Psyllid ID: psy4417

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440
MEHPPHPLKKILGTGLSPCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENVSSPEDLQIEVVKSDGNIQFTIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLMSRSFPDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQVDSRPTILMVKCASP
cccccccEEEEEcccccccEEEEEEcccccEEEEEEcccccHHHccccccccEEEEEccEEcccHHHHHHHHHHccccEEEEEccccccccccccccccccEEEEEcccccccccccccccccccccEEEEEEcccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccHHHHHHHHccccEEEEEEEcccccccccccHHHHHHcccEEEcccccccccEEEEcccccccccccccccccccccccccccccccccccccccccccEEEEEEHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccEEEEcccccHHHHHHHHHHHHHHHHHHcccccEEEEcccHHHHHHHHHHHHHHHHcccccccccEEEEcccccc
ccccccEEEEEEEEcccccEEEEEEcccccEEEEEEEccccccccccEEcccEEEEEcccccccHHHHHHHHHHHccccEEEEEEcccccccccccEEEEEEEEccccccccccccHHcccccccccEEEEEEccccHHHHHHEccccccEEEcccHHHHHHHHHHccccccccccccccccccccccHHHHHHcccEEEcccEEcccccccccEcccEEEccHHHHHHHHHHccEEEEEEEccEEEEEEHHHHHHHHHcccEEEEEccHHHHEEEEEccccccccHHcccEEEEEcccccccEccEEEcccccccccEcccEEEccHHHHHHHHHcccEEEEEEEccEEEEEEHHHHHHHHHHccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHEEEEcccHHHHHHHHHHHHHHHccccccccccEEEEEEEccc
mehpphplkkilgtglspcgltveqdANGNLIIARILAGSlidkqgvlkvgdvilgvngenvsspedLQIEVVksdgniqftiapqgddaslpikpvcymrclftydpkedsllpckeiglafnhgdILQILnqkdpnwwqaqlieptgpmglvpsqeleerrkafvppeadyvhkigiCGTRYIKQYNTlqynstlmsrsfpdttrpmreleengqnywftSREVMERDIQDHkfleygehnghlygtHLDSIREVILSGKicvldcspvgLFTFLLGLIegtvtaklipytysipicswssffasdttrpmreleengqnywftSREVMERDIQDHkfleygehnghlygtHLDSIREVILSGKicvldcspveEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLDTLsnkhqvdsrptilmvkcasp
mehpphplkkilgtglspCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVngenvsspedLQIEVVKSDGNIQFTiapqgddaslpIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLMSRSFPDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLdtlsnkhqvdsrptilmvkcasp
MEHPPHPLKKILGTGLSPCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENVSSPEDLQIEVVKSDGNIQFTIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLMSRSFPDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQVDSRPTILMVKCASP
**********ILGTGLSPCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENVSSPEDLQIEVVKSDGNIQFTIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPM*************AFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLM******************QNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTT*******ENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQV****TILM******
*****HP**KILGTGLSPCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENVSSPEDLQIEVVKSDGNIQFTI**************CYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLMSRSF************************M***IQDHKFLEYGEHNGHLYGTHLDS**EVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSF******************YWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEE***********LQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQVDSRPTILMVKCASP
MEHPPHPLKKILGTGLSPCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENVSSPEDLQIEVVKSDGNIQFTIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLMSRSFPDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQVDSRPTILMVKCASP
***PPHPLKKILGTGLSPCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENVSSPEDLQIEVVKSDGNIQFTIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLMSRSFPDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQVDSRPTILMVKCAS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEHPPHPLKKILGTGLSPCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENVSSPEDLQIEVVKSDGNIQFTIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLMSRSFPDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQVDSRPTILMVKCASP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query440 2.2.26 [Sep-21-2011]
Q9NZW5540 MAGUK p55 subfamily membe yes N/A 0.759 0.618 0.317 6e-54
Q9WV34552 MAGUK p55 subfamily membe no N/A 0.759 0.605 0.32 3e-53
Q14168576 MAGUK p55 subfamily membe no N/A 0.759 0.579 0.315 4e-53
Q9JLB0553 MAGUK p55 subfamily membe yes N/A 0.763 0.607 0.311 5e-53
Q8BVD5576 MAGUK p55 subfamily membe no N/A 0.825 0.630 0.285 2e-41
Q24210898 Peripheral plasma membran no N/A 0.793 0.388 0.303 2e-41
Q6P0D7576 MAGUK p55 subfamily membe no N/A 0.784 0.598 0.311 1e-38
Q5RDW4466 55 kDa erythrocyte membra no N/A 0.577 0.545 0.332 4e-38
A9CB74466 55 kDa erythrocyte membra N/A N/A 0.577 0.545 0.328 6e-38
Q00013466 55 kDa erythrocyte membra no N/A 0.577 0.545 0.328 7e-38
>sp|Q9NZW5|MPP6_HUMAN MAGUK p55 subfamily member 6 OS=Homo sapiens GN=MPP6 PE=1 SV=2 Back     alignment and function desciption
 Score =  212 bits (539), Expect = 6e-54,   Method: Compositional matrix adjust.
 Identities = 144/454 (31%), Positives = 220/454 (48%), Gaps = 120/454 (26%)

