Diaphorina citri psyllid: psy4385


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MAYGLMQSAVIDSKRIRMVESKAIDLTDDGGVLKEIKTPGVGDTTPSAGCKVKVHYTGTLLDGTVFDSSKTRGEPFEFDLGKGQVIKAWDRGIATMKKDEVAVFTCKPEYAYGKQGSPPTIPPDSTLVFEVEMISWEAEDISPTHDGGIRREILEEGASFSTPKDGANVEITLKGECEGKVFQEGTFSFVLGEGSEYDIPENLEKALEKFKYKEKSRLFVQPQHLWSGKGNDKLGVPSNKPATYTITMNNFEKIKDTWQLNSDEKLEQGKLLKERGTTYFKQDKFELACRNYKKAIPYLDFDGGFEGEQETERKKTLTACHLNAAMCLLKLKQAKPAKDQCDKAIELEPNNEKAFFRRGNAYLDLNEPELAEKDFQKVLQIDPNNKAAVQKLTQTKQKLREQKIKEKQVYANMFDKFAKHDTEKEEEEKKKEPDVMKTLGEWGAEERGRESTNFEKENPNIFMLDGTGDFKNM
cccccccccccccccEEEcccccCCccccccEEEEEEEccccccccccccEEEEEEEEEEccccEEEccccccccEEEEcccccccccHHHHHcccccccEEEEEEccccccccccccccccccccEEEEEEEccccccccccccccccEEEEEEccccccccccccEEEEEEEEEEccCEECcccEEEEEcccccccccHHHHHHHHHcccccEEEEEEcccccccccccccccccccccEEEEEEEcccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHcccccHHHHHccccccccccccccccccccccccccccccccccc
*AYG***SAVIDSKRIRMVESKAIDLTDDGGVLKEIKTPGVGDTTPSAGCKVKVHYTGTLLDGTVFDSSKTRGEPFEFDLGKGQVIKAWDRGIATMKKDEVAVFTCKPEYAYGKQGSPPTIPPDSTLVFEVEMISWEAEDISPTHDGGIRREILEEGASFSTPKDGANVEITLKGECEGKVFQEGTFSFVLGEGSEYDIPENLEKALEKFKYKEKSRLFVQPQHLWSGKGNDKLGVPSNKPATYTITMNNFEKIKDTWQLNSDEKLEQGKLLKERGTTYFKQDKFELACRNYKKAIPYLDFDGGFE********KTLTACHLNAAMCLLKLKQAKPAKDQCDKAIELEPNNEKAFFRRGNAYLDLNEPELAEKDFQKVLQIDPNNKAAVQKLTQTKQKLRE**IKEKQVYANM************************************************FMLDG***FK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYGLMQSAVIDSKRIRMVESKAIDLTDDGGVLKEIKTPGVGDTTPSAGCKVKVHYTGTLLDGTVFDSSKTRGEPFEFDLGKGQVIKAWDRGIATMKKDEVAVFTCKPEYAYGKQGSPPTIPPDSTLVFEVEMISWEAEDISPTHDGGIRREILEEGASFSTPKDGANVEITLKGECEGKVFQEGTFSFVLGEGSEYDIPENLEKALEKFKYKEKSRLFVQPQHLWSGKGNDKLGVPSNKPATYTITMNNFEKIKDTWQLNSDEKLEQGKLLKERGTTYFKQDKFELACRNYKKAIPYLDFDGGFEGEQETERKKTLTACHLNAAMCLLKLKQAKPAKDQCDKAIELEPNNEKAFFRRGNAYLDLNEPELAEKDFQKVLQIDPNxxxxxxxxxxxxxxxxxxxxxxxxxYANMFDKFAKHDTEKEEEEKKKEPDVMKTLGEWGAEERGRESTNFEKENPNIFMLDGTGDFKNM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase FKBP4 Immunophilin protein with PPIase and co-chaperone activities (By similarity). Component of unligated steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90) (By similarity). May play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments (By similarity). The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening (By similarity). Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly.confidentQ9TRY0
Peptidyl-prolyl cis-trans isomerase FKBP4 Immunophilin protein with PPIase and co-chaperone activities. Component of unligated steroid receptors heterocomplexes thought interaction with heat-shock protein 90 (HSP90) (By similarity). May play a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments. The isomerase activity controls neuronal growth cones via regulation of TRPC1 channel opening (By similarity). Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly.confidentP27124
Peptidyl-prolyl cis-trans isomerase FKBP4 Immunophilin protein with PPIase and co-chaperone activities (By similarity). Component of unligated steroid receptors heterocomplexes through interaction with heat-shock protein 90 (HSP90) (By similarity). Plays a role in the intracellular trafficking of heterooligomeric forms of steroid hormone receptors between cytoplasm and nuclear compartments (By similarity). Acts also as a regulator of microtubule dynamics by inhibiting MAPT/TAU ability to promote microtubule assembly. The PPIase activity controls neuronal growth cones via regulation of TRPC1 channel opening.confidentQ9QVC8

Prediction of Gene Ontology Terms ?

GO Term ?Description ?Confidence Level ?Parent GO Terms ?
