Psyllid ID: psy4325

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MSDVKAKSFLYQRIGLAVQRGNGLTVGICASKLHDLLHEAHAGSSSSFSSSFNDVDYEGIMPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKAKDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGGTSPKDELKIDLDSNFSHSHGKTAFS
cccccHHHHHHHHHccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccccccEEccHHHHHHHHccccccccccccccccEEEccccEEccccccccccccccccccccEEcccccccccccHHHHHHcccccccccccccccccccccccHHHccccccccccccHHHHHHHHcccccccccEEEccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccc
ccccccccccccccccEEEccccEEEEEccccHHHHHccccHcccccccccccccccccccccccccccccccccccccccccEEEEEcccHHHHHHHHHHHHHHHccccEEEccccEEEHHHHHHHHcccHHHccccccHHHHHHHHHccEEEEEEEEHHHHHcccccccEEEEEEccEEEEcccHHHHccccccccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHcEcHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccc
MSDVKAKSFLYQRIGLAvqrgngltvGICASKLHDLLheahagssssfsssfndvdyegimpvympiasipkcggcgdlILDRFILKVLERTWHARclkchecgaplaekcfarngllfcKEDFFKrfgtkcagcemgipptqVVRRAQDLVYHLNCFACVMCArqlntgdefylmedrklvckpdyeaakakdgncldgdqpnkrprttITAKQLETLKMAyntspkparHVREQlsqdtgldMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRsmkggtspkdelkidldsnfshshgktafs
MSDVKAKSFLYQRIGLAVQRGNGLTVGICASKLHDLLHEAHagssssfsssFNDVDYEGIMPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAakakdgncldgdqpnkrprttITAKQLETLKMayntspkparhVREQlsqdtgldmrVVQVWfqnrrakekrlkkdagrtrwsqyfrsmkggtspkdelkidldsnfshshgktafs
MSDVKAKSFLYQRIGLAVQRGNGLTVGICASKLHDLLHEAHAGssssfsssfNDVDYEGIMPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKAKDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGGTSPKDELKIDLDSNFSHSHGKTAFS
*******SFLYQRIGLAVQRGNGLTVGICASKLHDLLHEA***********FNDVDYEGIMPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYE******************************************************LDMRVVQVWFQN****************************************************
******K*******************************************************************GCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKAKDGNCLD**********************************************RVVQVWFQN****************************************************
MSDVKAKSFLYQRIGLAVQRGNGLTVGICASKLHDLLHEA*********SSFNDVDYEGIMPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKAKDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPKPARHVREQLSQDTGLDMRVVQVWFQNRRA**********RTRWSQYFRSMKGGTSPKDELKIDLDSNFS*********
*****AKSFLYQRIGLAVQRGNGLTVGICASKLHDLLHEAHAGSSSSFSSSFNDVDYEGIMPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKA*************RPRTTITAKQLETLKMAYNTSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRL********************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSDVKAKSFLYQRIGLAVQRGNGLTVGICASKLHDLLHEAHAGSSSSFSSSFNDVDYEGIMPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKAKDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGGTSPKDELKIDLDSNFSHSHGKTAFS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
Q9UBR4 397 LIM/homeobox protein Lhx3 yes N/A 0.722 0.556 0.708 4e-93
O97581 383 LIM/homeobox protein Lhx3 yes N/A 0.702 0.561 0.723 1e-92
P50481 400 LIM/homeobox protein Lhx3 no N/A 0.722 0.552 0.704 2e-92
P53412 395 LIM/homeobox protein Lhx3 yes N/A 0.705 0.546 0.721 5e-92
Q90421 398 LIM/homeobox protein Lhx3 no N/A 0.715 0.550 0.703 1e-91
P36200 395 LIM/homeobox protein Lhx3 N/A N/A 0.689 0.534 0.717 2e-91
P53776 390 LIM/homeobox protein Lhx4 no N/A 0.715 0.561 0.685 4e-90
Q969G2 390 LIM/homeobox protein Lhx4 no N/A 0.689 0.541 0.706 4e-90
Q25132 692 LIM/homeobox protein Lhx3 N/A N/A 0.699 0.309 0.654 3e-84
P20271351 Homeobox protein ceh-14 O yes N/A 0.702 0.612 0.576 2e-67
>sp|Q9UBR4|LHX3_HUMAN LIM/homeobox protein Lhx3 OS=Homo sapiens GN=LHX3 PE=1 SV=2 Back     alignment and function desciption
 Score =  341 bits (875), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 163/230 (70%), Positives = 184/230 (80%), Gaps = 9/230 (3%)

Query: 70  IPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFG 129
           IP C GC   ILDRFILK L+R WH++CLKC +C  PLAE+CF+R   ++CK+DFFKRFG
Sbjct: 28  IPLCAGCDQHILDRFILKALDRHWHSKCLKCSDCHTPLAERCFSRGESVYCKDDFFKRFG 87

Query: 130 TKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEA 189
           TKCA C++GIPPTQVVRRAQD VYHL+CFACV+C RQL TGDEFYLMED +LVCK DYE 
Sbjct: 88  TKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYET 147

Query: 190 AKAKDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPKPARHVREQLSQDTGLDMRVVQ 249
           AK ++          KRPRTTITAKQLETLK AYNTSPKPARHVREQLS +TGLDMRVVQ
Sbjct: 148 AKQREAEAT-----AKRPRTTITAKQLETLKSAYNTSPKPARHVREQLSSETGLDMRVVQ 202

Query: 250 VWFQNRRAKEKRLKKDAGRTRWSQYFRSMK----GGTSPKDELKIDLDSN 295
           VWFQNRRAKEKRLKKDAGR RW QYFR+MK    G  S KD ++   DS+
Sbjct: 203 VWFQNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSD 252
Acts as a transcriptional activator. Binds to and activates the promoter of the alpha-glycoprotein gene, and synergistically enhances transcription from the prolactin promoter in cooperation with Pit-1.
Homo sapiens (taxid: 9606)
>sp|O97581|LHX3_PIG LIM/homeobox protein Lhx3 (Fragment) OS=Sus scrofa GN=LHX3 PE=2 SV=1 Back     alignment and function description
>sp|P50481|LHX3_MOUSE LIM/homeobox protein Lhx3 OS=Mus musculus GN=Lhx3 PE=1 SV=1 Back     alignment and function description
>sp|P53412|LHX3_CHICK LIM/homeobox protein Lhx3 OS=Gallus gallus GN=LHX3 PE=2 SV=1 Back     alignment and function description
>sp|Q90421|LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio GN=lhx3 PE=2 SV=1 Back     alignment and function description
>sp|P36200|LHX3_XENLA LIM/homeobox protein Lhx3 OS=Xenopus laevis GN=lhx3 PE=1 SV=1 Back     alignment and function description
>sp|P53776|LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus GN=Lhx4 PE=1 SV=4 Back     alignment and function description
>sp|Q969G2|LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens GN=LHX4 PE=1 SV=2 Back     alignment and function description
>sp|Q25132|LHX3_HALRO LIM/homeobox protein Lhx3 OS=Halocynthia roretzi GN=LHX3 PE=2 SV=2 Back     alignment and function description
>sp|P20271|HM14_CAEEL Homeobox protein ceh-14 OS=Caenorhabditis elegans GN=ceh-14 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
328708425375 PREDICTED: LIM/homeobox protein Lhx3-lik 0.781 0.637 0.860 1e-120
189237525 448 PREDICTED: similar to lim homeobox prote 0.754 0.515 0.836 1e-115
270007707 415 hypothetical protein TcasGA2_TC014400 [T 0.754 0.556 0.836 1e-115
242011200366 LIM/homeobox protein Lhx4, putative [Ped 0.813 0.680 0.796 1e-114
307200797 421 LIM/homeobox protein Lhx3 [Harpegnathos 0.777 0.565 0.760 1e-111
383858395 463 PREDICTED: LIM/homeobox protein Lhx3-lik 0.777 0.514 0.760 1e-110
195164566 490 GL21131 [Drosophila persimilis] gi|19410 0.748 0.467 0.814 1e-110
195398039 545 GJ17996 [Drosophila virilis] gi|19414128 0.748 0.420 0.818 1e-110
198473411 491 GA10505 [Drosophila pseudoobscura pseudo 0.748 0.466 0.814 1e-110
225581041 499 GA10505 [Drosophila miranda] 0.748 0.458 0.814 1e-110
>gi|328708425|ref|XP_001944208.2| PREDICTED: LIM/homeobox protein Lhx3-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  436 bits (1121), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 209/243 (86%), Positives = 228/243 (93%), Gaps = 4/243 (1%)

Query: 61  MPVYMPIASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFC 120
           +PV + +ASIPKCGGC +LILDRFILKVLERTWHARCLKC+ECGA LA+KCFARNG+LFC
Sbjct: 34  IPVKL-LASIPKCGGCQELILDRFILKVLERTWHARCLKCNECGATLADKCFARNGMLFC 92

Query: 121 KEDFFKRFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRK 180
           K+DFFKR+GTKCAGC++GIPPTQ+VRRAQDLVYHL CFACVMC R LNTGDEFYLMEDRK
Sbjct: 93  KDDFFKRYGTKCAGCDLGIPPTQIVRRAQDLVYHLQCFACVMCGRTLNTGDEFYLMEDRK 152

Query: 181 LVCKPDYEAAKAKDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPKPARHVREQLSQD 240
           LVCKPDYEAAK K+G CLDGDQPNKRPRTTITAKQLETLKMAYN SPKPARHVREQLSQD
Sbjct: 153 LVCKPDYEAAKTKEGGCLDGDQPNKRPRTTITAKQLETLKMAYNNSPKPARHVREQLSQD 212

Query: 241 TGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGGTSPKD---ELKIDLDSNFS 297
           TGLDMRVVQVWFQNRRAKEKRLKKDAGR+RWSQYFR+MKG  SP++   +LK+DLDSNFS
Sbjct: 213 TGLDMRVVQVWFQNRRAKEKRLKKDAGRSRWSQYFRTMKGSISPRNDKDDLKVDLDSNFS 272

Query: 298 HSH 300
           HSH
Sbjct: 273 HSH 275

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|189237525|ref|XP_973330.2| PREDICTED: similar to lim homeobox protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270007707|gb|EFA04155.1| hypothetical protein TcasGA2_TC014400 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|242011200|ref|XP_002426343.1| LIM/homeobox protein Lhx4, putative [Pediculus humanus corporis] gi|212510420|gb|EEB13605.1| LIM/homeobox protein Lhx4, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|307200797|gb|EFN80850.1| LIM/homeobox protein Lhx3 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383858395|ref|XP_003704687.1| PREDICTED: LIM/homeobox protein Lhx3-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|195164566|ref|XP_002023117.1| GL21131 [Drosophila persimilis] gi|194105202|gb|EDW27245.1| GL21131 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|195398039|ref|XP_002057632.1| GJ17996 [Drosophila virilis] gi|194141286|gb|EDW57705.1| GJ17996 [Drosophila virilis] Back     alignment and taxonomy information
>gi|198473411|ref|XP_001356286.2| GA10505 [Drosophila pseudoobscura pseudoobscura] gi|198139444|gb|EAL33349.2| GA10505 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|225581041|gb|ACN94618.1| GA10505 [Drosophila miranda] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
FB|FBgn0002023 523 Lim3 "Lim3" [Drosophila melano 0.748 0.437 0.804 7.7e-103
UNIPROTKB|Q9UBR4 397 LHX3 "LIM/homeobox protein Lhx 0.722 0.556 0.713 1.8e-87
UNIPROTKB|Q2TEA4 403 Lhx3 "LIM homeodomain 3 protei 0.702 0.533 0.727 2.3e-87
UNIPROTKB|O97581 383 LHX3 "LIM/homeobox protein Lhx 0.741 0.592 0.700 2.3e-87
MGI|MGI:102673 400 Lhx3 "LIM homeobox protein 3" 0.722 0.552 0.708 4.7e-87
UNIPROTKB|G3V8E3 400 Lhx3 "Protein Lhx3" [Rattus no 0.722 0.552 0.708 4.7e-87
UNIPROTKB|G3V9E7 402 Lhx3 "RCG45383, isoform CRA_b" 0.722 0.549 0.708 4.7e-87
ZFIN|ZDB-GENE-060728-1 391 lhx4 "LIM homeobox 4" [Danio r 0.751 0.588 0.684 6e-87
UNIPROTKB|P53412 395 LHX3 "LIM/homeobox protein Lhx 0.696 0.539 0.727 4.3e-86
ZFIN|ZDB-GENE-980526-131 398 lhx3 "LIM homeobox 3" [Danio r 0.715 0.550 0.703 5.4e-86
FB|FBgn0002023 Lim3 "Lim3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1019 (363.8 bits), Expect = 7.7e-103, P = 7.7e-103
 Identities = 197/245 (80%), Positives = 209/245 (85%)

