Psyllid ID: psy4350
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| 242023961 | 383 | LIM/homeobox protein Lhx2, putative [Ped | 0.691 | 0.193 | 0.546 | 8e-19 | |
| 241753309 | 357 | lim homeobox protein, putative [Ixodes s | 0.719 | 0.215 | 0.532 | 2e-18 | |
| 357622661 | 359 | apterous [Danaus plexippus] | 0.682 | 0.203 | 0.608 | 2e-18 | |
| 328925124 | 349 | apterous B alpha [Bombyx mori] | 0.682 | 0.209 | 0.594 | 2e-18 | |
| 193575711 | 356 | PREDICTED: LIM/homeobox protein Lhx2-lik | 0.579 | 0.174 | 0.646 | 4e-18 | |
| 345132129 | 420 | apterous [Neanthes arenaceodentata] | 0.560 | 0.142 | 0.616 | 6e-18 | |
| 143347140 | 280 | Lhx2 [Platynereis dumerilii] | 0.607 | 0.232 | 0.584 | 2e-17 | |
| 225543484 | 361 | apterous [Tribolium castaneum] gi|224459 | 0.691 | 0.204 | 0.517 | 2e-17 | |
| 148224455 | 331 | LIM/homeobox protein Lhx9 [Xenopus laevi | 0.626 | 0.202 | 0.567 | 3e-17 | |
| 410929509 | 417 | PREDICTED: LIM/homeobox protein Lhx2-lik | 0.663 | 0.170 | 0.52 | 3e-17 |
| >gi|242023961|ref|XP_002432399.1| LIM/homeobox protein Lhx2, putative [Pediculus humanus corporis] gi|212517822|gb|EEB19661.1| LIM/homeobox protein Lhx2, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 97.8 bits (242), Expect = 8e-19, Method: Compositional matrix adjust.
Identities = 47/86 (54%), Positives = 58/86 (67%), Gaps = 12/86 (13%)
Query: 1 MLKDRD------DSSSPCPEEKSS------CGGCGQPIIDRFYLLAVDRQWHLGCLQCAH 48
MLKDRD ++SPCP S C GCG I+DR+YLLAVDRQWH CL+C
Sbjct: 1 MLKDRDAMGPVARAASPCPSGGESASCPTACAGCGGRILDRYYLLAVDRQWHSPCLKCTE 60
Query: 49 CHVPLHSELSCFSRHGNIYCKQDFFR 74
C PL +EL+CF+R GNIYCK+D++R
Sbjct: 61 CKSPLDTELTCFARDGNIYCKEDYYR 86
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|241753309|ref|XP_002401118.1| lim homeobox protein, putative [Ixodes scapularis] gi|215508343|gb|EEC17797.1| lim homeobox protein, putative [Ixodes scapularis] | Back alignment and taxonomy information |
|---|
| >gi|357622661|gb|EHJ74087.1| apterous [Danaus plexippus] | Back alignment and taxonomy information |
|---|
| >gi|328925124|dbj|BAK19077.1| apterous B alpha [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|193575711|ref|XP_001949543.1| PREDICTED: LIM/homeobox protein Lhx2-like [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|345132129|gb|AEN75257.1| apterous [Neanthes arenaceodentata] | Back alignment and taxonomy information |
|---|
| >gi|143347140|gb|ABO93218.1| Lhx2 [Platynereis dumerilii] | Back alignment and taxonomy information |
|---|
| >gi|225543484|ref|NP_001139388.1| apterous [Tribolium castaneum] gi|224459214|gb|ACN43342.1| apterous b [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|148224455|ref|NP_001087527.1| LIM/homeobox protein Lhx9 [Xenopus laevis] gi|82198794|sp|Q68EY3.1|LHX9_XENLA RecName: Full=LIM/homeobox protein Lhx9; Short=LIM homeobox protein 9 gi|51258697|gb|AAH80067.1| Lhx9 protein [Xenopus laevis] | Back alignment and taxonomy information |
|---|
| >gi|410929509|ref|XP_003978142.1| PREDICTED: LIM/homeobox protein Lhx2-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 107 | ||||||
| UNIPROTKB|Q68EY3 | 331 | lhx9 "LIM/homeobox protein Lhx | 0.551 | 0.178 | 0.593 | 8.1e-18 | |
| UNIPROTKB|H0YM35 | 147 | LHX2 "LIM/homeobox protein Lhx | 0.504 | 0.367 | 0.611 | 6.7e-17 | |
| UNIPROTKB|E1BSF2 | 330 | LHX9 "LIM/homeobox protein Lhx | 0.504 | 0.163 | 0.611 | 9.7e-17 | |
| UNIPROTKB|E2R2S6 | 330 | LHX9 "Uncharacterized protein" | 0.504 | 0.163 | 0.611 | 9.7e-17 | |
| UNIPROTKB|H0YL54 | 336 | LHX9 "LIM/homeobox protein Lhx | 0.504 | 0.160 | 0.611 | 1.1e-16 | |
| UNIPROTKB|A2I8Z7 | 377 | lhx9 "LIM/homeobox protein Lhx | 0.504 | 0.143 | 0.611 | 1.1e-16 | |
| UNIPROTKB|Q58CW3 | 378 | LHX9 "LIM homeobox 9" [Bos tau | 0.504 | 0.142 | 0.611 | 1.5e-16 | |
| UNIPROTKB|A0JNI8 | 397 | LHX9 "LIM/homeobox protein Lhx | 0.504 | 0.136 | 0.611 | 1.8e-16 | |
| UNIPROTKB|F1S5F5 | 397 | LHX9 "Uncharacterized protein" | 0.504 | 0.136 | 0.611 | 1.8e-16 | |
| UNIPROTKB|F1NV70 | 378 | LHX9 "LIM/homeobox protein Lhx | 0.504 | 0.142 | 0.611 | 1.9e-16 |
| UNIPROTKB|Q68EY3 lhx9 "LIM/homeobox protein Lhx9" [Xenopus laevis (taxid:8355)] | Back alignment and assigned GO terms |
|---|
Score = 217 (81.4 bits), Expect = 8.1e-18, P = 8.1e-18
Identities = 35/59 (59%), Positives = 47/59 (79%)
Query: 21 GCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFRYSQAR 79
GCG I DR+YLLAVD+QWHL CL+C C + L SEL+CF++ G+IYCK+D++R+S R
Sbjct: 75 GCGGKISDRYYLLAVDKQWHLRCLKCCECKLTLESELTCFAKDGSIYCKEDYYRFSVKR 133
|
|
| UNIPROTKB|H0YM35 LHX2 "LIM/homeobox protein Lhx2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1BSF2 LHX9 "LIM/homeobox protein Lhx9" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R2S6 LHX9 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YL54 LHX9 "LIM/homeobox protein Lhx9" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A2I8Z7 lhx9 "LIM/homeobox protein Lhx9" [Astyanax fasciatus (taxid:223369)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q58CW3 LHX9 "LIM homeobox 9" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A0JNI8 LHX9 "LIM/homeobox protein Lhx9" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1S5F5 LHX9 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NV70 LHX9 "LIM/homeobox protein Lhx9" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| cd09369 | 54 | cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of L | 3e-28 | |
| cd09469 | 64 | cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | 8e-20 | |
| cd09470 | 54 | cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | 2e-19 | |
| cd09373 | 54 | cd09373, LIM1_AWH, The first LIM domain of Arrowhe | 2e-17 | |
| cd09368 | 52 | cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of L | 3e-16 | |
| cd09468 | 52 | cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 | 5e-16 | |
| cd09367 | 52 | cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of L | 3e-15 | |
| cd09386 | 55 | cd09386, LIM1_LMO4, The first LIM domain of LMO4 ( | 5e-15 | |
| cd08368 | 53 | cd08368, LIM, LIM is a small protein-protein inter | 1e-14 | |
| cd09467 | 55 | cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b | 1e-14 | |
| cd09371 | 53 | cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | 1e-14 | |
| cd09466 | 56 | cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a | 1e-13 | |
| cd09329 | 52 | cd09329, LIM3_abLIM, The third LIM domain of actin | 1e-12 | |
| pfam00412 | 58 | pfam00412, LIM, LIM domain | 1e-12 | |
| cd09366 | 55 | cd09366, LIM1_Isl, The first LIM domain of Isl, a | 2e-12 | |
| smart00132 | 54 | smart00132, LIM, Zinc-binding domain present in Li | 3e-11 | |
| cd09381 | 56 | cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of L | 7e-11 | |
| cd09370 | 52 | cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a | 3e-10 | |
| cd09380 | 54 | cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 | 3e-10 | |