Query: 18  PCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENV-SSPEDLQIEVVKSD 76
           P G+T   + N +L+IARIL G +ID+QG+L VGD+I  VNG  V ++P++LQ  +    
Sbjct: 140 PLGVTFRVE-NNDLVIARILHGGMIDRQGLLHVGDIIKEVNGHEVGNNPKELQELLKNIS 198

Query: 77  GNIQFTIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKD 136
           G++   I P   D   P +   +++C F Y+P  D+L+PCKE GL F+ G+ILQI+N++D
Sbjct: 199 GSVTLKILPSYRDTITPQQ--VFVKCHFDYNPYNDNLIPCKEAGLKFSKGEILQIVNRED 256

Query: 137 PNWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGT---------RYIKQ 187
           PNWWQA  ++  G  GL+PSQ LEE+RKAFV    D+ +    CGT          Y+  
Sbjct: 257 PNWWQASHVKEGGSAGLIPSQFLEEKRKAFV--RRDWDNSGPFCGTISSKKKKKMMYLTT 314

Query: 188 YNT-----------------------------------------LQYNSTLMSRSFPDTT 206
            N                                          +  N T    + P T+
Sbjct: 315 RNAEFDRHEIQIYEEVAKMPPFQRKTLVLIGAQGVGRRSLKNRFIVLNPTRFGTTVPFTS 374

Query: 207 RPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVL 266
           R  RE E++GQ Y F SR  ME DI+  K+LE+GE+ G+LYGT +DSI EV+ +G+ C+L
Sbjct: 375 RKPREDEKDGQAYKFVSRSEMEADIKAGKYLEHGEYEGNLYGTKIDSILEVVQTGRTCIL 434

Query: 267 DCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFT 326
           D +P  L            T++ +PY           F A+     +R +          
Sbjct: 435 DVNPQALKVLR--------TSEFMPYVV---------FIAAPELETLRAM---------- 467

Query: 327 SREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEES 386
                      HK                 ++ +  ++ K+        + D+K+T++ES
Sbjct: 468 -----------HK-----------------AVVDAGITTKLL------TDSDLKKTVDES 493

Query: 387 ACLQRSYERFIDKVIVNEDFDETF---RTVIELL 417
           A +QR+Y  + D +I+N++ D+ F   +T IE L
Sbjct: 494 ARIQRAYNHYFDLIIINDNLDKAFEKLQTAIEKL 527