Query:    68 ASIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFK- 126
             A+IPKCGGC +LILDRFILKVLERTWHA+CL+C EC   L +KCFARNG LFCKEDFFK 
Sbjct:   117 ATIPKCGGCHELILDRFILKVLERTWHAKCLQCSECHGQLNDKCFARNGQLFCKEDFFKS 176

Query:   127 --RFGTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCK 184
               R+GTKC+ C+MGIPPTQVVRRAQD VYHL CF C MC+R LNTGDEFYLMEDRKL+CK
Sbjct:   177 NRRYGTKCSACDMGIPPTQVVRRAQDNVYHLQCFLCAMCSRTLNTGDEFYLMEDRKLICK 236

Query:   185 PDYEAAKAK----DGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPKPARHVREQLSQD 240
              DYE AKAK    DG+ LDGDQPNKRPRTTITAKQLETLK AYN SPKPARHVREQLSQD
Sbjct:   237 RDYEEAKAKGLYLDGS-LDGDQPNKRPRTTITAKQLETLKTAYNNSPKPARHVREQLSQD 295

Query:   241 TGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGGTSP-------KDELKIDLD 293
             TGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKG  SP       KDELK+D D
Sbjct:   296 TGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGNCSPRTDKFLDKDELKVDYD 355

Query:   294 SNFSH 298
             S FSH
Sbjct:   356 S-FSH 359
GO:0005634 "nucleus" evidence=ISS;NAS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS;NAS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0007399 "nervous system development" evidence=TAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0043565 "sequence-specific DNA binding" evidence=IEA
GO:0008045 "motor neuron axon guidance" evidence=IMP
UNIPROTKB|Q9UBR4 LHX3 "LIM/homeobox protein Lhx3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q2TEA4 Lhx3 "LIM homeodomain 3 protein b isoform" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|O97581 LHX3 "LIM/homeobox protein Lhx3" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:102673 Lhx3 "LIM homeobox protein 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|G3V8E3 Lhx3 "Protein Lhx3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V9E7 Lhx3 "RCG45383, isoform CRA_b" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060728-1 lhx4 "LIM homeobox 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|P53412 LHX3 "LIM/homeobox protein Lhx3" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-980526-131 lhx3 "LIM homeobox 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P20271HM14_CAEELNo assigned EC number0.57600.70260.6125yesN/A
Q9UBR4LHX3_HUMANNo assigned EC number0.70860.72220.5566yesN/A
P53412LHX3_CHICKNo assigned EC number0.72190.70580.5468yesN/A
O97581LHX3_PIGNo assigned EC number0.72320.70260.5613yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
cd0937656 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of 7e-36
cd0947257 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3 9e-29
cd0947356 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 4e-28
cd0936852 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of L 2e-27
cd0946656 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a 3e-23
pfam0004657 pfam00046, Homeobox, Homeobox domain 3e-23
cd0937556 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of 4e-23
cd0946755 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b 2e-20
cd0936752 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L 3e-20
cd0946852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 9e-20
cd0008659 cd00086, homeodomain, Homeodomain; DNA binding dom 1e-19
smart0038957 smart00389, HOX, Homeodomain 2e-19
cd0937955 cd09379, LIM2_AWH, The second LIM domain of Arrowh 4e-17
cd0936954 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L 4e-17
cd0937153 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b 4e-16
cd0938655 cd09386, LIM1_LMO4, The first LIM domain of LMO4 ( 4e-16
cd0937855 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain o 3e-15
cd0936655 cd09366, LIM1_Isl, The first LIM domain of Isl, a 1e-14
cd0937759 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of 2e-14
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 3e-14
cd0937354 cd09373, LIM1_AWH, The first LIM domain of Arrowhe 8e-14
pfam0041258 pfam00412, LIM, LIM domain 9e-14
pfam0041258 pfam00412, LIM, LIM domain 1e-13
cd0937052 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a 3e-13
cd0947459 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 3e-12
cd0937455 cd09374, LIM2_Isl, The second LIM domain of Isl, a 4e-12
cd0938755 cd09387, LIM2_LMO4, The second LIM domain of LMO4 5e-12
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 1e-11
cd0947054 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 1e-11
cd0947155 cd09471, LIM2_Isl2, The second LIM domain of Isl2 2e-11
cd0946964 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 3e-11
COG5576156 COG5576, COG5576, Homeodomain-containing transcrip 3e-11
cd0939055 cd09390, LIM2_dLMO, The second LIM domain of dLMO 6e-11
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 7e-11
cd0946274 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 7e-11
cd0938355 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of 9e-11
cd0947559 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 1e-10
cd0938955 cd09389, LIM2_LMO1_LMO3, The second LIM domain of 2e-10
cd0932952 cd09329, LIM3_abLIM, The third LIM domain of actin 2e-10
cd0946353 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 4e-10
cd0938255 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 9e-10
smart0013254 smart00132, LIM, Zinc-binding domain present in Li 1e-09
cd0836853 cd08368, LIM, LIM is a small protein-protein inter 2e-09
cd0938054 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 2e-09
cd0938855 cd09388, LIM1_LMO1_LMO3, The first LIM domain of L 4e-09
cd0938156 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of L 1e-08
cd0938556 cd09385, LIM2_LMO2, The second LIM domain of LMO2 2e-07
cd0938456 cd09384, LIM1_LMO2, The first LIM domain of LMO2 ( 7e-07
cd0933252 cd09332, LIM2_PINCH, The second LIM domain of prot 1e-06
cd0937253 cd09372, LIM2_FBLP-1, The second LIM domain of the 7e-06
cd0939157 cd09391, LIM1_Lrg1p_like, The first LIM domain of 7e-06
cd0933752 cd09337, LIM2_Paxillin_like, The second LIM domain 1e-05
cd0933853 cd09338, LIM3_Paxillin_like, The third LIM domain 2e-05
cd0933653 cd09336, LIM1_Paxillin_like, The first LIM domain 3e-05
cd0934987 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin 6e-05
cd0939653 cd09396, LIM_DA1, The Lim domain of DA1 1e-04
cd0946559 cd09465, LIM2_LIMK2, The second LIM domain of LIMK 1e-04
cd0936453 cd09364, LIM1_LIMK, The first LIM domain of LIMK ( 2e-04
cd0940153 cd09401, LIM_TLP_like, The LIM domains of thymus L 2e-04
cd0941053 cd09410, LIM3_Leupaxin, The third LIM domain of Le 2e-04
cd0940953 cd09409, LIM3_Paxillin, The third LIM domain of pa 3e-04
cd0937253 cd09372, LIM2_FBLP-1, The second LIM domain of the 4e-04
cd0940655 cd09406, LIM1_Leupaxin, The first LIM domain of Le 4e-04
cd0946353 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 5e-04
cd0946455 cd09464, LIM2_LIMK1, The second LIM domain of LIMK 5e-04
cd0933159 cd09331, LIM1_PINCH, The first LIM domain of prote 5e-04
cd0933454 cd09334, LIM4_PINCH, The fourth LIM domain of prot 5e-04
cd0932752 cd09327, LIM1_abLIM, The first LIM domain of actin 6e-04
cd0940752 cd09407, LIM2_Paxillin, The second LIM domain of p 0.001
cd0935254 cd09352, LIM1_Ajuba_like, The first LIM domain of 0.001
cd0934359 cd09343, LIM1_FHL, The first LIM domain of Four an 0.001
cd0935154 cd09351, LIM1_LPP, The first LIM domain of lipoma 0.002
cd0935763 cd09357, LIM3_Zyxin_like, The third LIM domain of 0.002
cd0935054 cd09350, LIM1_TRIP6, The first LIM domain of Thyro 0.002
cd0945752 cd09457, LIM2_ENH, The second LIM domain of the En 0.002
cd0939455 cd09394, LIM1_Rga, The first LIM domain of Rga GTP 0.003
cd0934156 cd09341, LIM2_Testin_like, The second LIM domain o 0.004
>gnl|CDD|188762 cd09376, LIM2_Lhx3_Lhx4, The second LIM domain of Lhx3-Lhx4 family Back     alignment and domain information 
 Score =  122 bits (309), Expect = 7e-36
 Identities = 46/56 (82%), Positives = 48/56 (85%)

Query: 132 CAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDY 187
           CAGC+ GIPPTQVVRRAQD VYHL CFAC MC RQL TGDEFYLMED +LVCK DY
Sbjct: 1   CAGCDEGIPPTQVVRRAQDNVYHLECFACFMCKRQLETGDEFYLMEDDRLVCKKDY 56