GO:0005634 [CC]nucleusconfidentGO:0043231, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0043229, GO:0044424, GO:0043227, GO:0043226
GO:0009987 [BP]cellular processconfidentGO:0008150
GO:0048471 [CC]perinuclear region of cytoplasmprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0031072 [MF]heat shock protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0043025 [CC]neuronal cell bodyprobableGO:0005575, GO:0097458, GO:0044297, GO:0005623, GO:0044464
GO:0006463 [BP]steroid hormone receptor complex assemblyprobableGO:0022607, GO:0071822, GO:0070271, GO:0043933, GO:0006461, GO:0016043, GO:0065003, GO:0044085, GO:0008150, GO:0034622, GO:0043623, GO:0071840
GO:0044295 [CC]axonal growth coneprobableGO:0044464, GO:0044463, GO:0030427, GO:0030426, GO:0005623, GO:0030424, GO:0005575, GO:0097458, GO:0043005, GO:0033267, GO:0042995
GO:0005829 [CC]cytosolprobableGO:0005737, GO:0044464, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424
GO:0061077 [BP]chaperone-mediated protein foldingprobableGO:0044267, GO:0006457, GO:0044260, GO:0044238, GO:0019538, GO:0009987, GO:0044237, GO:0043170, GO:0071704, GO:0008150, GO:0008152
GO:0051924 [BP]regulation of calcium ion transportprobableGO:0051049, GO:0010959, GO:0065007, GO:0008150, GO:0032879, GO:0050789, GO:0043269
GO:0005524 [MF]ATP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0030554, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032553, GO:0032559, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0005525 [MF]GTP bindingprobableGO:0043168, GO:0003674, GO:0005488, GO:0019001, GO:0035639, GO:0097159, GO:1901363, GO:0043167, GO:0036094, GO:0032561, GO:0032553, GO:0001883, GO:0032549, GO:0032555, GO:0017076, GO:0000166, GO:0032550, GO:1901265, GO:0001882
GO:0035259 [MF]glucocorticoid receptor bindingprobableGO:0035258, GO:0035257, GO:0003674, GO:0005488, GO:0005515, GO:0051427, GO:0005102
GO:0005730 [CC]nucleolusprobableGO:0005575, GO:0043232, GO:0031981, GO:0043233, GO:0005634, GO:0044464, GO:0031974, GO:0005622, GO:0044446, GO:0070013, GO:0043229, GO:0043228, GO:0044428, GO:0005623, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0010977 [BP]negative regulation of neuron projection developmentprobableGO:0010975, GO:0030154, GO:0051129, GO:0051128, GO:0031345, GO:0050789, GO:0044699, GO:0050767, GO:0048869, GO:0060284, GO:0031344, GO:0045664, GO:0065007, GO:0048519, GO:0032502, GO:0032501, GO:0050793, GO:0009987, GO:0050794, GO:0045595, GO:0008150, GO:0051239, GO:0048731, GO:0022008, GO:0048699, GO:0044707, GO:0007399, GO:0048856, GO:0051960, GO:2000026, GO:0007275, GO:0044763, GO:0048523
GO:0051219 [MF]phosphoprotein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0048156 [MF]tau protein bindingprobableGO:0003674, GO:0005488, GO:0005515, GO:0008092
GO:0031503 [BP]protein complex localizationprobableGO:0033036, GO:0008104, GO:0008150, GO:0051179
GO:0030850 [BP]prostate gland developmentprobableGO:0032502, GO:0032501, GO:0048608, GO:0000003, GO:0044707, GO:0022414, GO:0061458, GO:0048856, GO:0044767, GO:0003006, GO:0048513, GO:0008150, GO:0001655, GO:0048731, GO:0048732, GO:0007275, GO:0044699
GO:0030674 [MF]protein binding, bridgingprobableGO:0003674, GO:0005488, GO:0005515, GO:0060090
GO:0005773 [CC]vacuoleprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0005874 [CC]microtubuleprobableGO:0043234, GO:0005856, GO:0015630, GO:0032991, GO:0005575, GO:0043232, GO:0044464, GO:0005623, GO:0005622, GO:0044446, GO:0043229, GO:0044430, GO:0044424, GO:0043228, GO:0043226, GO:0044422
GO:0046661 [BP]male sex differentiationprobableGO:0032502, GO:0007548, GO:0032501, GO:0000003, GO:0044707, GO:0022414, GO:0003006, GO:0008150, GO:0007275, GO:0044699
GO:0016529 [CC]sarcoplasmic reticulumprobableGO:0005737, GO:0005783, GO:0043229, GO:0044464, GO:0016528, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0043231
GO:0050908 [BP]detection of light stimulus involved in visual perceptionprobableGO:0009582, GO:0009581, GO:0050962, GO:0009583, GO:0009584, GO:0051606, GO:0009605, GO:0009628, GO:0050877, GO:0050896, GO:0007601, GO:0007600, GO:0050953, GO:0008150, GO:0032501, GO:0050906, GO:0009314, GO:0009416, GO:0044707, GO:0044699, GO:0003008
