Diaphorina citri psyllid: psy4278


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------
MKPPKSDLWFIDVKQLLQFQELDQLETDIFFKQLLPKIISLALRLPNVLQCGIPLLKAHSNHSITLSQLQIASLLANAFLCTYPRRNSNQPESQYANFPCINFSRLFQAQSSCVSEKLKCLINYFVRVTTKDPTGLVTYSRRYLPHSQLPHWGDSRRKLPDLFISSEGMIENQRGLLQVDFANKSHHLEIEDRRKTG
ccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccccccccccECcccccEEEEEHHHHHHHHHHHHHccccccccccccccccccccccccHHcccccHHHHHHHHHHHHHHHHHHccccccEEEEEEEEccccccccccccccccccEEEccccccccccccEEEEccccccccEEEcccccc
***PKSDLWFIDVKQLLQFQELDQLETDIFFKQLLPKIISLALRLPNVLQCGIPLLKAHSNHSITLSQLQIASLLANAFLCTYPRR*******QYANFPCINFSRLFQAQSSCVSEKLKCLINYFVRVTTKDPTGLVTYSRRYLPHSQLPHWGDSRRKLPDLFISSEGMIENQRGLLQVDFANKSHHLEIED*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKPPKSDLWFIDVKQLLQFQELDQLETDIFFKQLLPKIISLALRLPNVLQCGIPLLKAHSNHSITLSQLQIASLLANAFLCTYPRRNSNQPESQYANFPCINFSRLFQAQSSCVSEKLKCLINYFVRVTTKDPTGLVTYSRRYLPHSQLPHWGDSRRKLPDLFISSEGMIENQRGLLQVDFANKSHHLEIEDRRKTG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Poly(ADP-ribose) glycohydrolase Poly(ADP-ribose) synthesized after DNA damage is only present transiently and is rapidly degraded by poly(ADP-ribose) glycohydrolase. Poly(ADP-ribose) metabolism is required for maintenance of the normal function of neuronal cells.confidentO46043

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0060255 [BP]regulation of macromolecule metabolic processprobableGO:0008150, GO:0065007, GO:0050789, GO:0019222
GO:0005654 [CC]nucleoplasmprobableGO:0005575, GO:0043231, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422
GO:0008152 [BP]metabolic processprobableGO:0008150
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0000785 [CC]chromatinprobableGO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0043228, GO:0044424, GO:0044427, GO:0005694, GO:0043226, GO:0044422
GO:0003682 [MF]chromatin bindingprobableGO:0003674, GO:0005488
GO:0004649 [MF]poly(ADP-ribose) glycohydrolase activityprobableGO:0016787, GO:0003824, GO:0003674, GO:0016798, GO:0004553
GO:0019219 [BP]regulation of nucleobase-containing compound metabolic processprobableGO:0080090, GO:0019222, GO:0031323, GO:0050794, GO:0065007, GO:0051171, GO:0008150, GO:0050789

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UEK, chain A
Confidence level:very confident
Coverage over the Query: 2-195
View the alignment between query and template
View the model in PyMOL