Diaphorina citri psyllid: psy4350

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------

MLKDRDDSSSPCPEEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFRYSQARYPDLPIPKTLVSFLYDKQGAASEPLLTG

cccccccccccccccccccccccccccccEEEEEccccccccccccccccccccccccEEECccccccHHHHHHHHccccccccccccHHHHHHHcccccccccccc

*******************GGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFRYSQARYPDLPIPKTLVSFLYDKQGAA*******

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MLKDRDDSSSPCPEEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFRYSQARYPDLPIPKTLVSFLYDKQGAASEPLLTG

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
LIM/homeobox protein Lhx9	Involved in gonadal development.	confident	Q9NQ69
LIM/homeobox protein Lhx9	Involved in gonadal development.	confident	Q80W90
LIM/homeobox protein Lhx9	Involved in gonadal development.	confident	Q9WUH2

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0021537 [BP]	telencephalon development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0044767, GO:0048513, GO:0030900, GO:0048731, GO:0008150, GO:0007275, GO:0044699, GO:0007417
GO:0021549 [BP]	cerebellum development	probable	GO:0032502, GO:0044707, GO:0007420, GO:0007399, GO:0032501, GO:0048856, GO:0022037, GO:0044767, GO:0048513, GO:0008150, GO:0030902, GO:0048731, GO:0007275, GO:0044699, GO:0007417
GO:0000977 [MF]	RNA polymerase II regulatory region sequence-specific DNA binding	probable	GO:0043565, GO:0044212, GO:0001067, GO:0003677, GO:0001012, GO:0000976, GO:0005488, GO:0003676, GO:0000975, GO:0003674, GO:0097159, GO:1901363
GO:0008284 [BP]	positive regulation of cell proliferation	probable	GO:0042127, GO:0050794, GO:0065007, GO:0048518, GO:0008150, GO:0050789, GO:0048522
GO:0001654 [BP]	eye development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0007423, GO:0048856, GO:0044767, GO:0048513, GO:0008150, GO:0048731, GO:0007275, GO:0044699
GO:0044092 [BP]	negative regulation of molecular function	probable	GO:0008150, GO:0065009, GO:0065007
GO:0048598 [BP]	embryonic morphogenesis	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0009653, GO:0007275, GO:0044699
GO:0006366 [BP]	transcription from RNA polymerase II promoter	probable	GO:0032774, GO:0090304, GO:0044249, GO:0034641, GO:0006807, GO:0034645, GO:1901362, GO:1901360, GO:1901576, GO:0044260, GO:0071704, GO:0010467, GO:0018130, GO:0006139, GO:0009987, GO:0006725, GO:0009058, GO:0009059, GO:0008150, GO:0008152, GO:0034654, GO:0046483, GO:0016070, GO:0044238, GO:0044271, GO:0044237, GO:0043170, GO:0006351, GO:0019438
GO:0051239 [BP]	regulation of multicellular organismal process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0005515 [MF]	protein binding	probable	GO:0003674, GO:0005488
GO:0008045 [BP]	motor neuron axon guidance	probable	GO:0032502, GO:0044707, GO:0030030, GO:0030154, GO:0048468, GO:0031175, GO:0007411, GO:0009653, GO:0007275, GO:0044699, GO:0000904, GO:0000902, GO:0042330, GO:0048869, GO:0016043, GO:0032989, GO:0071840, GO:0048666, GO:0048667, GO:0032501, GO:0006935, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0007409, GO:0048731, GO:0042221, GO:0022008, GO:0048858, GO:0040011, GO:0048699, GO:0032990, GO:0009605, GO:0050896, GO:0048856, GO:0007399, GO:0048812, GO:0044763
GO:0022414 [BP]	reproductive process	probable	GO:0008150, GO:0000003
GO:0035295 [BP]	tube development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0008150, GO:0007275, GO:0044699
GO:0003700 [MF]	sequence-specific DNA binding transcription factor activity	probable	GO:0003674, GO:0001071
GO:0007267 [BP]	cell-cell signaling	probable	GO:0044700, GO:0009987, GO:0008150, GO:0023052, GO:0007154, GO:0044763, GO:0044699
GO:0048646 [BP]	anatomical structure formation involved in morphogenesis	probable	GO:0032502, GO:0009653, GO:0008150, GO:0048856
GO:0005856 [CC]	cytoskeleton	probable	GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0043228, GO:0044424, GO:0043226