| cd09364 | 53 | cd09364, LIM1_LIMK, The first LIM domain of LIMK ( | 3e-08 | |
| cd09388 | 55 | cd09388, LIM1_LMO1_LMO3, The first LIM domain of L | 3e-07 | |
| cd09384 | 56 | cd09384, LIM1_LMO2, The first LIM domain of LMO2 ( | 5e-07 | |
| cd09338 | 53 | cd09338, LIM3_Paxillin_like, The third LIM domain | 1e-06 | |
| cd09462 | 74 | cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 | 1e-06 | |
| cd09361 | 52 | cd09361, LIM1_Enigma_like, The first LIM domain of | 8e-06 | |
| cd09463 | 53 | cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 | 4e-05 | |
| cd09336 | 53 | cd09336, LIM1_Paxillin_like, The first LIM domain | 7e-05 | |
| cd09409 | 53 | cd09409, LIM3_Paxillin, The third LIM domain of pa | 1e-04 | |
| cd09410 | 53 | cd09410, LIM3_Leupaxin, The third LIM domain of Le | 2e-04 | |
| cd09396 | 53 | cd09396, LIM_DA1, The Lim domain of DA1 | 3e-04 | |
| cd09357 | 63 | cd09357, LIM3_Zyxin_like, The third LIM domain of | 4e-04 | |
| cd09485 | 53 | cd09485, LIM_Eplin_alpha_beta, The Lim domain of E | 4e-04 | |
| cd09397 | 58 | cd09397, LIM1_UF1, LIM domain in proteins of unkno | 5e-04 | |
| cd09356 | 53 | cd09356, LIM2_TRIP6, The second LIM domain of Thyr | 5e-04 | |
| cd09334 | 54 | cd09334, LIM4_PINCH, The fourth LIM domain of prot | 7e-04 | |
| cd09340 | 58 | cd09340, LIM1_Testin_like, The first LIM domain of | 9e-04 | |
| cd09353 | 60 | cd09353, LIM2_Zyxin, The second LIM domain of Zyxi | 0.001 | |
| cd09393 | 56 | cd09393, LIM3_Lrg1p_like, The third LIM domain of | 0.001 | |
| cd09363 | 54 | cd09363, LIM3_Enigma_like, The third LIM domain of | 0.001 | |
| cd09408 | 52 | cd09408, LIM2_Leupaxin, The second LIM domain of L | 0.001 | |
| cd09326 | 53 | cd09326, LIM_CRP_like, The LIM domains of Cysteine | 0.002 | |
| cd09406 | 55 | cd09406, LIM1_Leupaxin, The first LIM domain of Le | 0.002 | |
| cd09337 | 52 | cd09337, LIM2_Paxillin_like, The second LIM domain | 0.003 | |
| cd09477 | 54 | cd09477, LIM2_TLP, The second LIM domain of thymus | 0.004 | |
| cd09434 | 56 | cd09434, LIM4_FHL3, The fourth LIM domain of Four | 0.004 |
| >gnl|CDD|188755 cd09369, LIM1_Lhx2_Lhx9, The first LIM domain of Lhx2 and Lhx9 family | Back alignment and domain information |
|---|
Score = 97.0 bits (242), Expect = 3e-28
Identities = 39/54 (72%), Positives = 44/54 (81%)
Query: 19 CGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDF 72
C GCG+ I DRFYLLAVDRQWH CL+C C +PL SELSCFSR GNIYCK+D+
Sbjct: 1 CAGCGEKIQDRFYLLAVDRQWHASCLKCCECRLPLDSELSCFSRDGNIYCKEDY 54
|
The first LIM domain of Lhx2 and Lhx9 family: Lhx2 and Lhx9 are highly homologous LHX regulatory proteins. They belong to the LHX protein family, which features two tandem N-terminal LIM domains and a C-terminal DNA binding homeodomain. Members of LHX family are found in the nucleus and act as transcription factors or cofactors. LHX proteins are critical for the development of specialized cells in multiple tissue types, including the nervous system, skeletal muscle, the heart, the kidneys, and endocrine organs, such as the pituitary gland and the pancreas. Although Lhx2 and Lhx9 are highly homologous, they seems to play regulatory roles in different organs. In animals, Lhx2 plays important roles in eye, cerebral cortex, limb, the olfactory organs, and erythrocyte development. Lhx2 gene knockout mice exhibit impaired patterning of the cortical hem and the telencephalon of the developing brain, and a lack of development in olfactory structures. Lhx9 is expressed in several regions of the developing mouse brain , the spinal cord, the pancreas, in limb mesenchyme, and in the urogenital region. Lhx9 plays critical roles in gonad development. Homozygous mice lacking functional Lhx9 alleles exhibit numerous urogenital defects, such as gonadal agenesis, infertility, and undetectable levels of testosterone and estradiol coupled with high FSH levels. Lhx9 null mice are phenotypically female, even those that are genotypically male. As in other LIM domains, this domain family is 50-60 amino acids in size and shares two characteristic zinc finger motifs. The two zinc fingers contain eight conserved residues, mostly cysteines and histidines, which coordinately bond to two zinc atoms. LIM domains function as adaptors or scaffolds to support the assembly of multimeric protein. Length = 54 |
| >gnl|CDD|188853 cd09469, LIM1_Lhx2, The first LIM domain of Lhx2 | Back alignment and domain information |
|---|
| >gnl|CDD|188854 cd09470, LIM1_Lhx9, The first LIM domain of Lhx9 | Back alignment and domain information |
|---|
| >gnl|CDD|188759 cd09373, LIM1_AWH, The first LIM domain of Arrowhead (AWH) | Back alignment and domain information |
|---|
| >gnl|CDD|188754 cd09368, LIM1_Lhx3_Lhx4, The first LIM domain of Lhx3 and Lhx4 family | Back alignment and domain information |
|---|
| >gnl|CDD|188852 cd09468, LIM1_Lhx4, The first LIM domain of Lhx4 | Back alignment and domain information |
|---|
| >gnl|CDD|188753 cd09367, LIM1_Lhx1_Lhx5, The first LIM domain of Lhx1 (also known as Lim1) and Lhx5 | Back alignment and domain information |
|---|
| >gnl|CDD|188772 cd09386, LIM1_LMO4, The first LIM domain of LMO4 (LIM domain only protein 4) | Back alignment and domain information |
|---|
| >gnl|CDD|188711 cd08368, LIM, LIM is a small protein-protein interaction domain, containing two zinc fingers | Back alignment and domain information |
|---|
| >gnl|CDD|188851 cd09467, LIM1_Lhx3b, The first LIM domain of Lhx3b | Back alignment and domain information |
|---|
| >gnl|CDD|188757 cd09371, LIM1_Lmx1b, The first LIM domain of Lmx1b | Back alignment and domain information |
|---|
| >gnl|CDD|188850 cd09466, LIM1_Lhx3a, The first LIM domain of Lhx3a | Back alignment and domain information |
|---|
| >gnl|CDD|188715 cd09329, LIM3_abLIM, The third LIM domain of actin binding LIM (abLIM) proteins | Back alignment and domain information |
|---|
| >gnl|CDD|215907 pfam00412, LIM, LIM domain | Back alignment and domain information |
|---|
| >gnl|CDD|188752 cd09366, LIM1_Isl, The first LIM domain of Isl, a member of LHX protein family | Back alignment and domain information |
|---|
| >gnl|CDD|214528 smart00132, LIM, Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >gnl|CDD|188767 cd09381, LIM1_Lhx7_Lhx8, The first LIM domain of Lhx7 and Lhx8 | Back alignment and domain information |
|---|
| >gnl|CDD|188756 cd09370, LIM1_Lmx1a, The first LIM domain of Lmx1a | Back alignment and domain information |
|---|
| >gnl|CDD|188766 cd09380, LIM1_Lhx6, The first LIM domain of Lhx6 | Back alignment and domain information |
|---|
| >gnl|CDD|188750 cd09364, LIM1_LIMK, The first LIM domain of LIMK (LIM domain Kinase ) | Back alignment and domain information |
|---|
| >gnl|CDD|188774 cd09388, LIM1_LMO1_LMO3, The first LIM domain of LMO1 and LMO3 (LIM domain only protein 1 and 3) | Back alignment and domain information |
|---|
