Diaphorina citri psyllid: psy4417

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440

MEHPPHPLKKILGTGLSPCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENVSSPEDLQIEVVKSDGNIQFTIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLMSRSFPDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQVDSRPTILMVKCASP

cccccccEEEEEcccccccEEEEEEcccccEEEEEEccccccHcccccccccEEEEEccCCcccHHHHHHHHHHccccCEEEEccccccccccccccccccEEEECcccccccccccccccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccHHccccccccccHHHHHHHHccccEEEEEEEcccccccccccHHHHHHcccEEEcccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccCEEEEEHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHccccccccccEEEEcccccc

*****HP**KILGTGLSPCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENVSSPEDLQIEVVKSDGNIQFTIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLMSRSF**************QNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTT*******ENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQVDSRPTILMVKCASP

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
MAGUK p55 subfamily member 6		confident	Q9NZW5
MAGUK p55 subfamily member 6		confident	Q9JLB0

Prediction of Gene Ontology Terms

GO Term	Description	Confidence Level	Parent GO Terms
GO:0044464 [CC]	cell part	probable	GO:0005575, GO:0005623

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2XKX, chain A
Confidence level:very confident
Coverage over the Query: 6-318,334,349-352,375-430
View the alignment between query and template
View the model in PyMOL

Template: 3TVT, chain A
Confidence level:very confident
Coverage over the Query: 260-384
View the alignment between query and template
View the model in PyMOL