Homo sapiens (taxid: 9606)
>sp|Q9WV34|MPP2_MOUSE MAGUK p55 subfamily member 2 OS=Mus musculus GN=Mpp2 PE=1 SV=1 Back     alignment and function description
>sp|Q14168|MPP2_HUMAN MAGUK p55 subfamily member 2 OS=Homo sapiens GN=MPP2 PE=1 SV=3 Back     alignment and function description
>sp|Q9JLB0|MPP6_MOUSE MAGUK p55 subfamily member 6 OS=Mus musculus GN=Mpp6 PE=1 SV=1 Back     alignment and function description
>sp|Q8BVD5|MPP7_MOUSE MAGUK p55 subfamily member 7 OS=Mus musculus GN=Mpp7 PE=2 SV=2 Back     alignment and function description
>sp|Q24210|CSKP_DROME Peripheral plasma membrane protein CASK OS=Drosophila melanogaster GN=CASK PE=1 SV=4 Back     alignment and function description
>sp|Q6P0D7|MPP7_DANRE MAGUK p55 subfamily member 7 OS=Danio rerio GN=mpp7 PE=1 SV=1 Back     alignment and function description
>sp|Q5RDW4|EM55_PONAB 55 kDa erythrocyte membrane protein OS=Pongo abelii GN=MPP1 PE=2 SV=1 Back     alignment and function description
>sp|A9CB74|EM55_PAPAN 55 kDa erythrocyte membrane protein OS=Papio anubis GN=MPP1 PE=3 SV=1 Back     alignment and function description
>sp|Q00013|EM55_HUMAN 55 kDa erythrocyte membrane protein OS=Homo sapiens GN=MPP1 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
328724454 609 PREDICTED: MAGUK p55 subfamily member 6- 0.847 0.612 0.480 1e-105
328724456 595 PREDICTED: MAGUK p55 subfamily member 6- 0.847 0.626 0.480 1e-105
189237268 604 PREDICTED: similar to calcium/calmodulin 0.852 0.620 0.452 4e-97
270007542 623 hypothetical protein TcasGA2_TC014139 [T 0.852 0.601 0.452 5e-97
307211950 605 MAGUK p55 subfamily member 6 [Harpegnath 0.847 0.616 0.438 3e-96
383864681 602 PREDICTED: MAGUK p55 subfamily member 6- 0.847 0.619 0.440 4e-96
345488418 644 PREDICTED: MAGUK p55 subfamily member 6- 0.845 0.577 0.443 2e-95
307179775 594 MAGUK p55 subfamily member 2 [Camponotus 0.847 0.627 0.431 3e-94
340721605 602 PREDICTED: MAGUK p55 subfamily member 6- 0.847 0.619 0.433 3e-93
350404844 602 PREDICTED: MAGUK p55 subfamily member 6- 0.847 0.619 0.431 9e-93
>gi|328724454|ref|XP_003248154.1| PREDICTED: MAGUK p55 subfamily member 6-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  389 bits (998), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 220/458 (48%), Positives = 265/458 (57%), Gaps = 85/458 (18%)

Query: 18  PCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENVSSPEDLQIEVVKSDG 77
           P GLTVEQD NGNLI+ARILAG  IDKQG+LK GDVIL VNGE V SPEDL  EV +S  
Sbjct: 179 PLGLTVEQDENGNLIVARILAGGTIDKQGLLKKGDVILEVNGERVESPEDLMNEVSRSKD 238

Query: 78  NIQFTIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDP 137
            +QF IAP     +      CYMR LF YDP ED+L+PCKEIGL F HGDILQ+L+QKDP
Sbjct: 239 TLQFRIAPGFSQKNTIQTQQCYMRALFDYDPMEDTLIPCKEIGLTFKHGDILQVLDQKDP 298

Query: 138 NWWQAQLIEPTGPMGLVPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNS-- 195
           NWWQA+ +      GL+PSQELEERRKAFV PEADYVHK  ICGTR  K+     Y S  
Sbjct: 299 NWWQAKKVGDNELPGLIPSQELEERRKAFVAPEADYVHKTSICGTRISKKKCKKMYQSKW 358

Query: 196 -------------------------------------TLMSR-----------SFPDTTR 207
                                                TL  R             P TTR
Sbjct: 359 NGEFDKAELILYEEVTKMPPFKRRTLALIGTTGVGRRTLKGRLINSDPQRFAGVIPYTTR 418

Query: 208 PMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLD 267
           P RELEENGQNYWFT R+ ME DI++HKFLEYGE+ G+LYGT+LDSIR+VI  GK+CVLD
Sbjct: 419 PQRELEENGQNYWFTDRDQMEHDIREHKFLEYGENGGNLYGTNLDSIRDVINEGKMCVLD 478

Query: 268 CSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFTS 327
           CSPV L            +++ +PY           F A+     M+ L +  +N  +++
Sbjct: 479 CSPVALKML-------HNSSEFMPYVI---------FIAAPGVEVMKSLYDYSRNLGYST 522

Query: 328 REVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESA 387
           R +          + Y         + L SI E               E+D+K++LEESA
Sbjct: 523 RTLT---FDRQSSIRYSSRRARTLES-LASIYE---------------EDDVKKSLEESA 563

Query: 388 CLQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQ 425
           CLQR YE++ID VIVNEDFD TFR V+E L+ +SN+HQ
Sbjct: 564 CLQRMYEKYIDLVIVNEDFDMTFRKVVEALEIISNEHQ 601