| >gnl|CDD|188770 cd09384, LIM1_LMO2, The first LIM domain of LMO2 (LIM domain only protein 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188724 cd09338, LIM3_Paxillin_like, The third LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188846 cd09462, LIM1_LIMK1, The first LIM domain of LIMK1 (LIM domain Kinase 1) | Back alignment and domain information |
|---|
| >gnl|CDD|188747 cd09361, LIM1_Enigma_like, The first LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188847 cd09463, LIM1_LIMK2, The first LIM domain of LIMK2 (LIM domain Kinase 2) | Back alignment and domain information |
|---|
| >gnl|CDD|188722 cd09336, LIM1_Paxillin_like, The first LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188793 cd09409, LIM3_Paxillin, The third LIM domain of paxillin | Back alignment and domain information |
|---|
| >gnl|CDD|188794 cd09410, LIM3_Leupaxin, The third LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188782 cd09396, LIM_DA1, The Lim domain of DA1 | Back alignment and domain information |
|---|
| >gnl|CDD|188743 cd09357, LIM3_Zyxin_like, The third LIM domain of Zyxin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188869 cd09485, LIM_Eplin_alpha_beta, The Lim domain of Epithelial Protein Lost in Neoplasm (Eplin) | Back alignment and domain information |
|---|
| >gnl|CDD|188783 cd09397, LIM1_UF1, LIM domain in proteins of unknown function | Back alignment and domain information |
|---|
| >gnl|CDD|188742 cd09356, LIM2_TRIP6, The second LIM domain of Thyroid receptor-interacting protein 6 (TRIP6) | Back alignment and domain information |
|---|
| >gnl|CDD|188720 cd09334, LIM4_PINCH, The fourth LIM domain of protein PINCH | Back alignment and domain information |
|---|
| >gnl|CDD|188726 cd09340, LIM1_Testin_like, The first LIM domain of Testin-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188739 cd09353, LIM2_Zyxin, The second LIM domain of Zyxin | Back alignment and domain information |
|---|
| >gnl|CDD|188779 cd09393, LIM3_Lrg1p_like, The third LIM domain of Lrg1p, a LIM and RhoGap domain containing protein | Back alignment and domain information |
|---|
| >gnl|CDD|188749 cd09363, LIM3_Enigma_like, The third LIM domain of Enigma-like family | Back alignment and domain information |
|---|
| >gnl|CDD|188792 cd09408, LIM2_Leupaxin, The second LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188712 cd09326, LIM_CRP_like, The LIM domains of Cysteine Rich Protein (CRP) family | Back alignment and domain information |
|---|
| >gnl|CDD|188790 cd09406, LIM1_Leupaxin, The first LIM domain of Leupaxin | Back alignment and domain information |
|---|
| >gnl|CDD|188723 cd09337, LIM2_Paxillin_like, The second LIM domain of the paxillin like protein family | Back alignment and domain information |
|---|
| >gnl|CDD|188861 cd09477, LIM2_TLP, The second LIM domain of thymus LIM protein (TLP) | Back alignment and domain information |
|---|
| >gnl|CDD|188818 cd09434, LIM4_FHL3, The fourth LIM domain of Four and a half LIM domains protein 3 (FHL3) | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| KOG1701|consensus | 468 | 99.79 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 99.6 | |
| KOG1044|consensus | 670 | 99.58 | ||
| KOG1701|consensus | 468 | 99.57 | ||
| KOG4577|consensus | 383 | 99.49 | ||
| KOG2272|consensus | 332 | 99.46 | ||
| KOG2272|consensus | 332 | 99.46 | ||
| KOG1703|consensus | 479 | 99.3 | ||
| KOG1703|consensus | 479 | 99.12 | ||
| smart00132 | 39 | LIM Zinc-binding domain present in Lin-11, Isl-1, | 98.83 | |
| KOG1044|consensus | 670 | 98.7 | ||
| KOG4577|consensus | 383 | 98.53 | ||
| KOG1700|consensus | 200 | 98.21 | ||
| KOG1700|consensus | 200 | 98.06 | ||
| KOG1702|consensus | 264 | 97.88 | ||
| KOG0490|consensus | 235 | 95.46 | ||
| PF00412 | 58 | LIM: LIM domain; InterPro: IPR001781 Zinc finger ( | 90.0 | |
| PF14446 | 54 | Prok-RING_1: Prokaryotic RING finger family 1 | 88.18 | |
| PF08394 | 37 | Arc_trans_TRASH: Archaeal TRASH domain; InterPro: | 87.21 |
| >KOG1701|consensus | Back alignment and domain information |
|---|
Probab=99.79 E-value=7.4e-21 Score=134.37 Aligned_cols=91 Identities=19% Similarity=0.436 Sum_probs=83.3
Q ss_pred CCCCCCCCCccccccccccCceE-EeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCC
Q psy4350 9 SSPCPEEKSSCGGCGQPIIDRFY-LLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIP 86 (107)
Q Consensus 9 ~~~~~~~~~~C~~C~~~i~~~~~-~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~ 86 (107)
++..+..+..|.+|+|.|+.... +.++++.||..||+|..|++.|.++ .||..++++||+.||.. .. +|.. |+
T Consensus 267 ~~p~~~~~~iC~~C~K~V~g~~~ac~Am~~~fHv~CFtC~~C~r~L~Gq-~FY~v~~k~~CE~cyq~tle--kC~~--Cg 341 (468)
T KOG1701|consen 267 AEPVEDYFGICAFCHKTVSGQGLAVEAMDQLFHVQCFTCRTCRRQLAGQ-SFYQVDGKPYCEGCYQDTLE--KCNK--CG 341 (468)
T ss_pred CChhhhhhhhhhhcCCcccCcchHHHHhhhhhcccceehHhhhhhhccc-cccccCCcccchHHHHHHHH--HHhh--hh
Confidence 45566677799999999987654 6999999999999999999999998 89999999999999999 77 8999 99
Q ss_pred CcchhhhhhhccccCCCC
Q psy4350 87 KTLVSFLYDKQGAASEPL 104 (107)
Q Consensus 87 ~~i~~~~~~~~g~~~~p~ 104 (107)
++|+++++++.|++|||.
T Consensus 342 ~~I~d~iLrA~GkayHp~ 359 (468)
T KOG1701|consen 342 EPIMDRILRALGKAYHPG 359 (468)
T ss_pred hHHHHHHHHhcccccCCC
Confidence 999999999999999995
|
|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG1701|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG2272|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >KOG1703|consensus | Back alignment and domain information |
|---|
| >smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3 | Back alignment and domain information |
|---|
| >KOG1044|consensus | Back alignment and domain information |
|---|
| >KOG4577|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG1700|consensus | Back alignment and domain information |
|---|
| >KOG1702|consensus | Back alignment and domain information |
|---|
| >KOG0490|consensus | Back alignment and domain information |
|---|
| >PF00412 LIM: LIM domain; InterPro: IPR001781 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule | Back alignment and domain information |
|---|
| >PF14446 Prok-RING_1: Prokaryotic RING finger family 1 | Back alignment and domain information |
|---|
| >PF08394 Arc_trans_TRASH: Archaeal TRASH domain; InterPro: IPR013603 This region is found in the C terminus of a number of archaeal transcriptional regulators | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 107 | ||||
| 2jtn_A | 182 | Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Compl | 4e-13 | ||
| 2rgt_A | 169 | Crystal Structure Of Lhx3 Lim Domains 1 And 2 With | 8e-13 | ||
| 3mmk_A | 169 | The Structural Basis For Partial Redundancy In A Cl | 1e-11 | ||
| 1m3v_A | 122 | Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And | 2e-07 | ||
| 2l4z_A | 123 | Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-L | 2e-07 | ||
