Diaphorina citri psyllid: psy4354

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340--

MIQLLFTGVLSHYNVDMLGYSTVIMFVDKYWAVTNVDYIHTRNANRIIMMIVVVWSVAFIVSLAPQLGWKDPEYMDRINQQKCMVSQDVGYQIFATCSTFYVPLLVILVLYWKIYQTARKRIRRRRQQRNVLMAGKKPDTSDNKTSHFIFFKKRKFFRIKKCTNVVPPSPNKLSINVIDEDNGINNATTSSSLILADGHSNSDADRRTSINNEANTAFTITHNNGASQSNHNNECVQVKHKIPPTKKEKKESLEAKRERKAAKTLAIITGAFVICWLPFFMMALLLPLCQTCYISDYLASFFLWLGYFNSTLNPVIYTVFSPEFRQAFKRILCGSPNRGRFR

cccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccEEEccccEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccHHHHHcccHHHHHHHHHHHHccccccccc

MIQLLFTGVLSHYNVDMLGYSTVIMFVDKYWAVTNVDYIHTRNANRIIMMIVVVWSVAFIVSLAPQLGWKDPEYMDRINQQKCMVSQDVGYQIFATCSTFYVPLLVILVLYWKIYQTARKRIRRRR*************************************************NVIDEDNGINNATT**********************************************************************KAAKTLAIITGAFVICWLPFFMMALLLPLCQTCYISDYLASFFLWLGYFNSTLNPVIYTVFSPEFRQAFKRILCGSPNRG***

xxxxxxxxxxxxxxxHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
5-hydroxytryptamine receptor 1A	This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.	confident	Q9N298
5-hydroxytryptamine receptor 1A	This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.	confident	Q0EAB6
5-hydroxytryptamine receptor 1A	This is one of the several different receptors for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity.	confident	Q64264

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0050794 [BP]	regulation of cellular process	probable	GO:0008150, GO:0065007, GO:0050789
GO:0016020 [CC]	membrane	probable	GO:0005575
GO:0050896 [BP]	response to stimulus	probable	GO:0008150
GO:0044699 [BP]	single-organism process	probable	GO:0008150

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3EML, chain A
Confidence level:very confident
Coverage over the Query: 4-134,145-150,180-339
View the alignment between query and template
View the model in PyMOL