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|328724456|ref|XP_003248155.1| PREDICTED: MAGUK p55 subfamily member 6-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189237268|ref|XP_972920.2| PREDICTED: similar to calcium/calmodulin-dependent serine protein kinase membrane-associated guanylate kinase (cask) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|270007542|gb|EFA03990.1| hypothetical protein TcasGA2_TC014139 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|307211950|gb|EFN87862.1| MAGUK p55 subfamily member 6 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383864681|ref|XP_003707806.1| PREDICTED: MAGUK p55 subfamily member 6-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345488418|ref|XP_001599435.2| PREDICTED: MAGUK p55 subfamily member 6-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307179775|gb|EFN67965.1| MAGUK p55 subfamily member 2 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340721605|ref|XP_003399208.1| PREDICTED: MAGUK p55 subfamily member 6-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350404844|ref|XP_003487238.1| PREDICTED: MAGUK p55 subfamily member 6-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query440
FB|FBgn0250785636 vari "varicose" [Drosophila me 0.229 0.158 0.686 6.2e-90
UNIPROTKB|F1MU05551 MPP6 "Uncharacterized protein" 0.393 0.313 0.447 4.9e-64
UNIPROTKB|B8ZZG1428 MPP6 "Uncharacterized protein" 0.393 0.404 0.447 1e-63
UNIPROTKB|Q9NZW5540 MPP6 "MAGUK p55 subfamily memb 0.393 0.320 0.447 1e-63
UNIPROTKB|E1BS31540 MPP6 "Uncharacterized protein" 0.393 0.320 0.447 5.4e-63
ZFIN|ZDB-GENE-040704-70547 mpp2b "membrane protein, palmi 0.413 0.332 0.436 1.1e-61
UNIPROTKB|G3V8T8552 Mpp2 "Protein Mpp2" [Rattus no 0.411 0.327 0.447 8.5e-61
MGI|MGI:1927340553 Mpp6 "membrane protein, palmit 0.397 0.316 0.424 2.1e-60
MGI|MGI:1858257552 Mpp2 "membrane protein, palmit 0.411 0.327 0.447 2.9e-60
UNIPROTKB|Q14168576 MPP2 "MAGUK p55 subfamily memb 0.413 0.315 0.439 6.8e-60
FB|FBgn0250785 vari "varicose" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 371 (135.7 bits), Expect = 6.2e-90, Sum P(4) = 6.2e-90
 Identities = 70/102 (68%), Positives = 79/102 (77%)

Query:    95 KPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEP-TGPMGL 153
             K  CYMR LFTY+P EDSLLPC++IGL F  GDILQI+N KDPNWWQA+ I   +  +GL
Sbjct:   283 KLTCYMRALFTYNPSEDSLLPCRDIGLPFKSGDILQIINVKDPNWWQAKNITAESDKIGL 342