| 2dfy_X | 195 | Crystal Structure Of A Cyclized Protein Fusion Of L | 3e-07 | ||
| 1rut_X | 188 | Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 L | 4e-07 | ||
| 2dj7_A | 80 | Solution Structure Of 3rd Lim Domain Of Actin-Bindi | 6e-05 | ||
| 1j2o_A | 114 | Structure Of Flin2, A Complex Containing The N-Term | 9e-05 | ||
| 2xjy_A | 131 | Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 | 2e-04 |
| >pdb|2JTN|A Chain A, Nmr Solution Structure Of A Ldb1-Lid:lhx3-Lim Complex Length = 182 | Back alignment and structure |
|
| >pdb|2RGT|A Chain A, Crystal Structure Of Lhx3 Lim Domains 1 And 2 With The Binding Domain Of Isl1 Length = 169 | Back alignment and structure |
| >pdb|3MMK|A Chain A, The Structural Basis For Partial Redundancy In A Class Of Transcription Factors, The Lim-Homeodomain Proteins, In Neural Cell Type Specification Length = 169 | Back alignment and structure |
| >pdb|1M3V|A Chain A, Flin4: Fusion Of The Lim Binding Domain Of Ldb1 And The N- Terminal Lim Domain Of Lmo4 Length = 122 | Back alignment and structure |
| >pdb|2L4Z|A Chain A, Nmr Structure Of Fusion Of Ctip (641-685) To Lmo4-Lim1 (18-82) Length = 123 | Back alignment and structure |
| >pdb|2DFY|X Chain X, Crystal Structure Of A Cyclized Protein Fusion Of Lmo4 Lim Domains 1 And 2 With The Lim Interacting Domain Of Ldb1 Length = 195 | Back alignment and structure |
| >pdb|1RUT|X Chain X, Complex Of Lmo4 Lim Domains 1 And 2 With The Ldb1 Lid Domain Length = 188 | Back alignment and structure |
| >pdb|2DJ7|A Chain A, Solution Structure Of 3rd Lim Domain Of Actin-Binding Lim Protein 3 Length = 80 | Back alignment and structure |
| >pdb|1J2O|A Chain A, Structure Of Flin2, A Complex Containing The N-Terminal Lim Domain Of Lmo2 And Ldb1-Lid Length = 114 | Back alignment and structure |
| >pdb|2XJY|A Chain A, Crystal Structure Of The Lmo2:ldb1-Lid Complex, P21 Crystal Form Length = 131 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 107 | |||
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 2e-21 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 2e-21 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 4e-20 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 7e-06 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 6e-20 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 2e-06 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 7e-20 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 4e-09 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 9e-20 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 9e-18 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 4e-17 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 5e-07 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 4e-17 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 8e-16 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 5e-07 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 1e-15 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 5e-15 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 8e-13 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 3e-12 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 1e-11 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 1e-11 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 2e-11 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 3e-11 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 4e-08 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 4e-11 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 4e-11 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 7e-11 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 9e-11 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 1e-10 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 2e-10 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 3e-10 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 4e-10 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 5e-10 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 7e-10 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 1e-09 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 1e-09 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 1e-09 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 2e-09 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 2e-09 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 3e-09 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 4e-09 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 5e-09 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 3e-08 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 4e-08 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 8e-08 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 9e-08 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 7e-05 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 2e-04 |
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} Length = 123 | Back alignment and structure |
|---|
Score = 80.9 bits (199), Expect = 2e-21
Identities = 24/66 (36%), Positives = 32/66 (48%), Gaps = 1/66 (1%)
Query: 10 SPCPEEKSSCGGCGQPIIDRFYLLAVDRQWHLGCLQCAHCHVPL-HSELSCFSRHGNIYC 68
C GCG I DRF L A+D WH CL+C+ C L S +++ G I C
Sbjct: 55 GSGGLSWKRCAGCGGKIADRFLLYAMDSYWHSRCLKCSSCQAQLGDIGTSSYTKSGMILC 114
Query: 69 KQDFFR 74
+ D+ R
Sbjct: 115 RNDYIR 120
|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} Length = 182 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A Length = 169 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A Length = 131 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 122 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 114 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B Length = 188 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} Length = 126 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 Length = 101 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 Length = 89 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B Length = 66 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A Length = 81 | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A Length = 192 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 82 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 90 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 91 | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 69 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 70 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 80 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 72 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 77 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B Length = 72 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 82 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 76 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 81 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} Length = 77 