Diaphorina citri psyllid: psy4310


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200---
MLQIGYLMLCHYLNFPLYCGICCMGDIEGLIDKVNELKLDDNEELIEKIKHGQFTLRDMYEQFQNIMKMGPFSQIMGMIPGFSQDFLSKGSEQESMARLKRLMTIMDSMNDGELDNRDGAKLFSKQTGRITRVAQGAGVTEKEVKDLISQYTKFAAVVKKMGGIKGLFKGGDITKNVNQTQMMKLNQQMAKMMDPRVLHQMGE
cccccccccccccccHHHHHHccccHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccHHHHHccccccccccccccccHHHHHHHHHHHHHHHcccHHHHccccccccccccccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccHHHHHHccc
*LQIGYLMLCHYLNFPLYCGICCMGDIEGLIDKVNELKLDDNEELIEKIKHGQFTLRDMYEQFQNIMKMGPFSQIMGMIPGFS*****************RLMTIMDSMNDGELDNRD*********GRITRVAQGAGVTEKEVKDLISQYTKFAAVVKKMGGI********************************VLHQ***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLQIGYLMLCHYLNFPLYCGICCMGDIEGLIDKVNELKLDDNEELIEKIKHGQFTLRDMYEQFQNIMKMGPFSQIMGMIPGFSQDFLSKGSEQESMARLKRLMTIMDSMNDGELDNRDGAKLFSKQTGRITRVAQGAGVTEKEVKDLISQYTKFAAVVKKMGGIKGLFKGGDITKNVNQTQMMKLNQQMAKMMDPRVLHQMGE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Signal recognition particle 54 kDa protein Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).confidentQ6AYB5
Signal recognition particle 54 kDa protein Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).confidentP14576
Signal recognition particle 54 kDa protein Binds to the signal sequence of presecretory protein when they emerge from the ribosomes and transfers them to TRAM (translocating chain-associating membrane protein).confidentQ2T9U1

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005786 [CC]signal recognition particle, endoplasmic reticulum targetingprobableGO:0005737, GO:0032991, GO:0044464, GO:0005623, GO:0030529, GO:0005575, GO:0044444, GO:0048500, GO:0044424, GO:0005622
GO:0042493 [BP]response to drugprobableGO:0042221, GO:0050896, GO:0008150
GO:0003924 [MF]GTPase activityprobableGO:0016787, GO:0016818, GO:0003824, GO:0017111, GO:0016817, GO:0016462, GO:0003674
GO:0006616 [BP]SRP-dependent cotranslational protein targeting to membrane, translocationprobableGO:0008104, GO:0006613, GO:0006612, GO:0006614, GO:0051641, GO:0044699, GO:0070972, GO:0071806, GO:0070727, GO:0006886, GO:0051179, GO:0065002, GO:0071702, GO:0033036, GO:0006810, GO:0072599, GO:0072594, GO:0034613, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0044763, GO:0051649, GO:0051234, GO:0055085, GO:0016482, GO:0046907, GO:0045047, GO:0015031, GO:0008150, GO:0009987
GO:0043021 [MF]ribonucleoprotein complex bindingprobableGO:0003674, GO:0005488
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0030942 [MF]endoplasmic reticulum signal peptide bindingprobableGO:0033218, GO:0003674, GO:0042277, GO:0005048, GO:0005488
GO:0019003 [MF]GDP bindingprobableGO:0043168, GO:0017076, GO:0019001, GO:0097159, GO:1901363, GO:1901265, GO:0043167, GO:0036094, GO:0032561, GO:0003674, GO:0032553, GO:0032549, GO:0032555, GO:0005488, GO:0000166, GO:0032550, GO:0001883, GO:0001882
GO:0008144 [MF]drug bindingprobableGO:0003674, GO:0005488
GO:0006184 [BP]GTP catabolic processprobableGO:0046434, GO:0009141, GO:0009143, GO:0009144, GO:0009146, GO:0009166, GO:0009164, GO:0006807, GO:0044237, GO:0072521, GO:0009203, GO:0072523, GO:0046130, GO:0009259, GO:1901360, GO:1901361, GO:0046700, GO:0006139, GO:1901575, GO:0006195, GO:0071704, GO:0042278, GO:1901069, GO:1901068, GO:0009199, GO:0006152, GO:0046483, GO:0044281, GO:0009207, GO:0009205, GO:0009987, GO:0046039, GO:0044238, GO:0009154, GO:0006725, GO:0044710, GO:0009150, GO:0009261, GO:0019637, GO:0009117, GO:0009116, GO:0008152, GO:0034655, GO:0009119, GO:0046128, GO:0009056, GO:0055086, GO:0042454, GO:0044248, GO:1901564, GO:0044270, GO:1901136, GO:1901135, GO:0034641, GO:0019693, GO:0006163, GO:1901657, GO:0006796, GO:1901292, GO:0006793, GO:0019439, GO:0008150, GO:0006753, GO:1901658, GO:1901565
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0008312 [MF]7S RNA bindingprobableGO:0097159, GO:0003674, GO:0005488, GO:0003676, GO:1901363, GO:0003723
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0006617 [BP]SRP-dependent cotranslational protein targeting to membrane, signal sequence recognitionprobableGO:0022607, GO:0070271, GO:0043933, GO:0006613, GO:0006612, GO:0006614, GO:0008104, GO:0034622, GO:0044699, GO:0070972, GO:0071822, GO:0070727, GO:0006886, GO:0016043, GO:0065003, GO:0071840, GO:0006810, GO:0071702, GO:0051641, GO:0034613, GO:0072599, GO:0072594, GO:0006461, GO:0006605, GO:0045184, GO:0033365, GO:0044765, GO:0008150, GO:0051649, GO:0051234, GO:0043623, GO:0051179, GO:0016482, GO:0033036, GO:0046907, GO:0045047, GO:0044085, GO:0015031, GO:0044763, GO:0009987
GO:0006412 [BP]translationprobableGO:0071704, GO:0044267, GO:0008152, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0009058, GO:0044237, GO:0043170, GO:0044249, GO:0010467, GO:0009059, GO:0008150, GO:0034645, GO:1901576

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2J37, chain W
Confidence level:very confident
Coverage over the Query: 5-202
View the alignment between query and template
View the model in PyMOL