The second LIM domain of Lhx3-Lhx4 family: Lhx3 and Lhx4 belong to the LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Members of LHX family are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs, such as the pituitary gland and the pancreas. The LHX3 and LHX4 LIM-homeodomain transcription factors play essential roles in pituitary gland and nervous system development. Although LHX3 and LHX4 share marked sequence homology, the genes have different expression patterns. They play overlapping, but distinct functions during the establishment of the specialized cells of the mammalian pituitary gland and the nervous system. Lhx3 proteins have been demonstrated the ability to directly bind to the promoters/enhancers of several pituitary hormone gene promoters to cause increased transcription.Lhx3a and Lhx3b, whose mRNAs have distinct temporal expression profiles during development, are two isoforms of Lhx3. LHX4 plays essential roles in pituitary gland and nervous system development. In mice, the lhx4 gene is expressed in the developing hindbrain, cerebral cortex, pituitary gland, and spinal cord. LHX4 shows significant sequence similarity to LHX3, particularly to isoforms Lhx3a. In gene regulation experiments, the LHX4 protein exhibits regulation roles towards pituitary genes, acting on their promoters/enhancers. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 56
>gnl|CDD|188856 cd09472, LIM2_Lhx3b, The second LIM domain of Lhx3b Back     alignment and domain information
>gnl|CDD|188857 cd09473, LIM2_Lhx4, The second LIM domain of Lhx4 Back     alignment and domain information
>gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4 family Back     alignment and domain information
>gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a Back     alignment and domain information
>gnl|CDD|200956 pfam00046, Homeobox, Homeobox domain Back     alignment and domain information
>gnl|CDD|188761 cd09375, LIM2_Lhx1_Lhx5, The second LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b Back     alignment and domain information
>gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 Back     alignment and domain information
>gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 Back     alignment and domain information
>gnl|CDD|238039 cd00086, homeodomain, Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>gnl|CDD|197696 smart00389, HOX, Homeodomain Back     alignment and domain information
>gnl|CDD|188765 cd09379, LIM2_AWH, The second LIM domain of Arrowhead (AWH) Back     alignment and domain information
>gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b Back     alignment and domain information
>gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188764 cd09378, LIM2_Lmx1a_Lmx1b, The second LIM domain of Lmx1a and Lmx1b Back     alignment and domain information
>gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family Back     alignment and domain information
>gnl|CDD|188763 cd09377, LIM2_Lhx2_Lhx9, The second LIM domain of Lhx2 and Lhx9 family Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH) Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|215907 pfam00412, LIM, LIM domain Back     alignment and domain information
>gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a Back     alignment and domain information
>gnl|CDD|188858 cd09474, LIM2_Lhx2, The second LIM domain of Lhx2 Back     alignment and domain information
>gnl|CDD|188760 cd09374, LIM2_Isl, The second LIM domain of Isl, a member of LHX protein family Back     alignment and domain information
>gnl|CDD|188773 cd09387, LIM2_LMO4, The second LIM domain of LMO4 (LIM domain only protein 4) Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|188855 cd09471, LIM2_Isl2, The second LIM domain of Isl2 Back     alignment and domain information
>gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 Back     alignment and domain information
>gnl|CDD|227863 COG5576, COG5576, Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>gnl|CDD|188776 cd09390, LIM2_dLMO, The second LIM domain of dLMO (Beaderx) Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188769 cd09383, LIM2_Lhx7_Lhx8, The second LIM domain of Lhx7 and Lhx8 Back     alignment and domain information
>gnl|CDD|188859 cd09475, LIM2_Lhx9, The second LIM domain of Lhx9 Back     alignment and domain information
>gnl|CDD|188775 cd09389, LIM2_LMO1_LMO3, The second LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) Back     alignment and domain information
>gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) Back     alignment and domain information
>gnl|CDD|188768 cd09382, LIM2_Lhx6, The second LIM domain of Lhx6 Back     alignment and domain information
>gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers Back     alignment and domain information
>gnl|CDD|188766 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 Back     alignment and domain information
>gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) Back     alignment and domain information
>gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8 Back     alignment and domain information
>gnl|CDD|188771 cd09385, LIM2_LMO2, The second LIM domain of LMO2 (LIM domain only protein 2) Back     alignment and domain information
>gnl|CDD|188770 cd09384, LIM1_LMO2, The first LIM domain of LMO2 (LIM domain only protein 2) Back     alignment and domain information
>gnl|CDD|188718 cd09332, LIM2_PINCH, The second LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) Back     alignment and domain information
>gnl|CDD|188777 cd09391, LIM1_Lrg1p_like, The first LIM domain of Lrg1p, a LIM and RhoGap domain containing protein Back     alignment and domain information
>gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family Back     alignment and domain information
>gnl|CDD|188735 cd09349, LIM1_Zyxin, The first LIM domain of Zyxin Back     alignment and domain information
>gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 Back     alignment and domain information
>gnl|CDD|188849 cd09465, LIM2_LIMK2, The second LIM domain of LIMK2 (LIM domain Kinase 2) Back     alignment and domain information
>gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) Back     alignment and domain information
>gnl|CDD|188785 cd09401, LIM_TLP_like, The LIM domains of thymus LIM protein (TLP) Back     alignment and domain information
>gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188758 cd09372, LIM2_FBLP-1, The second LIM domain of the filamin-binding LIM protein-1 (FBLP-1) Back     alignment and domain information
>gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin Back     alignment and domain information
>gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) Back     alignment and domain information
>gnl|CDD|188848 cd09464, LIM2_LIMK1, The second LIM domain of LIMK1 (LIM domain Kinase 1) Back     alignment and domain information
>gnl|CDD|188717 cd09331, LIM1_PINCH, The first LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH Back     alignment and domain information
>gnl|CDD|188713 cd09327, LIM1_abLIM, The first LIM domain of actin binding LIM (abLIM) proteins Back     alignment and domain information
>gnl|CDD|188791 cd09407, LIM2_Paxillin, The second LIM domain of paxillin Back     alignment and domain information
>gnl|CDD|188738 cd09352, LIM1_Ajuba_like, The first LIM domain of Ajuba-like proteins Back     alignment and domain information
>gnl|CDD|188729 cd09343, LIM1_FHL, The first LIM domain of Four and a half LIM domains protein (FHL) Back     alignment and domain information
>gnl|CDD|188737 cd09351, LIM1_LPP, The first LIM domain of lipoma preferred partner (LPP) Back     alignment and domain information
>gnl|CDD|188743 cd09357, LIM3_Zyxin_like, The third LIM domain of Zyxin-like family Back     alignment and domain information
>gnl|CDD|188736 cd09350, LIM1_TRIP6, The first LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) Back     alignment and domain information
>gnl|CDD|188841 cd09457, LIM2_ENH, The second LIM domain of the Enigma Homolog (ENH) family Back     alignment and domain information
>gnl|CDD|188780 cd09394, LIM1_Rga, The first LIM domain of Rga GTPase-Activating Proteins Back     alignment and domain information
>gnl|CDD|188727 cd09341, LIM2_Testin_like, The second LIM domain of Testin-like family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 306
KOG4577|consensus 383 100.0
KOG1701|consensus468 99.94
KOG1701|consensus468 99.9
KOG2272|consensus332 99.89
KOG1044|consensus 670 99.86
KOG2272|consensus332 99.85
KOG1703|consensus479 99.84
KOG0850|consensus245 99.77
KOG0484|consensus125 99.77
KOG2251|consensus228 99.73
KOG0490|consensus235 99.72
KOG0489|consensus261 99.72
KOG0843|consensus197 99.71
KOG1703|consensus479 99.71
KOG0488|consensus309 99.7
KOG0842|consensus307 99.67
KOG0487|consensus308 99.66
KOG0848|consensus317 99.64
KOG0492|consensus246 99.63
PF0004657 Homeobox: Homeobox domain not present here.; Inter 99.62
KOG0485|consensus268 99.61
KOG0490|consensus235 99.61
KOG0494|consensus332 99.6
TIGR0156558 homeo_ZF_HD homeobox domain, ZF-HD class. This mod 99.53
KOG0493|consensus342 99.53
COG5576156 Homeodomain-containing transcription factor [Trans 99.52
KOG1044|consensus 670 99.5
smart0038956 HOX Homeodomain. DNA-binding factors that are invo 99.48
KOG0483|consensus198 99.48
cd0008659 homeodomain Homeodomain; DNA binding domains invol 99.46
KOG0847|consensus288 99.46
KOG0491|consensus194 99.43
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.38
KOG3802|consensus398 99.37
KOG0844|consensus 408 99.36
KOG0486|consensus 351 99.33
PF0041258 LIM: LIM domain; InterPro: IPR001781 Zinc finger ( 99.3
KOG1700|consensus200 99.24
KOG0775|consensus304 99.17
KOG1168|consensus385 99.01
KOG0849|consensus354 98.99
KOG4577|consensus383 98.79
PF0592040 Homeobox_KN: Homeobox KN domain; InterPro: IPR0084 98.73
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.55
smart0013239 LIM Zinc-binding domain present in Lin-11, Isl-1, 98.5
KOG2252|consensus558 98.49
KOG0774|consensus334 98.49
KOG1146|consensus 1406 97.6
KOG1702|consensus264 97.57
KOG1700|consensus200 97.42
KOG0773|consensus342 96.92
PF1156956 Homez: Homeodomain leucine-zipper encoding, Homez; 96.33
KOG1702|consensus264 95.94
KOG3623|consensus 1007 94.99
PF0421853 CENP-B_N: CENP-B N-terminal DNA-binding domain; In 92.63
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 90.46
PF10083158 DUF2321: Uncharacterized protein conserved in bact 85.21
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 83.22
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 82.76
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 82.27
smart0050463 Ubox Modified RING finger domain. Modified RING fi 81.19
PF0839437 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: 80.73
>KOG4577|consensus Back     alignment and domain information 
Probab=100.00  E-value=7.1e-52  Score=354.50  Aligned_cols=216  Identities=76%  Similarity=1.313  Sum_probs=209.4

Q ss_pred             CCCCCccCCCeeccceeeeecCccccccCcccCcCCCCCCCcceeeCCeeccccccccccCcCCCCCCCCCCCCCceecc
Q psy4325          69 SIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRA  148 (306)
Q Consensus        69 ~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f~~~g~~yC~~cy~~~~~~~C~~C~~~I~~~~~~~~~  148 (306)
                      ..++|++|.+.|.+++++.++++.||..|++|+.|..+|....|.++|.+||+.+|.++|+.+|.+|+..|....+|.+|
T Consensus        32 eip~CagC~q~IlDrFilKvl~R~wHs~CLkCs~C~~qL~drCFsR~~s~yCkedFfKrfGTKCsaC~~GIpPtqVVRkA  111 (383)
T KOG4577|consen   32 EIPICAGCDQHILDRFILKVLDRHWHSSCLKCSDCHDQLADRCFSREGSVYCKEDFFKRFGTKCSACQEGIPPTQVVRKA  111 (383)
T ss_pred             ccccccchHHHHHHHHHHHHHhhhhhhhhcchhhhhhHHHHHHhhcCCceeehHHHHHHhCCcchhhcCCCChHHHHHHh
Confidence            57899999999999999999999999999999999999999999999999999999999999999999999999888899


Q ss_pred             cCccccCCCcccccCCCCCCCCCceeeccCCcccccchhHHHhhccCCCCCCCCCCCCCCcccchHhHHHHHhccccCCC
Q psy4325         149 QDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKAKDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPK  228 (306)
Q Consensus       149 ~~~~~H~~CF~C~~C~~~l~~g~~~~~~~~~~~~C~~c~~~~~~~~~~~~~~~~~~kr~rt~~s~~q~~~Le~~F~~~~~  228 (306)
                      .+.+||.+||.|.+|++.|.+|++||++++++++|...|+.+..+.-..++++...||+||+++..|++.|+..|+..+.
T Consensus       112 qd~VYHl~CF~C~iC~R~L~TGdEFYLmeD~rLvCK~DYE~Ak~k~~~~l~gd~~nKRPRTTItAKqLETLK~AYn~SpK  191 (383)
T KOG4577|consen  112 QDFVYHLHCFACFICKRQLATGDEFYLMEDARLVCKDDYETAKQKHCNELEGDASNKRPRTTITAKQLETLKQAYNTSPK  191 (383)
T ss_pred             hcceeehhhhhhHhhhcccccCCeeEEeccceeehhhhHHHHHhccccccccccccCCCcceeeHHHHHHHHHHhcCCCc
Confidence            99999999999999999999999999999999999999999999977789999999999999999999999999999999


Q ss_pred             CCHHHHHHHHHhhCCCccchhcccccchhHHHHhhhhcCCCCccccccCCCCCCCC
Q psy4325         229 PARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWSQYFRSMKGGTSP  284 (306)
Q Consensus       229 p~~~~r~~La~~~~l~~~~V~~WFqNrR~k~k~~~~~~~~~~~~~~~~~~~~~~~p  284 (306)
                      |....|++|+.++||..++|||||||||+|+||.++.+++..+.++++++.+..++
T Consensus       192 PARHVREQLsseTGLDMRVVQVWFQNRRAKEKRLKKDAGR~RWgqyfrsmK~sgs~  247 (383)
T KOG4577|consen  192 PARHVREQLSSETGLDMRVVQVWFQNRRAKEKRLKKDAGRTRWGQYFRSMKRSGSS  247 (383)
T ss_pred             hhHHHHHHhhhccCcceeehhhhhhhhhHHHHhhhhhcchhHHHHHHHHhhccCCc
Confidence            99999999999999999999999999999999999999999999999999887555