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 79 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 Length = 73 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} Length = 65 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 99.87 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.85 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 99.84 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.82 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.81 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.79 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.78 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.77 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 99.76 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 99.76 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 99.76 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 99.76 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 99.73 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 99.73 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 99.73 | |
| 1j2o_A | 114 | FLIN2, fusion of rhombotin-2 and LIM domain-bindin | 99.73 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 99.73 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.72 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 99.72 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 99.72 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 99.7 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 99.7 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 99.7 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 99.69 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 99.69 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 99.69 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 99.68 | |
| 1b8t_A | 192 | Protein (CRP1); LIM domain, muscle differentiation | 99.68 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 99.67 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 99.67 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 99.67 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 99.67 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 99.67 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 99.66 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 99.65 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 99.65 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 99.61 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 99.6 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 99.6 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 99.59 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 99.57 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 99.55 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 99.43 | |
| 1rut_X | 188 | Flinc4, fusion protein of LMO4 protein and LIM dom | 99.33 | |
| 2xjy_A | 131 | Rhombotin-2; oncoprotein, T-cell leukemia, proto-o | 99.31 | |
| 2xqn_T | 126 | Testin, TESS; metal-binding protein, cytoskeleton, | 99.28 | |
| 2rgt_A | 169 | Fusion of LIM/homeobox protein LHX3, linker, INSU | 99.16 | |
| 2jtn_A | 182 | LIM domain-binding protein 1, LIM/homeobox protein | 99.12 | |
| 1zfo_A | 31 | LAsp-1; LIM domain, zinc-finger, metal-binding pro | 98.44 | |
| 2ehe_A | 82 | Four and A half LIM domains 3; FHL-3, skeletal mus | 98.41 | |
| 2cuq_A | 80 | Four and A half LIM domains 3; structural genomics | 98.38 | |
| 1x6a_A | 81 | LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc fi | 98.36 | |
| 2egq_A | 77 | FHL1 protein; LIM domain, four and A half LIM doma | 98.33 | |
| 1x3h_A | 80 | Leupaxin; paxillin family, protein-protein interac | 98.32 | |
| 1v6g_A | 81 | Actin binding LIM protein 2; LIM domain, zinc bind | 98.28 | |
| 2cup_A | 101 | Skeletal muscle LIM-protein 1; four and half LIM d | 98.25 | |
| 2dlo_A | 81 | Thyroid receptor-interacting protein 6; LIM domain | 98.19 | |
| 1x63_A | 82 | Skeletal muscle LIM-protein 1; LIM domain, four an | 98.16 | |
| 1wig_A | 73 | KIAA1808 protein; LIM domain, zinc finger, metal-b | 96.59 | |
| 1m3v_A | 122 | FLIN4, fusion of the LIM interacting domain of LDB | 96.45 | |
| 2cur_A | 69 | Skeletal muscle LIM-protein 1; four and A half LIM | 95.07 | |
| 1x68_A | 76 | FHL5 protein; four-and-A-half LIM protein 5, zinc | 94.97 | |
| 2iyb_E | 65 | Testin, TESS, TES; LIM domain, SH3-binding, tumour | 94.97 | |
| 2cor_A | 79 | Pinch protein; LIM domain, particularly interestin | 94.94 | |
| 2dar_A | 90 | PDZ and LIM domain protein 5; enigma homolog prote | 94.88 | |
| 2l3k_A | 123 | Rhombotin-2, linker, LIM domain-binding protein 1; | 94.81 | |
| 1nyp_A | 66 | Pinch protein; LIM domain, protein recognition, ce | 94.8 | |
| 2d8x_A | 70 | Protein pinch; LIM domain, pinch protein, structur | 94.62 | |
| 2d8z_A | 70 | Four and A half LIM domains 2; skeletal muscle LIM | 94.57 | |
| 1wyh_A | 72 | SLIM 2, skeletal muscle LIM-protein 2; structural | 94.55 | |
| 1x62_A | 79 | C-terminal LIM domain protein 1; PDZ and LIM domai | 94.5 | |
| 1x4k_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 94.35 | |
| 1x4l_A | 72 | Skeletal muscle LIM-protein 3; LIM domain, structu | 94.06 | |
| 1iml_A | 76 | CRIP, cysteine rich intestinal protein; metal-bind | 93.88 | |
| 2cu8_A | 76 | Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein | 93.57 | |
| 1x64_A | 89 | Alpha-actinin-2 associated LIM protein; LIM domain | 93.35 | |
| 3f6q_B | 72 | LIM and senescent cell antigen-like-containing dom | 93.14 | |
| 1x61_A | 72 | Thyroid receptor interacting protein 6; LIM domain | 92.75 | |
| 2dj7_A | 80 | Actin-binding LIM protein 3; LIM domain, Zn bindin | 92.71 | |
| 1g47_A | 77 | Pinch protein; LIM domain, Zn finger, cell adhesio | 91.64 | |
| 2co8_A | 82 | NEDD9 interacting protein with calponin homology a | 90.35 | |
| 2cs3_A | 93 | Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s | 90.05 | |
| 2l4z_A | 123 | DNA endonuclease RBBP8, LIM domain transcription L | 90.02 | |
| 1a7i_A | 81 | QCRP2 (LIM1); LIM domain containing proteins, meta | 89.48 | |
| 2ct0_A | 74 | Non-SMC element 1 homolog; ring domain, structural | 85.52 | |
| 2d8y_A | 91 | Eplin protein; LIM domain, epithelial protein LOST | 82.97 | |
| 3nw0_A | 238 | Non-structural maintenance of chromosomes element | 80.89 |
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
Probab=99.87 E-value=1.3e-22 Score=119.95 Aligned_cols=88 Identities=25% Similarity=0.431 Sum_probs=79.2
Q ss_pred CCCCCccccccccccC-ceEEeecCcccccccccccccCCCCCCCCceeccCCeeccHHHHhh-hCCCCCCCCCCCCcch
Q psy4350 13 PEEKSSCGGCGQPIID-RFYLLAVDRQWHLGCLQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YSQARYPDLPIPKTLV 90 (107)
Q Consensus 13 ~~~~~~C~~C~~~i~~-~~~~~~~~~~~H~~Cf~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~~~~C~~~~C~~~i~ 90 (107)
+.+.++|.+|+++|.. .+.+.++++.||+.||+|..|+++|.+. .|+.+++++||+.||.+ |+ ++|.. |+++|.
