Diaphorina citri psyllid: psy4382


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MIKEHGVYINMDLPAGSVVEFLVGFTNKGKQDFTLDTLDASLRYPMDFNFYIQNFSTIIYNRIVKPGHEATLGYSFVPAEAVAGRPFGLSVNLQYRDEHNNFFYEGIYNETVNIITLGYSFVPAEAVAGRPFGLSVNLQYRDEHNNFFYEGIYNETVNIIEIDEGLDGETFFLYVFLGACVVLLLVIGQHFLYSVGKKRVGTAQSKKQTVETGTKNSKDIDYDWIPKESLNSLKNLTNSPKSPSVHKIDMIPTSQYLK
cccccccccccccccccEEEEEEEEECcccccEEEEEEEEEEcccccccEEEEEEEEEEEEEECccccEEEEEEEEcccccccccCEEEEEEEEEEcccccEEEEEEEcccEEEEEccccccccccccccccccEEEEEEcccccccccccEEccEEEEEEEccccccEEEEEHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEcccccccccccccccHHHHHHHHcccccccccccccccccccccccc
*****GVYINMDLPAGSVVEFLVGFTNKGKQDFTLDTLDASLRYPMDFNFYIQNFSTIIYNRIVKPGHEATLGYSFVPAEAVAGRPFGLSVNLQYRDEHNNFFYEGIYNETVNIITLGYSFVPAEAVAGRPFGLSVNLQYRDEHNNFFYEGIYNETVNIIEIDEGLDGETFFLYVFLGACVVLLLVIGQHFLYSVG***********************IDYDWI*********************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKEHGVYINMDLPAGSVVEFLVGFTNKGKQDFTLDTLDASLRYPMDFNFYIQNFSTIIYNRIVKPGHEATLGYSFVPAEAVAGRPFGLSVNLQYRDEHNNFFYEGIYNETVNIITLGYSFVPAEAVAGRPFGLSVNLQYRDEHNNFFYEGIYNETVNIIEIDEGLDGETFFLYVFLGACVVLLLVIGQHFLYSVGKKRVGTAQSKKQTVETGTKNSKDIDYDWIPKESLNSLKNLTNSPKSPSVHKIDMIPTSQYLK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Translocon-associated protein subunit alpha TRAP proteins are part of a complex whose function is to bind calcium to the ER membrane and thereby regulate the retention of ER resident proteins. May be involved in the recycling of the translocation apparatus after completion of the translocation process or may function as a membrane-bound chaperone facilitating folding of translocated proteins.confidentQ5R4X4

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005783 [CC]endoplasmic reticulumprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0045169 [CC]fusomeprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0005811 [CC]lipid particleprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ISY, chain A
Confidence level:probable
Coverage over the Query: 15-93
View the alignment between query and template
View the model in PyMOL