>KOG1701|consensus Back     alignment and domain information
>KOG1701|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>KOG2272|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG0850|consensus Back     alignment and domain information
>KOG0484|consensus Back     alignment and domain information
>KOG2251|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0489|consensus Back     alignment and domain information
>KOG0843|consensus Back     alignment and domain information
>KOG1703|consensus Back     alignment and domain information
>KOG0488|consensus Back     alignment and domain information
>KOG0842|consensus Back     alignment and domain information
>KOG0487|consensus Back     alignment and domain information
>KOG0848|consensus Back     alignment and domain information
>KOG0492|consensus Back     alignment and domain information
>PF00046 Homeobox: Homeobox domain not present here Back     alignment and domain information
>KOG0485|consensus Back     alignment and domain information
>KOG0490|consensus Back     alignment and domain information
>KOG0494|consensus Back     alignment and domain information
>TIGR01565 homeo_ZF_HD homeobox domain, ZF-HD class Back     alignment and domain information
>KOG0493|consensus Back     alignment and domain information
>COG5576 Homeodomain-containing transcription factor [Transcription] Back     alignment and domain information
>KOG1044|consensus Back     alignment and domain information
>smart00389 HOX Homeodomain Back     alignment and domain information
>KOG0483|consensus Back     alignment and domain information
>cd00086 homeodomain Homeodomain; DNA binding domains involved in the transcriptional regulation of key eukaryotic developmental processes; may bind to DNA as monomers or as homo- and/or heterodimers, in a sequence-specific manner Back     alignment and domain information
>KOG0847|consensus Back     alignment and domain information
>KOG0491|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG3802|consensus Back     alignment and domain information
>KOG0844|consensus Back     alignment and domain information
>KOG0486|consensus Back     alignment and domain information
>PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG0775|consensus Back     alignment and domain information
>KOG1168|consensus Back     alignment and domain information
>KOG0849|consensus Back     alignment and domain information
>KOG4577|consensus Back     alignment and domain information
>PF05920 Homeobox_KN: Homeobox KN domain; InterPro: IPR008422 This entry represents a homeobox transcription factor KN domain conserved from fungi to human and plants [] Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 Back     alignment and domain information
>KOG2252|consensus Back     alignment and domain information
>KOG0774|consensus Back     alignment and domain information
>KOG1146|consensus Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1700|consensus Back     alignment and domain information
>KOG0773|consensus Back     alignment and domain information
>PF11569 Homez: Homeodomain leucine-zipper encoding, Homez; PDB: 2YS9_A Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG3623|consensus Back     alignment and domain information
>PF04218 CENP-B_N: CENP-B N-terminal DNA-binding domain; InterPro: IPR006695 Centromere Protein B (CENP-B) is a DNA-binding protein localized to the centromere Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information
>PF10083 DUF2321: Uncharacterized protein conserved in bacteria (DUF2321); InterPro: IPR016891 This entry is represented by Bacteriophage 'Lactobacillus prophage Lj928', Orf-Ljo1454 Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2jtn_A182 Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl 3e-51
2rgt_A169 Crystal Structure Of Lhx3 Lim Domains 1 And 2 With 4e-51
3mmk_A169 The Structural Basis For Partial Redundancy In A Cl 9e-50
2dfy_X195 Crystal Structure Of A Cyclized Protein Fusion Of L 3e-22
1rut_X188 Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L 4e-22
2xjy_A131 Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 2e-17
2da3_A80 Solution Structure Of The Third Homeobox Domain Of 2e-10
2l4z_A123 Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-L 2e-10
1m3v_A122 Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And 1e-09
1bw5_A66 The Nmr Solution Structure Of The Homeodomain Of Th 6e-09
2k40_A67 Nmr Structure Of Hesx-1 Homeodomain Double Mutant R 2e-08
1fjl_A81 Homeodomain From The Drosophila Paired Protein Boun 6e-08
3a01_B67 Crystal Structure Of Aristaless And Clawless Homeod 8e-08
3cmy_A61 Structure Of A Homeodomain In Complex With Dna Leng 1e-07
3lnq_A58 Structure Of Aristaless Homeodomain In Complex With 2e-07
2dmq_A80 Solution Structure Of The Homeobox Domain Of LimHOM 2e-07
3hdd_A60 Engrailed Homeodomain Dna Complex Length = 60 3e-07
1hdd_C61 Crystal Structure Of An Engrailed Homeodomain-Dna C 3e-07
1p7j_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 5e-07
2m0c_A75 Solution Nmr Structure Of Homeobox Domain Of Human 5e-07
1p7i_A59 Crystal Structure Of Engrailed Homeodomain Mutant K 7e-07
2hdd_A61 Engrailed Homeodomain Q50k Variant Dna Complex Leng 1e-06
1ztr_A61 Solution Structure Of Engrailed Homeodomain L16a Mu 1e-06
1enh_A54 Structural Studies Of The Engrailed Homeodomain Len 2e-06
3a02_A60 Crystal Structure Of Aristaless Homeodomain Length 2e-06
2lxd_A125 Backbone 1h, 13c, And 15n Chemical Shift Assignment 2e-06
2l6y_B96 Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 4e-06
2dmu_A70 Solution Structure Of The Homeobox Domain Of Homeob 4e-06
1du0_A57 Engrailed Homeodomain Q50a Variant Dna Complex Leng 4e-06
1j2o_A114 Structure Of Flin2, A Complex Containing The N-Term 7e-06
2hos_A63 Phage-selected Homeodomain Bound To Unmodified Dna 8e-06
2cue_A80 Solution Structure Of The Homeobox Domain Of The Hu 1e-05
2dj7_A80 Solution Structure Of 3rd Lim Domain Of Actin-Bindi 2e-05
2da1_A70 Solution Structure Of The First Homeobox Domain Of 3e-05
3l1p_A155 Pou Protein:dna Complex Length = 155 5e-05
2l7z_A73 Nmr Structure Of A13 Homedomain Length = 73 5e-05
2xqn_T126 Complex Of The 2nd And 3rd Lim Domains Of Tes With 6e-05
2ld5_A67 Solution Nmr-Derived Complex Structure Of Hoxa13 Dn 6e-05
2l7m_P68 Solution Structure Of The Pitx2 Homeodomain R24h Mu 6e-05
2dms_A80 Solution Structure Of The Homeobox Domain Of Homeob 6e-05
2l7f_P68 Solution Structure Of The Pitx2 Homeodomain Length 7e-05
1ocp_A67 Solution Structure Of Oct3 Pou-Homeodomain Length = 1e-04
1ig7_A58 Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 2e-04
2xsd_C164 Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou 2e-04
1au7_A146 Pit-1 MutantDNA COMPLEX Length = 146 2e-04
2m34_A71 Nmr Structure Of The Homeodomain Transcription Fact 2e-04
1b72_A97 Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Le 3e-04
2djn_A70 The Solution Structure Of The Homeobox Domain Of Hu 4e-04
1x6a_A81 Solution Structures Of The Second Lim Domain Of Hum 7e-04
>pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 Back     alignment and structure 
Iteration: 1

 Score =  198 bits (504), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 88/123 (71%), Positives = 102/123 (82%)
Query: 69  SIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRF 128
            IP C GC   ILDRFILK L+R WH++CLKC +C  PLAE+CF+R   ++CK+DFFKRF
Sbjct: 59  EIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRF 118
Query: 129 GTKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYE 188
           GTKCA C++GIPPTQVVRRAQD VYHL+CFACV+C RQL TGDEFYLMED +LVCK DYE
Sbjct: 119 GTKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYE 178
Query: 189 AAK 191
            AK
Sbjct: 179 TAK 181
>pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 Back     alignment and structure
>pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 Back     alignment and structure
>pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 Back     alignment and structure
>pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 Back     alignment and structure
>pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 Back     alignment and structure
>pdb|2DA3|A Chain A, Solution Structure Of The Third Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 80 Back     alignment and structure
>pdb|2L4Z|A Chain A, Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-Lim1 (18-82) Length = 123 Back     alignment and structure
>pdb|1M3V|A Chain A, Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And The N- Terminal Lim Domain Of Lmo4 Length = 122 Back     alignment and structure
>pdb|1BW5|A Chain A, The Nmr Solution Structure Of The Homeodomain Of The Rat Insulin Gene Enhancer Protein Isl-1, 50 Structures Length = 66 Back     alignment and structure
>pdb|2K40|A Chain A, Nmr Structure Of Hesx-1 Homeodomain Double Mutant R31lE42L Length = 67 Back     alignment and structure
>pdb|1FJL|A Chain A, Homeodomain From The Drosophila Paired Protein Bound To A Dna Oligonucleotide Length = 81 Back     alignment and structure
>pdb|3A01|B Chain B, Crystal Structure Of Aristaless And Clawless Homeodomains Bo Length = 67 Back     alignment and structure
>pdb|3CMY|A Chain A, Structure Of A Homeodomain In Complex With Dna Length = 61 Back     alignment and structure
>pdb|3LNQ|A Chain A, Structure Of Aristaless Homeodomain In Complex With Dna Length = 58 Back     alignment and structure
>pdb|2DMQ|A Chain A, Solution Structure Of The Homeobox Domain Of LimHOMEOBOX Protein Lhx9 Length = 80 Back     alignment and structure
>pdb|3HDD|A Chain A, Engrailed Homeodomain Dna Complex Length = 60 Back     alignment and structure
>pdb|1HDD|C Chain C, Crystal Structure Of An Engrailed Homeodomain-Dna Complex At 2.8 Angstroms Resolution: A Framework For Understanding Homeodomain-Dna Interactions Length = 61 Back     alignment and structure
>pdb|1P7J|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52e Length = 59 Back     alignment and structure
>pdb|2M0C|A Chain A, Solution Nmr Structure Of Homeobox Domain Of Human Alx4, Northeast Structural Genomics Consortium (Nesg) Target Hr4490c Length = 75 Back     alignment and structure
>pdb|1P7I|A Chain A, Crystal Structure Of Engrailed Homeodomain Mutant K52a Length = 59 Back     alignment and structure
>pdb|2HDD|A Chain A, Engrailed Homeodomain Q50k Variant Dna Complex Length = 61 Back     alignment and structure
>pdb|1ZTR|A Chain A, Solution Structure Of Engrailed Homeodomain L16a Mutant Length = 61 Back     alignment and structure
>pdb|1ENH|A Chain A, Structural Studies Of The Engrailed Homeodomain Length = 54 Back     alignment and structure
>pdb|3A02|A Chain A, Crystal Structure Of Aristaless Homeodomain Length = 60 Back     alignment and structure
>pdb|2LXD|A Chain A, Backbone 1h, 13c, And 15n Chemical Shift Assignments For Lmo2(Lim2)- Ldb1(Lid) Length = 125 Back     alignment and structure
>pdb|2L6Y|B Chain B, Haddock Model Of Gata1nf:lmo2lim2-Ldb1lid Length = 96 Back     alignment and structure
>pdb|2DMU|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Goosecoid Length = 70 Back     alignment and structure
>pdb|1DU0|A Chain A, Engrailed Homeodomain Q50a Variant Dna Complex Length = 57 Back     alignment and structure
>pdb|1J2O|A Chain A, Structure Of Flin2, A Complex Containing The N-Terminal Lim Domain Of Lmo2 And Ldb1-Lid Length = 114 Back     alignment and structure