T Consensus 2 s~~~~~C~~C~~~I~~~~~~~~a~~~~~H~~CF~C~~C~~~L~~~-~~~~~~g~~yC~~cy~~~~~-~~C~~--C~~~I~ 77 (101)
T 2cup_A 2 SSGSSGCVECRKPIGADSKEVHYKNRFWHDTCFRCAKCLHPLANE-TFVAKDNKILCNKCTTREDS-PKCKG--CFKAIV 77 (101)
T ss_dssp CSCCCBCSSSCCBCCSSSCEEEETTEEEETTTCCCSSSCCCTTSS-CCEEETTEEECHHHHTTCCC-CBCSS--SCCBCC
T ss_pred CCCCCcCcccCCcccCCceEEEECccChhhcCCcccccCCCCCcC-eeECcCCEEEChhHhhhhcC-Ccccc--CCCccc
Confidence 3457889999999974 6678999999999999999999999776 78999999999999999 99 79999 999998
Q ss_pred --hhhhhhccccCCCC
Q psy4350 91 --SFLYDKQGAASEPL 104 (107)
Q Consensus 91 --~~~~~~~g~~~~p~ 104 (107)
+..+++.|+.|||-
T Consensus 78 ~~~~~~~a~~~~~H~~ 93 (101)
T 2cup_A 78 AGDQNVEYKGTVWHKD 93 (101)
T ss_dssp SSSCEEESSSCEEETT
T ss_pred cCCeEEEeCCcchHHh
Confidence 56889999999983
|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1j2o_A FLIN2, fusion of rhombotin-2 and LIM domain-binding protein 1; LIM-interaction-domain (LID), metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1b8t_A Protein (CRP1); LIM domain, muscle differentiation, contractIle; NMR {Gallus gallus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 1ibi_A 1qli_A 1cxx_A 1ctl_A 2o13_A | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1rut_X Flinc4, fusion protein of LMO4 protein and LIM domain- binding protein 1; B-tandem zipper, protein binding; 1.30A {Mus musculus} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 g.39.1.3 PDB: 2dfy_X 2xjz_I 2xjy_B | Back alignment and structure |
|---|
| >2xjy_A Rhombotin-2; oncoprotein, T-cell leukemia, proto-oncogene, transcription, developmental protein; 2.40A {Homo sapiens} PDB: 2xjz_A | Back alignment and structure |
|---|
| >2xqn_T Testin, TESS; metal-binding protein, cytoskeleton, focal adhesion, acrosom; 2.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2rgt_A Fusion of LIM/homeobox protein LHX3, linker, INSU enhancer protein ISL-1; protein-protein complex, LIM domain, Zn finger, activator, D binding; 2.05A {Mus musculus} PDB: 3mmk_A | Back alignment and structure |
|---|
| >2jtn_A LIM domain-binding protein 1, LIM/homeobox protein LHX3; intramolecular (fusion) protein-protein complex, protein binding/transcription complex; NMR {Mus musculus} | Back alignment and structure |
|---|
| >1zfo_A LAsp-1; LIM domain, zinc-finger, metal-binding protein; NMR {Sus scrofa} SCOP: g.39.1.4 | Back alignment and structure |
|---|
| >2ehe_A Four and A half LIM domains 3; FHL-3, skeletal muscle LIM- protein 2, SLIM 2, FHL3, SLIM2, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2cuq_A Four and A half LIM domains 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x6a_A LIMK-2, LIM domain kinase 2; LIM-kinase 2, zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2egq_A FHL1 protein; LIM domain, four and A half LIM domains protein 1, skeletal muscle LIM- protein 1, SLIM 1, structural genomics NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x3h_A Leupaxin; paxillin family, protein-protein interaction, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1v6g_A Actin binding LIM protein 2; LIM domain, zinc binding domain, ablim2, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cup_A Skeletal muscle LIM-protein 1; four and half LIM domains protein 1, LIM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dlo_A Thyroid receptor-interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x63_A Skeletal muscle LIM-protein 1; LIM domain, four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wig_A KIAA1808 protein; LIM domain, zinc finger, metal-binding protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1m3v_A FLIN4, fusion of the LIM interacting domain of LDB1 and the N-terminal LIM domain of LMO4...; fusion protein, LMO proteins, metal binding protein; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cur_A Skeletal muscle LIM-protein 1; four and A half LIM domains protein 1, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x68_A FHL5 protein; four-and-A-half LIM protein 5, zinc finger domain, AN actin- interacting protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2iyb_E Testin, TESS, TES; LIM domain, SH3-binding, tumour supressor LIM domain EVH1 DO cell motility, phosphorylation, cytoskeleton; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >2cor_A Pinch protein; LIM domain, particularly interesting NEW Cys- His protein, LIM and senescent cell antigen-like domains 1, structural genomics; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dar_A PDZ and LIM domain protein 5; enigma homolog protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1nyp_A Pinch protein; LIM domain, protein recognition, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 PDB: 1u5s_B | Back alignment and structure |
|---|
| >2d8x_A Protein pinch; LIM domain, pinch protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2d8z_A Four and A half LIM domains 2; skeletal muscle LIM-protein 3, LIM-domain protein DRAL, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1wyh_A SLIM 2, skeletal muscle LIM-protein 2; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x62_A C-terminal LIM domain protein 1; PDZ and LIM domain protein 1, LIM domain protein CLP-36, contractIle protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4k_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x4l_A Skeletal muscle LIM-protein 3; LIM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1iml_A CRIP, cysteine rich intestinal protein; metal-binding protein, LIM domain protein; NMR {Rattus rattus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cu8_A Cysteine-rich protein 2; CRP2, CRIP2, ESP1 protein, zinc-binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1x64_A Alpha-actinin-2 associated LIM protein; LIM domain, PDZ and LIM domain 3, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3f6q_B LIM and senescent cell antigen-like-containing domain protein 1; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 2kbx_B 3ixe_B | Back alignment and structure |
|---|
| >1x61_A Thyroid receptor interacting protein 6; LIM domain, OPA-interacting protein 1, zyxin related protein 1 (ZRP-1), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2dj7_A Actin-binding LIM protein 3; LIM domain, Zn binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >1g47_A Pinch protein; LIM domain, Zn finger, cell adhesion; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2co8_A NEDD9 interacting protein with calponin homology and LIM domains; zinc finger protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 | Back alignment and structure |
|---|
| >2l4z_A DNA endonuclease RBBP8, LIM domain transcription LMO4; protein-protein interaction, LIM-interaction DOM LMO4, RBBP8/CTIP, LIM-only protein; HET: DNA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1a7i_A QCRP2 (LIM1); LIM domain containing proteins, metal-binding protein, zinc finger; NMR {Coturnix japonica} SCOP: g.39.1.3 g.39.1.3 PDB: 2o10_A | Back alignment and structure |
|---|
| >2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d8y_A Eplin protein; LIM domain, epithelial protein LOST in neoplasm, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: g.39.1.3 g.39.1.3 | Back alignment and structure |
