Diaphorina citri psyllid: psy4325


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MSDVKAKSFLYQRIGLAVQRGNGLTVGICASKLHDLLHEAHAGSSSSFSSSFNDVDYEGIMPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKAKDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGGTSPKDELKIDLDSNFSHSHGKTAFS
cccccHHHHHHHHHccccccccccccccccccHHHHHHcccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccCEccHHHHHHHHccccccccccccccccEEEccccEEccccccccccccccccccccEEcccccccccccHHHHHccccccccccccccccccccccccHHHccccccccccccHHHHHHHHcccccccccEEEccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccc
******KSFLYQRIGLAVQRGNGLTVGICASKLHDLLHEA***********FNDVDYEGIMPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKAKDGNCLD*******************************************LDMRVVQVWFQN****************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDVKAKSFLYQRIGLAVQRGNGLTVGICASKLHDLLHEAHAGSSSSFSSSFNDVDYEGIMPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKAKDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGGTSPKDELKIDLDSNFSHSHGKTAFS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Homeobox protein ceh-14 Confers thermosensory function to neurons. Required for correct AFD-mediated thermotaxis.confidentP20271
LIM/homeobox protein Lhx3 Acts as a transcriptional activator. Binds to and activates the promoter of the alpha-glycoprotein gene, and synergistically enhances transcription from the prolactin promoter in cooperation with Pit-1.confidentQ9UBR4
LIM/homeobox protein Lhx3 (Fragment) Acts as a transcriptional activator. Binds to and activates the promoter of the alpha-glycoprotein gene, and synergistically enhances transcription from the prolactin promoter in cooperation with Pit-1.confidentO97581

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0043066 [BP]negative regulation of apoptotic processprobableGO:0043069, GO:0050794, GO:0008150, GO:0043067, GO:0065007, GO:0060548, GO:0048519, GO:0010941, GO:0042981, GO:0050789, GO:0048523
GO:0008045 [BP]motor neuron axon guidanceprobableGO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0021521 [BP]ventral spinal cord interneuron specificationprobableGO:0060573, GO:0021515, GO:0021514, GO:0021517, GO:0030154, GO:0021511, GO:0060579, GO:0021513, GO:0032501, GO:0007275, GO:0044699, GO:0007417, GO:0007389, GO:0048869, GO:0001708, GO:0008150, GO:0021953, GO:0032502, GO:0048665, GO:0048663, GO:0030182, GO:0009987, GO:0021510, GO:0060581, GO:0003002, GO:0048731, GO:0022008, GO:0048699, GO:0045165, GO:0009953, GO:0007399, GO:0044707, GO:0048856, GO:0044763
GO:0021526 [BP]medial motor column neuron differentiationprobableGO:0021515, GO:0021517, GO:0030154, GO:0021510, GO:0032501, GO:0007275, GO:0044699, GO:0007417, GO:0048869, GO:0021953, GO:0032502, GO:0021522, GO:0021523, GO:0030182, GO:0009987, GO:0008150, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0044763
GO:0021527 [BP]spinal cord association neuron differentiationprobableGO:0021515, GO:0021516, GO:0021510, GO:0007275, GO:0044699, GO:0007417, GO:0048869, GO:0021953, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0030154, GO:0044763
GO:0005667 [CC]transcription factor complexprobableGO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0001890 [BP]placenta developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0021549 [BP]cerebellum developmentprobableGO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0022037, GO:0044767, GO:0048513, GO:0008150, GO:0030902, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0000977 [MF]RNA polymerase II regulatory region sequence-specific DNA bindingprobableGO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0008284 [BP]positive regulation of cell proliferationprobableGO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0006366 [BP]transcription from RNA polymerase II promoterprobableGO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0051239 [BP]regulation of multicellular organismal processprobableGO:0008150, GO:0065007, GO:0050789
GO:0009887 [BP]organ morphogenesisprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0009653, GO:0007275, GO:0044699
GO:0005515 [MF]protein bindingprobableGO:0003674, GO:0005488
GO:0040040 [BP]thermosensory behaviorprobableGO:0009628, GO:0044702, GO:0044704, GO:0019098, GO:0044708, GO:0050896, GO:0007610, GO:0022414, GO:0008150, GO:0009266, GO:0044699, GO:0000003
GO:0007267 [BP]cell-cell signalingprobableGO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699
GO:0003700 [MF]sequence-specific DNA binding transcription factor activityprobableGO:0003674, GO:0001071
GO:0065009 [BP]regulation of molecular functionprobableGO:0008150, GO:0065007
GO:0048839 [BP]inner ear developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0043583, GO:0048731, GO:0007275, GO:0044699
GO:0021983 [BP]pituitary gland developmentprobableGO:0032502, GO:0021536, GO:0032501, GO:0007420, GO:0044707, GO:0048856, GO:0007399, GO:0044767, GO:0035270, GO:0048513, GO:0030900, GO:0008150, GO:0048731, GO:0048732, GO:0007275, GO:0044699, GO:0007417
GO:0001076 [MF]RNA polymerase II transcription factor binding transcription factor activityprobableGO:0003674, GO:0000989, GO:0000988
GO:0003714 [MF]transcription corepressor activityprobableGO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0021520 [BP]spinal cord motor neuron cell fate specificationprobableGO:0021515, GO:0021517, GO:0030154, GO:0021510, GO:0032501, GO:0007275, GO:0044699, GO:0007417, GO:0048869, GO:0001708, GO:0008150, GO:0021953, GO:0032502, GO:0021522, GO:0048665, GO:0048663, GO:0030182, GO:0009987, GO:0044763, GO:0022008, GO:0048699, GO:0045165, GO:0044707, GO:0007399, GO:0048856, GO:0048731
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045892 [BP]negative regulation of transcription, DNA-dependentprobableGO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0045944 [BP]positive regulation of transcription from RNA polymerase II promoterprobableGO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0008270 [MF]zinc ion bindingprobableGO:0043169, GO:0046914, GO:0043167, GO:0003674, GO:0005488, GO:0046872
GO:0016048 [BP]detection of temperature stimulusprobableGO:0009581, GO:0009582, GO:0051606, GO:0009605, GO:0009628, GO:0050896, GO:0008150, GO:0009266

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JTN, chain A
Confidence level:very confident
Coverage over the Query: 67-191
View the alignment between query and template
View the model in PyMOL
Template: 2RGT, chain A
Confidence level:very confident
Coverage over the Query: 71-192,207-231
View the alignment between query and template
View the model in PyMOL
Template: 2XJY, chain A
Confidence level:very confident
Coverage over the Query: 17-130
View the alignment between query and template
View the model in PyMOL
Template: 1B72, chain A
Confidence level:very confident
Coverage over the Query: 207-265
View the alignment between query and template
View the model in PyMOL