>pdb|2HOS|A Chain A, Phage-selected Homeodomain Bound To Unmodified Dna Length = 63 Back     alignment and structure
>pdb|2CUE|A Chain A, Solution Structure Of The Homeobox Domain Of The Human Paired Box Protein Pax-6 Length = 80 Back     alignment and structure
>pdb|2DJ7|A Chain A, Solution Structure Of 3rd Lim Domain Of Actin-Binding Lim Protein 3 Length = 80 Back     alignment and structure
>pdb|2DA1|A Chain A, Solution Structure Of The First Homeobox Domain Of At- Binding Transcription Factor 1 (Atbf1) Length = 70 Back     alignment and structure
>pdb|3L1P|A Chain A, Pou Protein:dna Complex Length = 155 Back     alignment and structure
>pdb|2L7Z|A Chain A, Nmr Structure Of A13 Homedomain Length = 73 Back     alignment and structure
>pdb|2XQN|T Chain T, Complex Of The 2nd And 3rd Lim Domains Of Tes With The Evh1 Domain Of Mena And The N-Terminal Domain Of Actin-Like Protein Arp7a Length = 126 Back     alignment and structure
>pdb|2LD5|A Chain A, Solution Nmr-Derived Complex Structure Of Hoxa13 Dna Binding Domain Bound To Dna Length = 67 Back     alignment and structure
>pdb|2L7M|P Chain P, Solution Structure Of The Pitx2 Homeodomain R24h Mutant Length = 68 Back     alignment and structure
>pdb|2DMS|A Chain A, Solution Structure Of The Homeobox Domain Of Homeobox Protein Otx2 Length = 80 Back     alignment and structure
>pdb|2L7F|P Chain P, Solution Structure Of The Pitx2 Homeodomain Length = 68 Back     alignment and structure
>pdb|1OCP|A Chain A, Solution Structure Of Oct3 Pou-Homeodomain Length = 67 Back     alignment and structure
>pdb|1IG7|A Chain A, Msx-1 HomeodomainDNA COMPLEX STRUCTURE Length = 58 Back     alignment and structure
>pdb|2XSD|C Chain C, Crystal Structure Of The Dimeric Oct-6 (Pou3f1) Pou Domain Bound To Palindromic More Dna Length = 164 Back     alignment and structure
>pdb|1AU7|A Chain A, Pit-1 MutantDNA COMPLEX Length = 146 Back     alignment and structure
>pdb|2M34|A Chain A, Nmr Structure Of The Homeodomain Transcription Factor Gbx1 From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|1B72|A Chain A, Pbx1, Homeobox Protein Hox-B1DNA TERNARY COMPLEX Length = 97 Back     alignment and structure
>pdb|2DJN|A Chain A, The Solution Structure Of The Homeobox Domain Of Human Homeobox Protein Dlx-5 Length = 70 Back     alignment and structure
>pdb|1X6A|A Chain A, Solution Structures Of The Second Lim Domain Of Human Lim- Kinase 2 (limk2) Length = 81 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 1e-61
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 9e-61
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 4e-10
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 3e-52
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 9e-09
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 6e-08
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 2e-49
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 1e-42
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 2e-08
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 6e-08
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 3e-37
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 4e-36
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 1e-09
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 3e-04
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 1e-35
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 5e-33
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 6e-33
1e3o_C160 Octamer-binding transcription factor 1; transcript 3e-32
2xsd_C164 POU domain, class 3, transcription factor 1; trans 9e-32
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 3e-30
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 1e-28
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 2e-28
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 8e-13
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 4e-28
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 2e-08
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 4e-25
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 8e-25
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 1e-07
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 3e-24
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 3e-24
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 7e-12
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 2e-22
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 6e-11
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 2e-22
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 1e-21
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 2e-06
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 9e-21
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 2e-20
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 4e-20
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 3e-06
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 8e-19
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 3e-12
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 1e-18
3d1n_I151 POU domain, class 6, transcription factor 1; prote 2e-18
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 3e-18
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 6e-18
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 6e-07
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 2e-17
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 4e-08
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 4e-17
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 2e-16
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 2e-11
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 5e-16
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 8e-07
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 6e-16
2cuq_A80 Four and A half LIM domains 3; structural genomics 7e-16
2cuq_A80 Four and A half LIM domains 3; structural genomics 3e-11
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 7e-16
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 9e-16
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 1e-06
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 9e-16
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 1e-15
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 2e-15
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 4e-13
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 8e-06
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 3e-15
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 3e-15
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 3e-15
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 2e-09
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 7e-15
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 8e-15
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 8e-10
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 1e-14
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 1e-14
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 5e-07
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 1e-14
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 2e-14
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 2e-07
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 2e-14
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 3e-14
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 2e-06
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 3e-14
3a02_A60 Homeobox protein aristaless; homeodomain, developm 4e-14
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 7e-14
1uhs_A72 HOP, homeodomain only protein; structural genomics 9e-14
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 1e-13
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 2e-12
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 1e-13
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 2e-12
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 3e-13
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 1e-05
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 3e-12
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 6e-12
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 3e-07
2e19_A64 Transcription factor 8; homeobox domain, structura 1e-11
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 1e-11
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 9e-09
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 3e-11
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 5e-11
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 8e-11
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 8e-11
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 1e-10
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 8e-11
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 1e-08
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 1e-10
3f6q_B72 LIM and senescent cell antigen-like-containing dom 1e-10
3f6q_B72 LIM and senescent cell antigen-like-containing dom 1e-10
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 2e-10
2cor_A79 Pinch protein; LIM domain, particularly interestin 4e-10
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 1e-09
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 1e-09
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 2e-09
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 7e-06
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 2e-09
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 2e-09
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 2e-09
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 3e-09
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 3e-09
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 2e-06
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 3e-09
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 3e-09
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 3e-09
3a01_A93 Homeodomain-containing protein; homeodomain, prote 7e-09
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 7e-09
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 1e-08
2co8_A82 NEDD9 interacting protein with calponin homology a 1e-08
2co8_A82 NEDD9 interacting protein with calponin homology a 1e-07
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 3e-08
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 3e-08
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 4e-08
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 4e-08
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 4e-08
1lfb_A99 Liver transcription factor (LFB1); transcription r 7e-08
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 7e-08
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 1e-07
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 2e-07
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 2e-07
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 2e-07
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 3e-07
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 6e-06
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 6e-05
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 7e-05
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 3e-04
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 8e-04
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 Back     alignment and structure
 Score =  192 bits (489), Expect = 1e-61
 Identities = 93/166 (56%), Positives = 111/166 (66%), Gaps = 6/166 (3%)