Query:   154 VPSQELEERRKAFVPPEADYVHKIGICGTRYIKQYNTLQYNS 195
             +PSQELEERRKAFV PEADYVHKIGICGTR  K+     Y S
Sbjct:   343 IPSQELEERRKAFVAPEADYVHKIGICGTRISKRKRKTMYRS 384
GO:0004385 "guanylate kinase activity" evidence=ISS
GO:0016020 "membrane" evidence=ISS
GO:0035151 "regulation of tube size, open tracheal system" evidence=IMP
GO:0007424 "open tracheal system development" evidence=IMP
GO:0005918 "septate junction" evidence=IDA
GO:0035159 "regulation of tube length, open tracheal system" evidence=IMP
GO:0019991 "septate junction assembly" evidence=IMP
GO:0035001 "dorsal trunk growth, open tracheal system" evidence=IMP
GO:0016328 "lateral plasma membrane" evidence=IDA
UNIPROTKB|F1MU05 MPP6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B8ZZG1 MPP6 "Uncharacterized protein" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NZW5 MPP6 "MAGUK p55 subfamily member 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BS31 MPP6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040704-70 mpp2b "membrane protein, palmitoylated 2b (MAGUK p55 subfamily member 2b)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G3V8T8 Mpp2 "Protein Mpp2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1927340 Mpp6 "membrane protein, palmitoylated 6 (MAGUK p55 subfamily member 6)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
MGI|MGI:1858257 Mpp2 "membrane protein, palmitoylated 2 (MAGUK p55 subfamily member 2)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q14168 MPP2 "MAGUK p55 subfamily member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9NZW5MPP6_HUMANNo assigned EC number0.31710.75900.6185yesN/A
Q9JLB0MPP6_MOUSENo assigned EC number0.31110.76360.6075yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
cd1186261 cd11862, SH3_MPP, Src Homology 3 domain of Membran 4e-31
smart00072174 smart00072, GuKc, Guanylate kinase homologues 5e-26
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 5e-26
pfam00625183 pfam00625, Guanylate_kin, Guanylate kinase 5e-24
cd1203759 cd12037, SH3_MPP2, Src Homology 3 domain of Membra 4e-23
cd1203562 cd12035, SH3_MPP1-like, Src Homology 3 domain of M 6e-23
smart00072174 smart00072, GuKc, Guanylate kinase homologues 2e-22
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMP 5e-22
cd1208062 cd12080, SH3_MPP1, Src Homology 3 domain of Membra 4e-21
TIGR03263179 TIGR03263, guanyl_kin, guanylate kinase 6e-21
cd1203861 cd12038, SH3_MPP6, Src Homology 3 domain of Membra 2e-19
cd00071137 cd00071, GMPK, Guanosine monophosphate kinase (GMP 4e-19
TIGR03263179 TIGR03263, guanyl_kin, guanylate kinase 1e-18
cd1208162 cd12081, SH3_CASK, Src Homology 3 domain of Calciu 1e-18
cd1203663 cd12036, SH3_MPP5, Src Homology 3 domain of Membra 2e-18
COG0194191 COG0194, Gmk, Guanylate kinase [Nucleotide transpo 5e-18
cd1203361 cd12033, SH3_MPP7, Src Homology 3 domain of Membra 2e-17
cd1203962 cd12039, SH3_MPP3, Src Homology 3 domain of Membra 4e-17
PRK00300205 PRK00300, gmk, guanylate kinase; Provisional 8e-17
PLN02772398 PLN02772, PLN02772, guanylate kinase 1e-16
PRK00300205 PRK00300, gmk, guanylate kinase; Provisional 3e-16
COG0194191 COG0194, Gmk, Guanylate kinase [Nucleotide transpo 8e-15
PLN02772398 PLN02772, PLN02772, guanylate kinase 1e-14
cd1186161 cd11861, SH3_DLG-like, Src Homology 3 domain of Di 3e-14
cd1203461 cd12034, SH3_MPP4, Src Homology 3 domain of Membra 1e-13
cd1203274 cd12032, SH3_DLG2, Src Homology 3 domain of Disks 1e-13
cd1202967 cd12029, SH3_DLG3, Src Homology 3 domain of Disks 2e-13
cd1203167 cd12031, SH3_DLG1, Src Homology 3 domain of Disks 5e-12
pfam0059580 pfam00595, PDZ, PDZ domain (Also known as DHR or G 2e-08
PRK14738206 PRK14738, gmk, guanylate kinase; Provisional 1e-07
cd1177253 cd11772, SH3_OSTF1, Src Homology 3 domain of metaz 1e-07
PRK14738206 PRK14738, gmk, guanylate kinase; Provisional 2e-07
smart0022885 smart00228, PDZ, Domain present in PSD-95, Dlg, an 2e-07
smart0032656 smart00326, SH3, Src homology 3 domains 2e-07
cd0099282 cd00992, PDZ_signaling, PDZ domain found in a vari 3e-07
cd1194953 cd11949, SH3_GRB2_C, C-terminal Src homology 3 dom 3e-07
PRK14737186 PRK14737, gmk, guanylate kinase; Provisional 4e-07
cd0017451 cd00174, SH3, Src Homology 3 domain superfamily 7e-07
PRK14737186 PRK14737, gmk, guanylate kinase; Provisional 1e-06
cd1203066 cd12030, SH3_DLG4, Src Homology 3 domain of Disks 2e-06
cd0013670 cd00136, PDZ, PDZ domain, also called DHR (Dlg hom 2e-06
cd1184552 cd11845, SH3_Src_like, Src homology 3 domain of Sr 3e-06
cd0098790 cd00987, PDZ_serine_protease, PDZ domain of tryspi 3e-06
cd0098979 cd00989, PDZ_metalloprotease, PDZ domain of bacter 4e-06
pfam0765353 pfam07653, SH3_2, Variant SH3 domain 6e-06
pfam0001847 pfam00018, SH3_1, SH3 domain 1e-05
cd1199554 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 2e-05
cd1180452 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3e-05
cd0098885 cd00988, PDZ_CTP_protease, PDZ domain of C-termina 4e-05
TIGR02037428 TIGR02037, degP_htrA_DO, periplasmic serine protea 1e-04
cd1196455 cd11964, SH3_STAM1, Src homology 3 domain of Signa 1e-04
cd1184053 cd11840, SH3_Intersectin_5, Fifth Src homology 3 d 1e-04
cd1182054 cd11820, SH3_STAM, Src homology 3 domain of Signal 1e-04
cd1195153 cd11951, SH3_GRAP_C, C-terminal Src homology 3 dom 2e-04
cd1176957 cd11769, SH3_CSK, Src Homology 3 domain of C-termi 3e-04
cd1199654 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 3e-04
cd1178653 cd11786, SH3_SH3RF_1, First Src Homology 3 domain 4e-04
cd1195053 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 do 5e-04
cd1201361 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain 7e-04
cd1176756 cd11767, SH3_Nck_3, Third Src Homology 3 domain of 8e-04
cd1200758 cd12007, SH3_Yes, Src homology 3 domain of Yes Pro 0.001
cd1182453 cd11824, SH3_PSTPIP1, Src homology 3 domain of Pro 0.001
COG0265347 COG0265, DegQ, Trypsin-like serine proteases, typi 0.001
cd1196357 cd11963, SH3_STAM2, Src homology 3 domain of Signa 0.002
cd1194854 cd11948, SH3_GRAP_N, N-terminal Src homology 3 dom 0.002
cd1182753 cd11827, SH3_MyoIe_If_like, Src homology 3 domain 0.002
pfam1318081 pfam13180, PDZ_2, PDZ domain 0.002
cd1200856 cd12008, SH3_Src, Src homology 3 domain of Src Pro 0.002
cd1177357 cd11773, SH3_Sla1p_1, First Src Homology 3 domain 0.002
cd1180553 cd11805, SH3_GRB2_like_C, C-terminal Src homology 0.002
cd1188355 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25 0.003
COG0793406 COG0793, Prc, Periplasmic protease [Cell envelope 0.003
cd1194656 cd11946, SH3_GRB2_N, N-terminal Src homology 3 dom 0.003
cd1200656 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn 0.004
>gnl|CDD|212796 cd11862, SH3_MPP, Src Homology 3 domain of Membrane Protein, Palmitoylated (or MAGUK p55 subfamily member) proteins Back     alignment and domain information 
 Score =  113 bits (285), Expect = 4e-31
 Identities = 38/61 (62%), Positives = 49/61 (80%), Gaps = 1/61 (1%)