GO:0016027 [CC]inaD signaling complexprobableGO:0019897, GO:0043234, GO:0016028, GO:0032991, GO:0044463, GO:0044464, GO:0005623, GO:0019898, GO:0005575, GO:0071944, GO:0005886, GO:0044425, GO:0016020, GO:0042995, GO:0044459
GO:0009792 [BP]embryo development ending in birth or egg hatchingprobableGO:0032502, GO:0032501, GO:0044707, GO:0048856, GO:0044767, GO:0009790, GO:0008150, GO:0007275, GO:0044699
GO:0080025 [MF]phosphatidylinositol-3,5-bisphosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0044432 [CC]endoplasmic reticulum partprobableGO:0005737, GO:0005575, GO:0005783, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0044446, GO:0044444, GO:0044424, GO:0043227, GO:0043226, GO:0044422, GO:0043231
GO:0032767 [MF]copper-dependent protein bindingprobableGO:0003674, GO:0005488, GO:0005515
GO:0000413 [BP]protein peptidyl-prolyl isomerizationprobableGO:0044267, GO:0018208, GO:0044260, GO:0044238, GO:0019538, GO:0044237, GO:0009987, GO:0006464, GO:0043170, GO:0071704, GO:0043412, GO:0036211, GO:0008150, GO:0018193, GO:0008152
GO:0040011 [BP]locomotionprobableGO:0008150
GO:0019220 [BP]regulation of phosphate metabolic processprobableGO:0019222, GO:0031323, GO:0050794, GO:0051174, GO:0065007, GO:0008150, GO:0050789
GO:0031115 [BP]negative regulation of microtubule polymerizationprobableGO:0031110, GO:0031111, GO:0031113, GO:0033043, GO:0051129, GO:0051128, GO:0032886, GO:0050789, GO:0044699, GO:0051494, GO:0051493, GO:0065007, GO:0032271, GO:0032272, GO:0048519, GO:0031333, GO:0009987, GO:0050794, GO:0044763, GO:0043254, GO:0010639, GO:0044087, GO:0008150, GO:0070507, GO:0048523
GO:0048518 [BP]positive regulation of biological processprobableGO:0008150, GO:0065007, GO:0050789
GO:0033554 [BP]cellular response to stressprobableGO:0051716, GO:0050896, GO:0009987, GO:0006950, GO:0044763, GO:0008150, GO:0044699
GO:0007566 [BP]embryo implantationprobableGO:0032502, GO:0044703, GO:0044702, GO:0000003, GO:0044707, GO:0044706, GO:0007565, GO:0022414, GO:0032501, GO:0008150, GO:0007275, GO:0044699, GO:0051704
GO:0032266 [MF]phosphatidylinositol-3-phosphate bindingprobableGO:0043168, GO:0035091, GO:0005543, GO:0008289, GO:0043167, GO:0003674, GO:0005488, GO:1901981
GO:0005528 [MF]FK506 bindingprobableGO:0097159, GO:1901363, GO:0008144, GO:0003674, GO:0005488, GO:0005527
GO:0005739 [CC]mitochondrionprobableGO:0005737, GO:0043231, GO:0044464, GO:0043229, GO:0005623, GO:0005622, GO:0005575, GO:0044444, GO:0044424, GO:0043227, GO:0043226
GO:0006825 [BP]copper ion transportprobableGO:0006810, GO:0006812, GO:0006811, GO:0000041, GO:0044765, GO:0030001, GO:0008150, GO:0051234, GO:0051179, GO:0044699
GO:0003755 [MF]peptidyl-prolyl cis-trans isomerase activityprobableGO:0003824, GO:0003674, GO:0016853, GO:0016859
GO:0002009 [BP]morphogenesis of an epitheliumprobableGO:0032502, GO:0048856, GO:0060429, GO:0009888, GO:0044767, GO:0008150, GO:0048729, GO:0009653, GO:0044699
GO:0030521 [BP]androgen receptor signaling pathwayprobableGO:0044700, GO:0051716, GO:0030522, GO:0050896, GO:0009987, GO:0050794, GO:0008150, GO:0065007, GO:0044763, GO:0007165, GO:0023052, GO:0030518, GO:0007154, GO:0050789, GO:0044699
GO:0007422 [BP]peripheral nervous system developmentprobableGO:0032502, GO:0032501, GO:0044707, GO:0007399, GO:0048856, GO:0008150, GO:0048731, GO:0007275, GO:0044699

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
5.-.-.-Isomerases.probable
5.2.-.-Cis-trans-isomerases.probable
5.2.1.-Cis-trans Isomerases.probable
5.2.1.8Peptidylprolyl isomerase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 261-297,313-402
View the alignment between query and template
View the model in PyMOL
Template: 2XPI, chain A
Confidence level:very confident
Coverage over the Query: 249-414
View the alignment between query and template
View the model in PyMOL
Template: 3JXV, chain A
Confidence level:very confident
Coverage over the Query: 137-254
View the alignment between query and template
View the model in PyMOL
Template: 1KT0, chain A
Confidence level:very confident
Coverage over the Query: 32-413
View the alignment between query and template
View the model in PyMOL