Query: 70  IPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFG 129
           IP C GC   ILDRFILK L+R WH++CLKC +C  PLAE+CF+R   ++CK+DFFKRFG
Sbjct: 6   IPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFG 65

Query: 130 TKCAGCEMGIPPTQVVRRAQDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEA 189
           TKCA C++GIPPTQVVRRAQD VYHL+CFACV+C RQL TGDEFYLMED +LVCK DYE 
Sbjct: 66  TKCAACQLGIPPTQVVRRAQDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYET 125

Query: 190 AKA-KDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPKPARHVR 234
           AK    G             T + A   E        +P   +  +
Sbjct: 126 AKQGGSGGS-----GGSGGGTPMVAASPERHDGGLQANPVEVQSYQ 166
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Length = 146 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Length = 160 Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Length = 164 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 66 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Length = 155 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 71 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Length = 151 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Length = 164 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 89 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Length = 66 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Length = 80 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 73 Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Length = 96 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Length = 61 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Length = 68 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 80 Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Length = 60 Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Length = 81 Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 76 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 64 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Length = 61 Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 95 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Length = 84 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Length = 72 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Length = 58 Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Length = 97 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Length = 62 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Length = 77 Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Length = 93 Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Length = 70 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Length = 194 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Length = 73 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Length = 60 Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Length = 68 Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Length = 77 Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Length = 58 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Length = 99 Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Length = 221 Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Length = 63 Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Length = 68 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Length = 88 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Length = 64 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Length = 81 Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Length = 56 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Length = 87 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 100.0
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.96
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.96
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.95
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.94
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.92
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.91
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.84
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.79
1b8t_A192 Protein (CRP1); LIM domain, muscle differentiation 99.79
2dmu_A70 Homeobox protein goosecoid; homeobox domain, three 99.77
2dmt_A80 Homeobox protein BARH-like 1; homeobox domain, thr 99.77
1nk2_P77 Homeobox protein VND; homeodomain, DNA-binding pro 99.77
2cra_A70 Homeobox protein HOX-B13; DNA-binding, transcripti 99.77
2dms_A80 Homeobox protein OTX2; homeobox domain, three heli 99.76
1zq3_P68 PRD-4, homeotic bicoid protein; protein-DNA comple 99.76
2da3_A80 Alpha-fetoprotein enhancer binding protein; homeob 99.76
2e1o_A70 Homeobox protein PRH; DNA binding protein, structu 99.76
2dmq_A80 LIM/homeobox protein LHX9; homeobox domain, three 99.76
2da2_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.76
2cue_A80 Paired box protein PAX6; homeobox domain, transcri 99.76
2djn_A70 Homeobox protein DLX-5; structural genomics, NPPSF 99.76
2da1_A70 Alpha-fetoprotein enhancer binding protein; homeob 99.76
2h1k_A63 IPF-1, pancreatic and duodenal homeobox 1, homeodo 99.76
1ahd_P68 Antennapedia protein mutant; DNA binding protein/D 99.76
1puf_A77 HOX-1.7, homeobox protein HOX-A9; homeodomian, pro 99.75
2hdd_A61 Protein (engrailed homeodomain Q50K); DNA binding, 99.75
3a01_A93 Homeodomain-containing protein; homeodomain, prote 99.75
1ig7_A58 Homeotic protein MSX-1; helix-turn-helix, transcri 99.75
2vi6_A62 Homeobox protein nanog; homeodomain, DNA-binding, 99.74
2l7z_A73 Homeobox protein HOX-A13; gene regulation; NMR {Ho 99.74
1ftt_A68 TTF-1 HD, thyroid transcription factor 1 homeodoma 99.74
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 99.74
1jgg_A60 Segmentation protein EVEN-skipped; homeodomain, pr 99.74
2kt0_A84 Nanog, homeobox protein nanog; homeodomain, struct 99.74
1yz8_P68 Pituitary homeobox 2; DNA binding protein, transcr 99.74
2da4_A80 Hypothetical protein DKFZP686K21156; homeobox doma 99.74
1wh5_A80 ZF-HD homeobox family protein; structural genomics 99.74
2r5y_A88 Homeotic protein sex combs reduced; homeodomain; H 99.74
3a02_A60 Homeobox protein aristaless; homeodomain, developm 99.73
2m0c_A75 Homeobox protein aristaless-like 4; structural gen 99.73
1fjl_A81 Paired protein; DNA-binding protein, paired BOX, t 99.73
3a03_A56 T-cell leukemia homeobox protein 2; homeodomain, d 99.73
1bw5_A66 ISL-1HD, insulin gene enhancer protein ISL-1; DNA- 99.73
1b72_A97 Protein (homeobox protein HOX-B1); homeodomain, DN 99.73
2k40_A67 Homeobox expressed in ES cells 1; thermostable hom 99.73
1uhs_A72 HOP, homeodomain only protein; structural genomics 99.73
1b8i_A81 Ultrabithorax, protein (ultrabithorax homeotic pro 99.73
3rkq_A58 Homeobox protein NKX-2.5; helix-turn-helix, DNA bi 99.72
1rut_X188 Flinc4, fusion protein of LMO4 protein and LIM dom 99.72
2ecb_A89 Zinc fingers and homeoboxes protein 1; homeobox do 99.72
2hi3_A73 Homeodomain-only protein; transcription; NMR {Mus 99.72
1wh7_A80 ZF-HD homeobox family protein; homeobox domain, st 99.72
2da5_A75 Zinc fingers and homeoboxes protein 3; homeobox do 99.72
1x2n_A73 Homeobox protein pknox1; homeobox domain, structur 99.71
1akh_A61 Protein (mating-type protein A-1); complex (TWO DN 99.71
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.71
2xjy_A131 Rhombotin-2; oncoprotein, T-cell leukemia, proto-o 99.71
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 99.71
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.71
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.71
2ehe_A82 Four and A half LIM domains 3; FHL-3, skeletal mus 99.7
1puf_B73 PRE-B-cell leukemia transcription factor-1; homeod 99.7
1wi3_A71 DNA-binding protein SATB2; homeodomain, helix-turn 99.7
2ly9_A74 Zinc fingers and homeoboxes protein 1; structural 99.7
2xqn_T126 Testin, TESS; metal-binding protein, cytoskeleton, 99.7
3nau_A66 Zinc fingers and homeoboxes protein 2; ZHX2, corep 99.69
2cuf_A95 FLJ21616 protein; homeobox domain, hepatocyte tran 99.69
1du6_A64 PBX1, homeobox protein PBX1; homeodomain, gene reg 99.69
2dmn_A83 Homeobox protein TGIF2LX; TGFB-induced factor 2-li 99.69
2cqx_A72 LAG1 longevity assurance homolog 5; homeodomain, D 99.69
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.68
2dmp_A89 Zinc fingers and homeoboxes protein 2; homeobox do 99.68
1b72_B87 Protein (PBX1); homeodomain, DNA, complex, DNA-bin 99.68
1k61_A60 Mating-type protein alpha-2; protein-DNA complex, 99.68
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.68
3nar_A96 ZHX1, zinc fingers and homeoboxes protein 1; corep 99.68
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.67
2cuq_A80 Four and A half LIM domains 3; structural genomics 99.67
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.66
2da6_A102 Hepatocyte nuclear factor 1-beta; homeobox domain, 99.66
2l9r_A69 Homeobox protein NKX-3.1; structural genomics, nor 99.66
1x3h_A80 Leupaxin; paxillin family, protein-protein interac 99.66
2dlo_A81 Thyroid receptor-interacting protein 6; LIM domain 99.65
1x2m_A64 LAG1 longevity assurance homolog 6; homeobox domai 99.65
2rgt_A169 Fusion of LIM/homeobox protein LHX3, linker, INSU 99.65
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.65
1le8_B83 Mating-type protein alpha-2; matalpha2, isothermal 99.64
1mnm_C87 Protein (MAT alpha-2 transcriptional repressor); t 99.64
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.64
2e19_A64 Transcription factor 8; homeobox domain, structura 99.64
2xsd_C164 POU domain, class 3, transcription factor 1; trans 99.64
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.64
1lfb_A99 Liver transcription factor (LFB1); transcription r 99.63
1au7_A146 Protein PIT-1, GHF-1; complex (DNA-binding protein 99.63
1e3o_C160 Octamer-binding transcription factor 1; transcript 99.63
1x63_A82 Skeletal muscle LIM-protein 1; LIM domain, four an 99.63
2jtn_A182 LIM domain-binding protein 1, LIM/homeobox protein 99.61
3l1p_A155 POU domain, class 5, transcription factor 1; POU, 99.61
3d1n_I151 POU domain, class 6, transcription factor 1; prote 99.61
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.6
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.6
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.59
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.58
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.58
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.57
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.57
3k2a_A67 Homeobox protein MEIS2; homeobox domain, DNA-bindi 99.56
1x6a_A81 LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi 99.56
2egq_A77 FHL1 protein; LIM domain, four and A half LIM doma 99.56
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.56
2d5v_A164 Hepatocyte nuclear factor 6; transcription factor, 99.55
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.55
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.54
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.53
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.52
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.52
2lk2_A89 Homeobox protein TGIF1; NESG, structural genomics, 99.51
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.49
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.48
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.48
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.47
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.47
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.46
1wig_A73 KIAA1808 protein; LIM domain, zinc finger, metal-b 99.46
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.46
2da7_A71 Zinc finger homeobox protein 1B; homeobox domain, 99.45
2co8_A82 NEDD9 interacting protein with calponin homology a 99.44
2l3k_A123 Rhombotin-2, linker, LIM domain-binding protein 1; 99.43
1x4k_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.43
2cup_A101 Skeletal muscle LIM-protein 1; four and half LIM d 99.43
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.42
1wyh_A72 SLIM 2, skeletal muscle LIM-protein 2; structural 99.42
1x61_A72 Thyroid receptor interacting protein 6; LIM domain 99.41
3f6q_B72 LIM and senescent cell antigen-like-containing dom 99.4
1x4l_A72 Skeletal muscle LIM-protein 3; LIM domain, structu 99.39
1x68_A76 FHL5 protein; four-and-A-half LIM protein 5, zinc 99.38
1v6g_A81 Actin binding LIM protein 2; LIM domain, zinc bind 99.38
1nyp_A66 Pinch protein; LIM domain, protein recognition, ce 99.37
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.37
1g47_A77 Pinch protein; LIM domain, Zn finger, cell adhesio 99.37
1ic8_A194 Hepatocyte nuclear factor 1-alpha; transcription r 99.36
2dar_A90 PDZ and LIM domain protein 5; enigma homolog prote 99.35
2d8y_A91 Eplin protein; LIM domain, epithelial protein LOST 99.34
2cur_A69 Skeletal muscle LIM-protein 1; four and A half LIM 99.33
2d8x_A70 Protein pinch; LIM domain, pinch protein, structur 99.32
2d8z_A70 Four and A half LIM domains 2; skeletal muscle LIM 99.31
2iyb_E65 Testin, TESS, TES; LIM domain, SH3-binding, tumour 99.31
2cu8_A76 Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein 99.28
2cor_A79 Pinch protein; LIM domain, particularly interestin 99.28
2l4z_A123 DNA endonuclease RBBP8, LIM domain transcription L 99.28
2h8r_A221 Hepatocyte nuclear factor 1-beta; trasncription fa 99.27
2dj7_A80 Actin-binding LIM protein 3; LIM domain, Zn bindin 99.27
1x62_A79 C-terminal LIM domain protein 1; PDZ and LIM domai 99.26
1x64_A89 Alpha-actinin-2 associated LIM protein; LIM domain 99.24
2co8_A82 NEDD9 interacting protein with calponin homology a 99.22
1a7i_A81 QCRP2 (LIM1); LIM domain containing proteins, meta 99.21
1j2o_A114 FLIN2, fusion of rhombotin-2 and LIM domain-bindin 99.21
1iml_A76 CRIP, cysteine rich intestinal protein; metal-bind 99.2
1mh3_A421 Maltose binding-A1 homeodomain protein chimera; MA 99.16
1m3v_A122 FLIN4, fusion of the LIM interacting domain of LDB 99.14
2nzz_A37 Penetratin conjugated GAS (374-394) peptide; confo 98.9
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.75
1zfo_A31 LAsp-1; LIM domain, zinc-finger, metal-binding pro 97.41
2ys9_A70 Homeobox and leucine zipper protein homez; homeodo 94.02
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 83.29
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 81.81
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 81.58
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 80.23
2ysl_A73 Tripartite motif-containing protein 31; ring-type 80.07
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
Probab=100.00  E-value=4.7e-35  Score=244.27  Aligned_cols=159  Identities=58%  Similarity=1.134  Sum_probs=137.8

Q ss_pred             CCCCCccCCCeeccceeeeecCccccccCcccCcCCCCCCCcceeeCCeeccccccccccCcCCCCCCCCCCCCCceecc
Q psy4325          69 SIPKCGGCGDLILDRFILKVLERTWHARCLKCHECGAPLAEKCFARNGLLFCKEDFFKRFGTKCAGCEMGIPPTQVVRRA  148 (306)
Q Consensus        69 ~~~~C~~C~~~I~~~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~f~~~g~~yC~~cy~~~~~~~C~~C~~~I~~~~~~~~~  148 (306)
                      ..++|++|+++|.+.+++.++|+.||+.||+|..|+++|.+..|.++|++||+.||.++|+++|.+|+++|.+.+.++.+
T Consensus         5 ~~~~C~~C~~~I~~~~~~~a~~~~wH~~CF~C~~C~~~L~~~~f~~~g~~yC~~~y~~~f~~~C~~C~~~I~~~~~v~~a   84 (169)
T 2rgt_A            5 EIPMCAGCDQHILDRFILKALDRHWHSKCLKCSDCHVPLAERCFSRGESVYCKDDFFKRFGTKCAACQLGIPPTQVVRRA   84 (169)
T ss_dssp             --CBBSSSSSBCCSSSCEECSSCEECTTTSBCTTTCCBCCSCCEESSSCEECHHHHHHHHSCBCTTTCCBCCTTSEEEEE
T ss_pred             CCCccccCCCccCCcEEEEECCcEEccccCccCCCCCcCCCCCcccCCeeeecccccccccccccccccccCCCcEEEEc
Confidence            35799999999999887889999999999999999999998889999999999999999999999999999988888899


Q ss_pred             cCccccCCCcccccCCCCCCCCCceeeccCCcccccchhHHHhhccCCCCCCCCCCCCCCcccchHhHHHHHhccccCCC
Q psy4325         149 QDLVYHLNCFACVMCARQLNTGDEFYLMEDRKLVCKPDYEAAKAKDGNCLDGDQPNKRPRTTITAKQLETLKMAYNTSPK  228 (306)
Q Consensus       149 ~~~~~H~~CF~C~~C~~~l~~g~~~~~~~~~~~~C~~c~~~~~~~~~~~~~~~~~~kr~rt~~s~~q~~~Le~~F~~~~~  228 (306)
                      .++.||++||+|..|++.|..|+.|++..++++||..||.++++...+    ..+.+++|+.++..|++.|+..|+.++|
T Consensus        85 ~~~~~H~~CF~C~~C~~~L~~g~~f~~~~~g~~~C~~c~~~~~~~~~~----~~~~~rprt~~~~~q~~~l~~~f~~~~~  160 (169)
T 2rgt_A           85 QDFVYHLHCFACVVCKRQLATGDEFYLMEDSRLVCKADYETAKQGGSG----GSGGSGGGTPMVAASPERHDGGLQANPV  160 (169)
T ss_dssp             TTEEEEGGGCBCTTTCCBCCTTCEEEECTTSCEEEHHHHHHHHHCC--------------EEEECCCCEECCSSCCCCCC
T ss_pred             CCceEeeCCCcCCCCCCCCCCCCceEEccCCeEECHHHHHHHhhccCC----CCCCcCCCCcccHHHHHHHHHHHhCCCC
Confidence            999999999999999999987888877778999999999998876221    2456899999999999999999999999