GO:0005737 [CC]	cytoplasm	probable	GO:0044424, GO:0005575, GO:0044464, GO:0005623, GO:0005622
GO:0043009 [BP]	chordate embryonic development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0009792, GO:0008150, GO:0007275, GO:0044699
GO:0060993 [BP]	kidney morphogenesis	probable	GO:0032502, GO:0009887, GO:0032501, GO:0044707, GO:0048856, GO:0001822, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0009653, GO:0007275, GO:0044699
GO:0072006 [BP]	nephron development	probable	GO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0001822, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0007275, GO:0044699
GO:0021521 [BP]	ventral spinal cord interneuron specification	probable	GO:0060573, GO:0021515, GO:0021514, GO:0021517, GO:0030154, GO:0021511, GO:0060579, GO:0021513, GO:0032501, GO:0007275, GO:0044699, GO:0007417, GO:0007389, GO:0048869, GO:0001708, GO:0008150, GO:0021953, GO:0032502, GO:0048665, GO:0048663, GO:0030182, GO:0009987, GO:0021510, GO:0060581, GO:0003002, GO:0048731, GO:0022008, GO:0048699, GO:0045165, GO:0009953, GO:0007399, GO:0044707, GO:0048856, GO:0044763
GO:0003714 [MF]	transcription corepressor activity	probable	GO:0003674, GO:0003712, GO:0000989, GO:0000988
GO:0021522 [BP]	spinal cord motor neuron differentiation	probable	GO:0032502, GO:0032501, GO:0048699, GO:0048856, GO:0007399, GO:0030182, GO:0021515, GO:0048869, GO:0021517, GO:0030154, GO:0021510, GO:0008150, GO:0009987, GO:0044763, GO:0044699, GO:0044707, GO:0048731, GO:0022008, GO:0007275, GO:0021953, GO:0007417
GO:0021527 [BP]	spinal cord association neuron differentiation	probable	GO:0021515, GO:0021516, GO:0021510, GO:0007275, GO:0044699, GO:0007417, GO:0048869, GO:0021953, GO:0032502, GO:0032501, GO:0030182, GO:0009987, GO:0044767, GO:0008150, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0030154, GO:0044763
GO:0005667 [CC]	transcription factor complex	probable	GO:0043234, GO:0044446, GO:0032991, GO:0005575, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0005623, GO:0005622, GO:0005654, GO:0070013, GO:0043229, GO:0044428, GO:0031974, GO:0044424, GO:0044451, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0005730 [CC]	nucleolus	probable	GO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0045892 [BP]	negative regulation of transcription, DNA-dependent	probable	GO:0009892, GO:0080090, GO:0009890, GO:0031327, GO:0031326, GO:0031324, GO:0031323, GO:0010629, GO:0050789, GO:0010605, GO:0019222, GO:2000112, GO:2000113, GO:0060255, GO:0065007, GO:0048519, GO:0010468, GO:0045934, GO:0019219, GO:0009889, GO:0050794, GO:0008150, GO:0051171, GO:0051172, GO:2001141, GO:0051253, GO:0051252, GO:0006355, GO:0010556, GO:0010558, GO:0048523
GO:0051098 [BP]	regulation of binding	probable	GO:0008150, GO:0065009, GO:0065007
GO:0045944 [BP]	positive regulation of transcription from RNA polymerase II promoter	probable	GO:0009893, GO:0019222, GO:0031328, GO:0031326, GO:0031325, GO:2001141, GO:0031323, GO:0010628, GO:0050789, GO:0080090, GO:0010604, GO:0051171, GO:0009891, GO:2000112, GO:0019219, GO:0010556, GO:0065007, GO:0048518, GO:0010468, GO:0045935, GO:0060255, GO:0009889, GO:0050794, GO:0008150, GO:0045893, GO:0051173, GO:0051252, GO:0051254, GO:0006355, GO:0010557, GO:0006357, GO:0048522
GO:0072073 [BP]	kidney epithelium development	probable	GO:0032502, GO:0048856, GO:0044707, GO:0032501, GO:0060429, GO:0001822, GO:0009888, GO:0044767, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0072001, GO:0007275, GO:0044699
GO:0001190 [MF]	RNA polymerase II transcription factor binding transcription factor activity involved in positive regulation of transcription	probable	GO:0001076, GO:0003674, GO:0000989, GO:0000988

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2JTN, chain A
Confidence level:very confident
Coverage over the Query: 12-103
View the alignment between query and template
View the model in PyMOL