|---|
| >3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 107 | ||||
| d1rutx1 | 30 | g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus m | 8e-10 | |
| d1j2oa1 | 30 | g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus m | 1e-09 | |
| d2dj7a2 | 36 | g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abL | 2e-06 | |
| d2dara2 | 45 | g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, En | 0.002 | |
| d1x3ha1 | 35 | g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [ | 0.003 |
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: LIM only 4 (Lmo4) species: Mouse (Mus musculus) [TaxId: 10090]
Score = 47.8 bits (114), Expect = 8e-10
Identities = 15/26 (57%), Positives = 16/26 (61%)
Query: 19 CGGCGQPIIDRFYLLAVDRQWHLGCL 44
C GCG I DRF L A+D WH CL
Sbjct: 5 CAGCGGKIADRFLLYAMDSYWHSRCL 30
|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} Length = 30 | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 36 | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} Length = 45 | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} Length = 35 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 107 | |||
| d1g47a2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.79 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.67 | |
| d1x3ha1 | 35 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.63 | |
| d1b8ta4 | 49 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.61 | |
| d1b8ta3 | 43 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.6 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.59 | |
| d2dloa1 | 35 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 98.58 | |
| d1b8ta2 | 65 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 98.58 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.53 | |
| d1rutx1 | 30 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 98.5 | |
| d2cu8a1 | 30 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 98.49 | |
| d1zfoa_ | 30 | LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | 98.48 | |
| d2d8ya1 | 35 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.47 | |
| d2dj7a2 | 36 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.47 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 98.45 | |
| d2co8a2 | 36 | Nedd9 interacting protein with calponin homology, | 98.44 | |
| d1ibia2 | 31 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.41 | |
| d2d8za2 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.39 | |
| d1j2oa1 | 30 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 98.37 | |
| d1imla2 | 48 | Cysteine-rich (intestinal) protein, CRP, CRIP {Rat | 98.27 | |
| d2dj7a1 | 31 | Actin-binding LIM protein 3, abLIM-3 {Human (Homo | 98.24 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 98.21 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.21 | |
| d2cuqa1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 98.2 | |
| d2d8za1 | 26 | Four and a half LIM domains protein 2, FHL2 {Human | 98.2 | |
| d1x3ha2 | 32 | Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | 98.18 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.15 | |
| d2cura2 | 26 | Four and a half LIM domains protein 1, FHL-1 {Huma | 98.14 | |
| d2dara1 | 32 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 98.13 | |
| d1ibia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 98.1 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 98.09 | |
| d1u5sb2 | 35 | Pinch (particularly interesting new Cys-His) prote | 98.05 | |
| d1x4ka1 | 32 | Four and a half LIM domains protein 2, FHL2 {Human | 98.0 | |
| d2d8ya2 | 42 | Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | 98.0 | |
| d1x4ka2 | 27 | Four and a half LIM domains protein 2, FHL2 {Human | 97.99 | |
| d1u5sb1 | 31 | Pinch (particularly interesting new Cys-His) prote | 97.97 | |
| d2cura1 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.94 | |
| d1a7ia2 | 32 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.94 | |
| d1wyha1 | 32 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.93 | |
| d1rutx3 | 31 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 97.93 | |
| d1x61a2 | 32 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.85 | |
| d1wyha2 | 27 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.83 | |
| d1x4la1 | 29 | Four and a half LIM domains protein 2, FHL2 {Human | 97.82 | |
| d2dara2 | 45 | PDZ and LIM domain protein 5, Enigma {Human (Homo | 97.82 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 97.76 | |
| d1b8ta1 | 35 | Cysteine-rich (intestinal) protein, CRP, CRIP {Chi | 97.74 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 97.7 | |
| d2cu8a2 | 33 | Cysteine-rich (intestinal) protein, CRP, CRIP {Hum | 97.66 | |
| d1x68a1 | 29 | Four and a half LIM domains protein 5, FHL-5 {Huma | 97.65 | |
| d1a7ia1 | 28 | Cysteine-rich (intestinal) protein, CRP, CRIP {Jap | 97.64 | |
| d2dloa2 | 33 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 97.64 | |
| d2cuqa2 | 35 | Four and a half LIM domains 3, FHL3 {Human (Homo s | 97.48 | |
| d2cupa3 | 27 | Four and a half LIM domains protein 1, FHL-1 {Huma | 97.43 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 97.02 | |
| d1x63a2 | 32 | Four and a half LIM domains protein 1, FHL-1 {Huma | 96.93 | |
| d1rutx2 | 34 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.91 | |
| d1x64a2 | 31 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.81 | |
| d1v6ga1 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 96.74 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 96.69 | |
| d1wiga1 | 32 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 96.67 | |
| d1rutx4 | 33 | LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10 | 96.65 | |
| d2d8xa2 | 26 | Pinch (particularly interesting new Cys-His) prote | 96.61 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 96.55 | |
| d1x62a2 | 35 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 96.37 | |
| d1x64a1 | 45 | PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus m | 96.13 | |
| d1x6aa2 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 96.07 | |
| d2cora1 | 31 | Pinch (particularly interesting new Cys-His) prote | 95.97 | |
| d1x62a1 | 31 | PDZ and LIM domain protein 1 Elfin {Human (Homo sa | 95.77 | |
| d1x63a1 | 37 | Four and a half LIM domains protein 1, FHL-1 {Huma | 95.3 | |
| d1x61a1 | 27 | Thyroid receptor interacting protein 6, TRIP6 {Hum | 95.29 | |
| d2d8xa1 | 32 | Pinch (particularly interesting new Cys-His) prote | 94.91 | |
| d1x68a2 | 34 | Four and a half LIM domains protein 5, FHL-5 {Huma | 94.82 | |
| d1g47a1 | 35 | Pinch (particularly interesting new Cys-His) prote | 94.72 | |
| d1wiga2 | 41 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 94.53 | |
| d2cupa2 | 31 | Four and a half LIM domains protein 1, FHL-1 {Huma | 94.5 | |
| d1x6aa1 | 34 | Lim domain kinase 2 {Human (Homo sapiens) [TaxId: | 94.07 | |
| d2cora2 | 35 | Pinch (particularly interesting new Cys-His) prote | 93.89 | |
| d1v6ga2 | 40 | Actin-binding LIM protein 2, abLIM2 {Human (Homo s | 92.58 | |