Q ss_pred             CCH
Q psy4325         229 PAR  231 (306)
Q Consensus       229 p~~  231 (306)
                      |..
T Consensus       161 ~~~  163 (169)
T 2rgt_A          161 EVQ  163 (169)
T ss_dssp             CCC
T ss_pred             ccc
Confidence            873
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Back     alignment and structure
>2dmu_A Homeobox protein goosecoid; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmt_A Homeobox protein BARH-like 1; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1nk2_P Homeobox protein VND; homeodomain, DNA-binding protein, embryonic development, complex (homeodomain/DNA); HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1nk3_P* 1vnd_A 1qry_A Back     alignment and structure
>2cra_A Homeobox protein HOX-B13; DNA-binding, transcription regulation, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dms_A Homeobox protein OTX2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1zq3_P PRD-4, homeotic bicoid protein; protein-DNA complex, double helix, helix-turn-helix; NMR {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2da3_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2e1o_A Homeobox protein PRH; DNA binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2dmq_A LIM/homeobox protein LHX9; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2da2_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2cue_A Paired box protein PAX6; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2djn_A Homeobox protein DLX-5; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2da1_A Alpha-fetoprotein enhancer binding protein; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>2h1k_A IPF-1, pancreatic and duodenal homeobox 1, homeodomain; protein-DNA complex, transcription/DNA complex; 2.42A {Mesocricetus auratus} Back     alignment and structure
>1ahd_P Antennapedia protein mutant; DNA binding protein/DNA; HET: DNA; NMR {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 2hoa_A 1hom_A 1ftz_A Back     alignment and structure
>1puf_A HOX-1.7, homeobox protein HOX-A9; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Mus musculus} SCOP: a.4.1.1 PDB: 1san_A Back     alignment and structure
>2hdd_A Protein (engrailed homeodomain Q50K); DNA binding, complex (DNA binding protein/DNA), transcription/DNA complex; HET: DNA; 1.90A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 1hdd_C* 2jwt_A 3hdd_A 1p7j_A* 1p7i_A* 2hos_A 2hot_A 1du0_A* 1ztr_A 1enh_A 2p81_A Back     alignment and structure
>3a01_A Homeodomain-containing protein; homeodomain, protein-DNA complex, DNA-binding, homeobox, NUC developmental protein; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1ig7_A Homeotic protein MSX-1; helix-turn-helix, transcription/DNA complex; 2.20A {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2vi6_A Homeobox protein nanog; homeodomain, DNA-binding, transcription, transcription facto developmental protein, transcription regulation, NUC homeobox; 2.6A {Mus musculus} Back     alignment and structure
>2l7z_A Homeobox protein HOX-A13; gene regulation; NMR {Homo sapiens} PDB: 2ld5_A* Back     alignment and structure
>1ftt_A TTF-1 HD, thyroid transcription factor 1 homeodomain; DNA binding protein; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1jgg_A Segmentation protein EVEN-skipped; homeodomain, protein-DNA complex, transcription/DNA complex; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 Back     alignment and structure
>2kt0_A Nanog, homeobox protein nanog; homeodomain, structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yz8_P Pituitary homeobox 2; DNA binding protein, transcription/DNA complex; NMR {Homo sapiens} SCOP: a.4.1.1 PDB: 2l7f_P 2lkx_A* 2l7m_P Back     alignment and structure
>2da4_A Hypothetical protein DKFZP686K21156; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wh5_A ZF-HD homeobox family protein; structural genomics, zinc finger homeobox family protein, riken structural genomics/proteomics initiative; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2r5y_A Homeotic protein sex combs reduced; homeodomain; HET: DNA; 2.60A {Drosophila melanogaster} PDB: 2r5z_A* Back     alignment and structure
>3a02_A Homeobox protein aristaless; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.00A {Drosophila melanogaster} PDB: 3lnq_A 3cmy_A Back     alignment and structure
>2m0c_A Homeobox protein aristaless-like 4; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1fjl_A Paired protein; DNA-binding protein, paired BOX, transcription regulation; HET: DNA; 2.00A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 3a01_B Back     alignment and structure
>3a03_A T-cell leukemia homeobox protein 2; homeodomain, developmental protein, DNA-binding, N gene regulation; 1.54A {Homo sapiens} Back     alignment and structure
>1bw5_A ISL-1HD, insulin gene enhancer protein ISL-1; DNA-binding protein, homeodomain, LIM domain; NMR {Rattus norvegicus} SCOP: a.4.1.1 Back     alignment and structure
>1b72_A Protein (homeobox protein HOX-B1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2k40_A Homeobox expressed in ES cells 1; thermostable homeodomain variant, DNA binding protein, developmental protein, disease mutation, DNA-binding; NMR {Homo sapiens} Back     alignment and structure
>1uhs_A HOP, homeodomain only protein; structural genomics, cardiac development, riken structural genomics/proteomics initiative, RSGI, transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1b8i_A Ultrabithorax, protein (ultrabithorax homeotic protein IV); DNA binding, homeodomain, homeotic proteins, development, specificity; HET: DNA; 2.40A {Drosophila melanogaster} SCOP: a.4.1.1 PDB: 9ant_A* Back     alignment and structure
>3rkq_A Homeobox protein NKX-2.5; helix-turn-helix, DNA binding, nucleus, transcription-DNA CO; 1.70A {Homo sapiens} Back     alignment and structure
>1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Back     alignment and structure
>2ecb_A Zinc fingers and homeoboxes protein 1; homeobox domain, transcription factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2hi3_A Homeodomain-only protein; transcription; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1wh7_A ZF-HD homeobox family protein; homeobox domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: a.4.1.1 Back     alignment and structure
>2da5_A Zinc fingers and homeoboxes protein 3; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x2n_A Homeobox protein pknox1; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1akh_A Protein (mating-type protein A-1); complex (TWO DNA-binding proteins/DNA), complex, DNA- binding protein, DNA; HET: DNA; 2.50A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1f43_A 1yrn_A* Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1puf_B PRE-B-cell leukemia transcription factor-1; homeodomian, protein-DNA complex, HOX hexapeptide, TALE homeodomain, homeodomain interaction; 1.90A {Homo sapiens} SCOP: a.4.1.1 PDB: 1b8i_B* 2r5y_B* 2r5z_B* Back     alignment and structure
>1wi3_A DNA-binding protein SATB2; homeodomain, helix-turn-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2ly9_A Zinc fingers and homeoboxes protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Back     alignment and structure
>3nau_A Zinc fingers and homeoboxes protein 2; ZHX2, corepressor, homeodomain, domain swapping, structural oxford protein production facility, OPPF; 2.70A {Homo sapiens} Back     alignment and structure
>2cuf_A FLJ21616 protein; homeobox domain, hepatocyte transcription factor, structural genomics, loop insertion, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1du6_A PBX1, homeobox protein PBX1; homeodomain, gene regulation; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2dmn_A Homeobox protein TGIF2LX; TGFB-induced factor 2-like protein, X-linked TGF(beta) induced transcription factor 2-like protein, TGIF-like on the X; NMR {Homo sapiens} Back     alignment and structure
>2cqx_A LAG1 longevity assurance homolog 5; homeodomain, DNA binding domain, transcription, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmp_A Zinc fingers and homeoboxes protein 2; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1b72_B Protein (PBX1); homeodomain, DNA, complex, DNA-binding protein, protein/DNA complex; HET: DNA; 2.35A {Homo sapiens} SCOP: a.4.1.1 PDB: 1lfu_P Back     alignment and structure
>1k61_A Mating-type protein alpha-2; protein-DNA complex, homeodomain, hoogsteen base PAIR, transcription/DNA complex; HET: 5IU; 2.10A {Synthetic} SCOP: a.4.1.1 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3nar_A ZHX1, zinc fingers and homeoboxes protein 1; corepressor, homeodomain, structural genomics, oxford production facility, OPPF, transcription; 2.60A {Homo sapiens} Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2da6_A Hepatocyte nuclear factor 1-beta; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2l9r_A Homeobox protein NKX-3.1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x2m_A LAG1 longevity assurance homolog 6; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1le8_B Mating-type protein alpha-2; matalpha2, isothermal titration calorimetry, protein-DNA complex, transcription/DNA complex; 2.30A {Saccharomyces cerevisiae} SCOP: a.4.1.1 PDB: 1akh_B* 1apl_C* 1yrn_B* Back     alignment and structure
>1mnm_C Protein (MAT alpha-2 transcriptional repressor); transcription regulation, transcriptional repression, DNA- binding protein; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.1 Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2e19_A Transcription factor 8; homeobox domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xsd_C POU domain, class 3, transcription factor 1; transcription-DNA complex, SOX; 2.05A {Mus musculus} Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1lfb_A Liver transcription factor (LFB1); transcription regulation; 2.80A {Rattus norvegicus} SCOP: a.4.1.1 PDB: 2lfb_A Back     alignment and structure
>1au7_A Protein PIT-1, GHF-1; complex (DNA-binding protein/DNA), pituitary, CPHD, POU domain, transcription factor, transcription/DNA complex; HET: DNA; 2.30A {Rattus norvegicus} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>1e3o_C Octamer-binding transcription factor 1; transcription factor, POU domain, dimer, DNA binding; 1.9A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 PDB: 1gt0_C 1hf0_A* 1cqt_A* 1o4x_A 1oct_C* 1pou_A 1pog_A 1hdp_A Back     alignment and structure
>1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Back     alignment and structure
>3l1p_A POU domain, class 5, transcription factor 1; POU, transcription factor DNA complex, pore, stem cells; HET: DNA; 2.80A {Mus musculus} PDB: 1ocp_A Back     alignment and structure
>3d1n_I POU domain, class 6, transcription factor 1; protein-DNA complex, helix-turn-helix (HTH), DNA-binding, homeobox, nucleus, transcription regulation; 2.51A {Homo sapiens} Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3k2a_A Homeobox protein MEIS2; homeobox domain, DNA-binding, transcription, nucleus, phosphoprotein, DNA bindi protein; 1.95A {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d5v_A Hepatocyte nuclear factor 6; transcription factor, transcription-DNA complex; 2.00A {Rattus norvegicus} PDB: 1s7e_A Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2lk2_A Homeobox protein TGIF1; NESG, structural genomics, northeast structural genomics CON PSI-biology, transcription; NMR {Homo sapiens} Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2da7_A Zinc finger homeobox protein 1B; homeobox domain, three helices with the DNA binding helix- turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Back     alignment and structure
>1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1ic8_A Hepatocyte nuclear factor 1-alpha; transcription regulation, DNA-binding, POU domain, diabetes, disease mutation, MODY3, transcription/DNA comple; 2.60A {Homo sapiens} SCOP: a.4.1.1 a.35.1.1 Back     alignment and structure
>2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Back     alignment and structure
>2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Back     alignment and structure
>2h8r_A Hepatocyte nuclear factor 1-beta; trasncription factor, POU, homeo, protein-DNA, human disease; 3.20A {Homo sapiens} Back     alignment and structure
>2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Back     alignment and structure
>1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Back     alignment and structure
>2nzz_A Penetratin conjugated GAS (374-394) peptide; conformational analysis, G protein, GAS subunit, A2A adenosine receptor, cell-penetrating peptides; NMR {Synthetic} PDB: 2o00_A Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 Back     alignment and structure
>2ys9_A Homeobox and leucine zipper protein homez; homeodomain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 306
d1pufa_77 a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus m 2e-21
d2cuea168 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (H 7e-20
d1b72a_88 a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo 5e-19
d1bw5a_66 a.4.1.1 (A:) Insulin gene enhancer protein isl-1 { 6e-18
d2e1oa157 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo 9e-18
d9anta_56 a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila 2e-17
d1fjla_65 a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila 2e-17
d2craa158 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human ( 2e-17
d1yz8p160 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo 6e-17
d1ig7a_58 a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculu 6e-17
d1ftta_68 a.4.1.1 (A:) Thyroid transcription factor 1 homeod 6e-17
d1zq3p167 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fl 6e-17
d1jgga_57 a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly ( 7e-17
d1au7a158 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Ra 1e-16
d1p7ia_53 a.4.1.1 (A:) Engrailed Homeodomain {Drosophila mel 2e-16
d1s7ea150 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {M 5e-16
d1ocpa_67 a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus mus 5e-16
d1pufb_73 a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 96 7e-16
d1vnda_77 a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophi 1e-15
d1le8a_53 a.4.1.1 (A:) Mating type protein A1 Homeodomain {B 2e-15
d1x2ma152 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 5e-15
d2cufa182 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HM 5e-15
d1wi3a_71 a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Hom 1e-14
d1x2na162 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (H 2e-14
d1wh7a_80 a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Tha 2e-14
d1e3oc157 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human ( 5e-14
d1uhsa_72 a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse 9e-14
d1k61a_60 a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast 2e-13
d2cqxa159 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 7e-13
d2ecba176 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes prote 1e-10
d1lfba_78 a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HN 2e-10
d1j2oa130 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus m 3e-10
d1rutx130 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus m 5e-10
d1rutx331 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus 5e-10
d2ecca176 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein H 8e-09
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 1e-04
d1x3ha135 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ 0.003
d1b8ta449 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) pr 4e-04
d1rutx234 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus m 7e-04
d2dloa135 g.39.1.3 (A:8-42) Thyroid receptor interacting pro 0.004
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Homeobox protein hox-a9
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 83.7 bits (207), Expect = 2e-21
 Identities = 19/67 (28%), Positives = 34/67 (50%)

Query: 202 QPNKRPRTTITAKQLETLKMAYNTSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKR 261
           +  ++ R   T  Q   L+  +  +    R  R ++++   L  R V++WFQNRR K K+
Sbjct: 11  RSTRKKRCPYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKK 70

