-661) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1tf5a3 c.37.1.19 (A:1-226,A:349-395) Translocation ATPase SecA, nucleotide-binding domains {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1a5ta2 c.37.1.20 (A:1-207) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2eyqa5 c.37.1.19 (A:779-989) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1c4oa2 c.37.1.19 (A:410-583) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1t5la1 c.37.1.19 (A:2-414) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1t5la2 c.37.1.19 (A:415-595) Nucleotide excision repair enzyme UvrB {Bacillus caldotenax [TaxId: 1395]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1fuka_ c.37.1.19 (A:) Initiation factor 4a {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s2ma2 c.37.1.19 (A:252-422) Putative ATP-dependent RNA helicase DHH1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1t5ia_ c.37.1.19 (A:) Spliceosome RNA helicase BAT1 (UAP56) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1oywa3 c.37.1.19 (A:207-406) RecQ helicase domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j0sa2 c.37.1.19 (A:244-411) Probable ATP-dependent RNA helicase DDX48 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hv8a2 c.37.1.19 (A:211-365) Putative DEAD box RNA helicase {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1c4oa1 c.37.1.19 (A:2-409) Nucleotide excision repair enzyme UvrB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1jr6a_ c.37.1.14 (A:) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1yksa2 c.37.1.14 (A:325-623) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1gm5a4 c.37.1.19 (A:550-755) RecG helicase domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} | Back information, alignment and structure |
|---|
| >d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ny5a2 c.37.1.20 (A:138-384) Transcriptional activator sigm54 (NtrC1), C-terminal domain {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1yj5a2 c.37.1.1 (A:351-522) 5' polynucleotide kinase-3' phosphatase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wp9a2 c.37.1.19 (A:201-486) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g8pa_ c.37.1.20 (A:) ATPase subunit of magnesium chelatase, BchI {Rhodobacter capsulatus [TaxId: 1061]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a1va2 c.37.1.14 (A:326-624) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1uj2a_ c.37.1.6 (A:) Uridine-cytidine kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1c9ka_ c.37.1.11 (A:) Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase CobU {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} | Back information, alignment and structure |
|---|
| >d1z5za1 c.37.1.19 (A:663-906) Helicase of the SNF2/Rad54 hamily {Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1q3ta_ c.37.1.1 (A:) CMP kinase {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} | Back information, alignment and structure |
|---|
| >d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1odfa_ c.37.1.6 (A:) Hypothetical protein Ygr205W {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} | Back information, alignment and structure |
|---|
| >d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} | Back information, alignment and structure |
|---|
| >d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2p6ra4 c.37.1.19 (A:203-403) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} | Back information, alignment and structure |
|---|
| >d1gkub2 c.37.1.16 (B:251-498) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} | Back information, alignment and structure |
|---|
| >d2vp4a1 c.37.1.1 (A:12-208) Deoxyribonucleoside kinase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihua1 c.37.1.10 (A:1-296) Arsenite-translocating ATPase ArsA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uf9a_ c.37.1.1 (A:) Dephospho-CoA kinase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} | Back information, alignment and structure |
|---|
| >d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|