| d1j2oa2 | 33 | Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 1 | 92.03 | |
| d1x4la2 | 30 | Four and a half LIM domains protein 2, FHL2 {Human | 91.15 | |
| d2cs3a1 | 80 | Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ | 87.63 | |
| d1jm7b_ | 97 | bard1 RING domain {Human (Homo sapiens) [TaxId: 96 | 83.1 | |
| d2gvia2 | 33 | Uncharacterized protein Ta1109 {Thermoplasma acido | 82.0 |
| >d1g47a2 g.39.1.3 (A:36-70) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Small proteins fold: Glucocorticoid receptor-like (DNA-binding domain) superfamily: Glucocorticoid receptor-like (DNA-binding domain) family: LIM domain domain: Pinch (particularly interesting new Cys-His) protein species: Human (Homo sapiens) [TaxId: 9606]
Probab=98.79 E-value=1.1e-09 Score=50.94 Aligned_cols=32 Identities=25% Similarity=0.680 Sum_probs=30.3
Q ss_pred ccccccCCCCCCCCceeccCCeeccHHHHhh-hC
Q psy4350 44 LQCAHCHVPLHSELSCFSRHGNIYCKQDFFR-YS 76 (107)
Q Consensus 44 f~C~~C~~~l~~~~~~~~~~~~~~C~~~y~~-~~ 76 (107)
|+|..|++++.+. .|++++|++||+.||.+ |+
T Consensus 1 F~C~~C~~~f~~~-~F~e~~G~pYCe~~Y~~lFA 33 (35)
T d1g47a2 1 FVCAQCFQQFPEG-LFYEFEGRKYCEHDFQMLFA 33 (35)
T ss_dssp CCCTTTCCCCGGG-CSEEETTEEECHHHHHHHCC
T ss_pred CCCCCCcCCCCCC-CeEEECCEecChHhHHhhcC
Confidence 7899999999987 89999999999999999 98
|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha1 g.39.1.3 (A:8-42) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta4 g.39.1.3 (A:144-192) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1b8ta3 g.39.1.3 (A:101-143) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dloa1 g.39.1.3 (A:8-42) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta2 g.39.1.3 (A:36-100) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx1 g.39.1.3 (X:19-48) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cu8a1 g.39.1.3 (A:8-37) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1zfoa_ g.39.1.4 (A:) LASP-1 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d2d8ya1 g.39.1.3 (A:9-43) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dj7a2 g.39.1.3 (A:8-43) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2co8a2 g.39.1.3 (A:8-43) Nedd9 interacting protein with calponin homology, NICAL (MICAL1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia2 g.39.1.3 (A:145-175) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2d8za2 g.39.1.3 (A:33-64) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa1 g.39.1.3 (A:1-30) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1imla2 g.39.1.3 (A:29-76) Cysteine-rich (intestinal) protein, CRP, CRIP {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d2dj7a1 g.39.1.3 (A:44-74) Actin-binding LIM protein 3, abLIM-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa1 g.39.1.3 (A:43-74) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x3ha2 g.39.1.3 (A:43-74) Leupaxin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara1 g.39.1.3 (A:53-84) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ibia1 g.39.1.3 (A:117-144) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb2 g.39.1.3 (B:103-137) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka1 g.39.1.3 (A:35-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8ya2 g.39.1.3 (A:44-85) Eplin, LIMA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4ka2 g.39.1.3 (A:8-34) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5sb1 g.39.1.3 (B:72-102) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cura1 g.39.1.3 (A:33-63) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia2 g.39.1.3 (A:36-67) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d1wyha1 g.39.1.3 (A:35-66) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx3 g.39.1.3 (X:83-113) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x61a2 g.39.1.3 (A:35-66) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wyha2 g.39.1.3 (A:8-34) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x4la1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2dara2 g.39.1.3 (A:8-52) PDZ and LIM domain protein 5, Enigma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1b8ta1 g.39.1.3 (A:1-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cu8a2 g.39.1.3 (A:38-70) Cysteine-rich (intestinal) protein, CRP, CRIP {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a1 g.39.1.3 (A:8-36) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a7ia1 g.39.1.3 (A:8-35) Cysteine-rich (intestinal) protein, CRP, CRIP {Japanese quail (Coturnix coturnix japonica), CRP2 [TaxId: 93934]} | Back information, alignment and structure |
|---|
| >d2dloa2 g.39.1.3 (A:43-75) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cuqa2 g.39.1.3 (A:8-42) Four and a half LIM domains 3, FHL3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa3 g.39.1.3 (A:8-34) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a2 g.39.1.3 (A:45-76) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx2 g.39.1.3 (X:49-82) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x64a2 g.39.1.3 (A:53-83) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1v6ga1 g.39.1.3 (A:1-41) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga1 g.39.1.3 (A:1-32) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rutx4 g.39.1.3 (X:114-146) LIM only 4 (Lmo4) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2d8xa2 g.39.1.3 (A:8-32) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a2 g.39.1.3 (A:8-42) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x64a1 g.39.1.3 (A:8-52) PDZ and LIM domain protein 3, PDLIM3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6aa2 g.39.1.3 (A:42-75) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora1 g.39.1.3 (A:43-73) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x62a1 g.39.1.3 (A:43-73) PDZ and LIM domain protein 1 Elfin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x63a1 g.39.1.3 (A:8-44) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x61a1 g.39.1.3 (A:8-34) Thyroid receptor interacting protein 6, TRIP6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2d8xa1 g.39.1.3 (A:33-64) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x68a2 g.39.1.3 (A:37-70) Four and a half LIM domains protein 5, FHL-5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1g47a1 g.39.1.3 (A:1-35) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wiga2 g.39.1.3 (A:33-73) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cupa2 g.39.1.3 (A:35-65) Four and a half LIM domains protein 1, FHL-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1x6aa1 g.39.1.3 (A:8-41) Lim domain kinase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cora2 g.39.1.3 (A:8-42) Pinch (particularly interesting new Cys-His) protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1v6ga2 g.39.1.3 (A:42-81) Actin-binding LIM protein 2, abLIM2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j2oa2 g.39.1.3 (A:31-63) Rhombotin-2 (Lmo2) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x4la2 g.39.1.3 (A:37-66) Four and a half LIM domains protein 2, FHL2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gvia2 g.39.1.18 (A:169-201) Uncharacterized protein Ta1109 {Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|