Query: 262 LKKDAGR 268
           + KD  +
Sbjct: 71  INKDRAK 77
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 66 Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 56 Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 65 Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 68 Back     information, alignment and structure
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 67 Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 57 Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 58 Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Length = 53 Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 77 Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 53 Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 80 Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 60 Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Length = 78 Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 31 Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Length = 49 Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 34 Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Length = 35 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d9anta_56 Antennapedia Homeodomain {Drosophila melanogaster 99.82
d1zq3p167 Homeotic bicoid protein {Fruit fly (Drosophila mel 99.82
d2craa158 Homeobox protein hox-b13 {Human (Homo sapiens) [Ta 99.82
d2e1oa157 Homeobox protein prh {Human (Homo sapiens) [TaxId: 99.82
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 99.82
d1pufa_77 Homeobox protein hox-a9 {Mouse (Mus musculus) [Tax 99.81
d1jgga_57 Even-skipped homeodomain {Fruit fly (Drosophila me 99.81
d1fjla_65 Paired protein {Fruit fly (Drosophila melanogaster 99.79
d1p7ia_53 Engrailed Homeodomain {Drosophila melanogaster [Ta 99.79
d1b72a_88 Homeobox protein hox-b1 {Human (Homo sapiens) [Tax 99.79
d1ftta_68 Thyroid transcription factor 1 homeodomain {Rat (R 99.79
d1vnda_77 VND/NK-2 protein {Fruit fly (Drosophila melanogast 99.79
d2cuea168 Paired box protein pax6 {Human (Homo sapiens) [Tax 99.78
d1uhsa_72 Homeodomain-only protein, Hop {Mouse (Mus musculus 99.78
d1yz8p160 Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 99.77
d1ocpa_67 Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId 99.75
d1bw5a_66 Insulin gene enhancer protein isl-1 {Rat (Rattus n 99.74
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 99.74
d1le8a_53 Mating type protein A1 Homeodomain {Baker's yeast 99.74
d1wi3a_71 DNA-binding protein SATB2 {Human (Homo sapiens) [T 99.73
d1e3oc157 Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId 99.72
d2cufa182 Homeobox-containing protein 1, HMBOX1 (Flj21616) { 99.72
d1s7ea150 Hepatocyte nuclear factor 6 {Mouse (Mus musculus) 99.7
d2ecba176 Zinc fingers and homeoboxes protein 1, ZHX1 {Human 99.69
d1wh7a_80 ZF-HD homeobox protein At4g24660 {Thale cress (Ara 99.66
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 99.65
d1pufb_73 pbx1 {Human (Homo sapiens) [TaxId: 9606]} 99.65
d1x2ma152 Lag1 longevity assurance homolog 6, LASS6 {Mouse ( 99.64
d1k61a_60 mat alpha2 Homeodomain {Baker's yeast (Saccharomyc 99.6
d1lfba_78 Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rat 99.6
d2cqxa159 LAG1 longevity assurance homolog 5, LASS5 {Mouse ( 99.59
d1x2na162 Homeobox protein pknox1 {Human (Homo sapiens) [Tax 99.53
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 99.05
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.68
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.67
d1x3ha135 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 98.66
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.65
d1g47a235 Pinch (particularly interesting new Cys-His) prote 98.59
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 98.43
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.38
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 98.31
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 98.26
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.23
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.23
d2dloa135 Thyroid receptor interacting protein 6, TRIP6 {Hum 98.18
d2dara245 PDZ and LIM domain protein 5, Enigma {Human (Homo 98.16
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 98.13
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 98.08
d1x63a137 Four and a half LIM domains protein 1, FHL-1 {Huma 98.06
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 98.06
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 98.04
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 98.02
d2cuqa235 Four and a half LIM domains 3, FHL3 {Human (Homo s 98.02
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.96
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 97.94
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.93
d1u5sb131 Pinch (particularly interesting new Cys-His) prote 97.93
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.92
d2d8xa226 Pinch (particularly interesting new Cys-His) prote 97.9
d1g47a235 Pinch (particularly interesting new Cys-His) prote 97.89
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.87
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.79
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 97.76
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.75
d2d8ya242 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.74
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 97.72
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.72
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.65
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.65
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.64
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.61
d2d8za232 Four and a half LIM domains protein 2, FHL2 {Human 97.58
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.58
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.56
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.56
d2co8a236 Nedd9 interacting protein with calponin homology, 97.54
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.52
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 97.48
d2d8za126 Four and a half LIM domains protein 2, FHL2 {Human 97.48
d2d8ya135 Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} 97.42
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.42
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.42
d2cuqa132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.39
d2cura226 Four and a half LIM domains protein 1, FHL-1 {Huma 97.38
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 97.38
d2co8a236 Nedd9 interacting protein with calponin homology, 97.37
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.34
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 97.33
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 97.33
d1x4la129 Four and a half LIM domains protein 2, FHL2 {Human 97.31
d2dj7a131 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 97.3
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.26
d1b8ta449 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.25
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.22
d1zfoa_30 LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} 97.19
d1b8ta343 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 97.19
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 97.18
d1x4ka132 Four and a half LIM domains protein 2, FHL2 {Human 97.18
d1wyha132 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.17
d1imla248 Cysteine-rich (intestinal) protein, CRP, CRIP {Rat 97.17
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 97.16
d1x4ka227 Four and a half LIM domains protein 2, FHL2 {Human 97.14
d1rutx130 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 97.13
d1wyha227 Four and a half LIM domains 3, FHL3 {Human (Homo s 97.13
d1x68a129 Four and a half LIM domains protein 5, FHL-5 {Huma 97.12
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 97.1
d1v6ga141 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 97.06
d2cu8a130 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 97.06
d2dloa233 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.06
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 97.04
d1j2oa130 Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 97.03
d1ibia231 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.98
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.95
d1x3ha232 Leupaxin {Human (Homo sapiens) [TaxId: 9606]} 96.93
d2dj7a236 Actin-binding LIM protein 3, abLIM-3 {Human (Homo 96.92
d1u5sb235 Pinch (particularly interesting new Cys-His) prote 96.84
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.83
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.8
d2cu8a233 Cysteine-rich (intestinal) protein, CRP, CRIP {Hum 96.8
d2cupa327 Four and a half LIM domains protein 1, FHL-1 {Huma 96.78
d1b8ta265 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 96.6
d1rutx331 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 96.58
d2dara132 PDZ and LIM domain protein 5, Enigma {Human (Homo 96.5
d1x62a235 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 96.48
d1x6aa134 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 96.39
d1x64a145 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 96.12
d1ibia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 96.1
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 95.99
d1a7ia128 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 95.91
d1b8ta135 Cysteine-rich (intestinal) protein, CRP, CRIP {Chi 95.89
d1wiga132 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 95.82
d2cura131 Four and a half LIM domains protein 1, FHL-1 {Huma 95.79
d1x61a232 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.7
d1a7ia232 Cysteine-rich (intestinal) protein, CRP, CRIP {Jap 95.46
d1x63a232 Four and a half LIM domains protein 1, FHL-1 {Huma 95.31
d2cora131 Pinch (particularly interesting new Cys-His) prote 95.24
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 95.13
d1g47a135 Pinch (particularly interesting new Cys-His) prote 95.0
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 94.53
d2cupa231 Four and a half LIM domains protein 1, FHL-1 {Huma 94.35
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 94.32
d1x61a127 Thyroid receptor interacting protein 6, TRIP6 {Hum 94.17
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 94.12
d1rutx433 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 93.87
d1v6ga240 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 93.77
d2cora235 Pinch (particularly interesting new Cys-His) prote 93.53
d2cora131 Pinch (particularly interesting new Cys-His) prote 93.04
d1rutx234 LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 92.49
d1x62a131 PDZ and LIM domain protein 1 Elfin {Human (Homo sa 92.47
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 91.79
d1x6aa234 Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 89.95
d1g47a135 Pinch (particularly interesting new Cys-His) prote 88.6
d2d8xa132 Pinch (particularly interesting new Cys-His) prote 88.49
d1x64a231 PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m 88.13
d2cora235 Pinch (particularly interesting new Cys-His) prote 87.18
d1hlva166 DNA-binding domain of centromere binding protein B 84.66
d1wiga241 Actin-binding LIM protein 2, abLIM2 {Human (Homo s 84.47
d2c2la280 STIP1 homology and U box-containing protein 1, STU 80.94
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 80.68
>d9anta_ a.4.1.1 (A:) Antennapedia Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Homeodomain
domain: Antennapedia Homeodomain
species: Drosophila melanogaster [TaxId: 7227]

Probab=99.82  E-value=1.2e-21  Score=129.52  Aligned_cols=55  Identities=31%  Similarity=0.432  Sum_probs=53.6

Q ss_pred             CcccchHhHHHHHhccccCCCCCHHHHHHHHHhhCCCccchhcccccchhHHHHh
Q psy4325         208 RTTITAKQLETLKMAYNTSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAKEKRL  262 (306)
Q Consensus       208 rt~~s~~q~~~Le~~F~~~~~p~~~~r~~La~~~~l~~~~V~~WFqNrR~k~k~~  262 (306)
                      ||.||..|+.+|+..|..++||+..++++||..|||++++|+|||||||+|+||+
T Consensus         1 Rt~ft~~Q~~~Le~~F~~~~yp~~~~r~~LA~~l~l~~~~V~iWFQNrRak~kk~   55 (56)
T d9anta_           1 RQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKE   55 (56)
T ss_dssp             CCCCCHHHHHHHHHHHTTCSSCCHHHHHHHHHHHTCCHHHHHHHHHHHHHHHHHC
T ss_pred             CCcCCHHHHHHHHHHHHhCCCCCHHHHHHHHHHhCCChhHeeeccccchhhhhhc
Confidence            7899999999999999999999999999999999999999999999999999985
>d1zq3p1 a.4.1.1 (P:2-68) Homeotic bicoid protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2craa1 a.4.1.1 (A:7-64) Homeobox protein hox-b13 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2e1oa1 a.4.1.1 (A:8-64) Homeobox protein prh {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pufa_ a.4.1.1 (A:) Homeobox protein hox-a9 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jgga_ a.4.1.1 (A:) Even-skipped homeodomain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fjla_ a.4.1.1 (A:) Paired protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p7ia_ a.4.1.1 (A:) Engrailed Homeodomain {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1b72a_ a.4.1.1 (A:) Homeobox protein hox-b1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ftta_ a.4.1.1 (A:) Thyroid transcription factor 1 homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vnda_ a.4.1.1 (A:) VND/NK-2 protein {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2cuea1 a.4.1.1 (A:7-74) Paired box protein pax6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhsa_ a.4.1.1 (A:) Homeodomain-only protein, Hop {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yz8p1 a.4.1.1 (P:1-60) Pituitary homeobox 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ocpa_ a.4.1.1 (A:) Oct-3 POU Homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bw5a_ a.4.1.1 (A:) Insulin gene enhancer protein isl-1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1le8a_ a.4.1.1 (A:) Mating type protein A1 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wi3a_ a.4.1.1 (A:) DNA-binding protein SATB2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3oc1 a.4.1.1 (C:104-160) Oct-1 POU Homeodomain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cufa1 a.4.1.1 (A:8-89) Homeobox-containing protein 1, HMBOX1 (Flj21616) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s7ea1 a.4.1.1 (A:103-152) Hepatocyte nuclear factor 6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecba1 a.4.1.1 (A:8-83) Zinc fingers and homeoboxes protein 1, ZHX1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh7a_ a.4.1.1 (A:) ZF-HD homeobox protein At4g24660 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pufb_ a.4.1.1 (B:) pbx1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x2ma1 a.4.1.1 (A:8-59) Lag1 longevity assurance homolog 6, LASS6 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1k61a_ a.4.1.1 (A:) mat alpha2 Homeodomain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lfba_ a.4.1.1 (A:) Hepatocyte nuclear factor 1a (LFB1/HNF1) {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2cqxa1 a.4.1.1 (A:8-66) LAG1 longevity assurance homolog 5, LASS5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x2na1 a.4.1.1 (A:6-67) Homeobox protein pknox1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} Back     information, alignment and structure
>d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hlva1 a.4.1.7 (A:1-66) DNA-binding domain of centromere binding protein B (CENP-B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure