Diaphorina citri psyllid: psy4303


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MGANNQGVKSRAPLTVDQMYEDVSQDYAKKTVTMESHPHLPGPPMASIHPCRHAEVMKKIIETVLEGGGELGVHMYLIIFLKFVQSVIPTIEYDFTQNFTVDQMYEDVSQDYAKKTVTMESHPHLPGPPMASIHPCRAIKSKASNQTQSCNKPNSTEEEDDDDEEALDMEDFEESGFLDEQDPSIANIPPEKQSPSSPAGDSQECGDIVRTRTYDLHITYDKYYQTPRLWLYGYNERFKGKENLVLISKWCNRMQSVINSVKGTALGVAEYLTPVLKESKFRETGVVTPEEFVAAGDHLVHHCPTWQWASGDESKAKSYLPPNKQFLITKNVPCPRRCKQIDYCEEKQKIIENEQDEEGWVDTHHYDETTGKDIAIEDKISEISLDASTGWVDTHHYDETTGKDIAIEDKISEISLDATT
cccccccccccccccHHHHHHccccccccccEEEcccccccccccCEEccccHHHHHHHHHHHHHHccccccccEEEEEEEEEEEEccccEEEcccccccHHHHHHHHHHccccccEEEccccccccccccCECccccccccccccccccccccccccccccccHccccHHHHHcccccccccccccccccccccccccccccccccccccEEEEEEEEECccccccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHccccEECcccCECccccccccccccccccEEEEEcccccHHHHcccccccccccccccccccccCEEcccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccc
*********SRAPLTVDQMYEDVSQDYAKKTVTMESHPHLPGPPMASIHPCRHAEVMKKIIETVLEGGGELGVHMYLIIFLKFVQSVIPTIEYDFTQNFTVDQMYEDVSQDYAKKTVTMESHPHLPGPPMASI***********************************MEDFEESGFLDEQDPS*********************GDIVRTRTYDLHITYDKYYQTPRLWLYGYNERFKGKENLVLISKWCNRMQSVINSVKGTALGVAEYLTPVLKESKFRETGVVTPEEFVAAGDHLVHHCPTWQWASGDES*AKSYLPPNKQFLITKNVPCPRRCKQIDYCEEKQKIIENEQDEEGWVDTHH************************************************I******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGANNQGVKSRAPLTVDQMYEDVSQDYAKKTVTMESHPHLPGPPMASIHPCRHAEVMKKIIETVLEGGGELGVHMYLIIFLKFVQSVIPTIEYDFTQNFTVDQMYEDVSQDYAKKTVTMESHPHLPGPPMASIHPCRAIKSKASNQTQSCNKPNSTEEEDDDDEEALDMEDFEESGFLDEQDPSIANIPPEKQSPSSPAGDSQECGDIVRTRTYDLHITYDKYYQTPRLWLYGYNERFKGKENLVLISKWCNRMQSVINSVKGTALGVAEYLTPVLKESKFRETGVVTPEEFVAAGDHLVHHCPTWQWASGDESKAKSYLPPNKQFLITKNVPCPRRCKQIDYCEEKQKIIENEQDEEGWVDTHHYDETTGKDIAIEDKISEISLDASTGWVDTHHYDETTGKDIAIEDKISEISLDATT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-like-conjugating enzyme ATG3 E2-like enzyme involved in autophagy and mitochondrial homeostasis. Catalyzes the conjugation of atg8-like proteins (gabarap, gabarapl1, gabarapl2 or map1lc3a) to phosphatidylethanolamine (PE). PE-conjugation to atg8-like proteins is essential for autophagy. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of atg12 to itself, atg12 conjugation to atg3 playing a role in mitochondrial homeostasis but not in autophagy.confidentQ5I0S6
Ubiquitin-like-conjugating enzyme ATG3 E2-like enzyme involved in autophagy and mitochondrial homeostasis. Catalyzes the conjugation of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A) to phosphatidylethanolamine (PE). PE-conjugation to ATG8-like proteins is essential for autophagy. Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3.confidentQ0VCL3
Ubiquitin-like-conjugating enzyme ATG3 E2-like enzyme involved in autophagy and mitochondrial homeostasis. Catalyzes the conjugation of ATG8-like proteins (GABARAP, GABARAPL1, GABARAPL2 or MAP1LC3A) to phosphatidylethanolamine (PE). PE-conjugation to ATG8-like proteins is essential for autophagy. Preferred substrate is MAP1LC3A. Also acts as an autocatalytic E2-like enzyme, catalyzing the conjugation of ATG12 to itself, ATG12 conjugation to ATG3 playing a role in mitochondrial homeostasis but not in autophagy. ATG7 (E1-like enzyme) facilitates this reaction by forming an E1-E2 complex with ATG3.confidentQ9CPX6

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0016567 [BP]protein ubiquitinationprobableGO:0071704, GO:0044267, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0070647, GO:0006464, GO:0043170, GO:0032446, GO:0043412, GO:0036211, GO:0008150, GO:0044237, GO:0008152
GO:0019777 [MF]Atg12 ligase activityprobableGO:0019787, GO:0016879, GO:0016881, GO:0003824, GO:0003674, GO:0016874
GO:0006914 [BP]autophagyprobableGO:0009987, GO:0044237, GO:0044248, GO:0008150, GO:0008152, GO:0009056

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2DYT, chain A
Confidence level:very confident
Coverage over the Query: 280-344
View the alignment between query and template
View the model in PyMOL
Template: 2DYT, chain A
Confidence level:very confident
Coverage over the Query: 2-96
View the alignment between query and template
View the model in PyMOL
Template: 4EBR, chain A
Confidence level:probable
Coverage over the Query: 210-240
View the alignment between query and template
View the model in PyMOL