Query: 99  YMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLI-EPTGPMGLVPSQ 157
           ++R LF YDP+ED L+PCKE GL+F  GDILQI+NQ DPNWWQA+ + +P G  GL+PSQ
Sbjct: 1   FVRALFDYDPEEDPLIPCKEAGLSFKKGDILQIVNQDDPNWWQARKVGDPNGRAGLIPSQ 60

Query: 158 E 158
           +
Sbjct: 61  D 61

The MPP/p55 subfamily of MAGUK (membrane-associated guanylate kinase) proteins includes at least eight vertebrate members (MPP1-7 and CASK), four Drosophila proteins (Stardust, Varicose, CASK and Skiff), and other similar proteins; they all contain one each of the core of three domains characteristic of MAGUK proteins: PDZ, SH3, and guanylate kinase (GuK). In addition, most members except for MPP1 contain N-terminal L27 domains and some also contain a Hook (Protein 4.1 Binding) motif in between the SH3 and GuK domains. CASK has an additional calmodulin-dependent kinase (CaMK)-like domain at the N-terminus. Members of this subfamily are scaffolding proteins that play important roles in regulating and establishing cell polarity, cell adhesion, and synaptic targeting and transmission, among others. The GuK domain in MAGUK proteins is enzymatically inactive; instead, the domain mediates protein-protein interactions and associates intramolecularly with the SH3 domain. SH3 domains are protein interaction domains that bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs. They play versatile and diverse roles in the cell including the regulation of enzymes, changing the subcellular localization of signaling pathway components, and mediating the formation of multiprotein complex assemblies. Length = 61
>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|201353 pfam00625, Guanylate_kin, Guanylate kinase Back     alignment and domain information
>gnl|CDD|212970 cd12037, SH3_MPP2, Src Homology 3 domain of Membrane Protein, Palmitoylated 2 (or MAGUK p55 subfamily member 2) Back     alignment and domain information
>gnl|CDD|212968 cd12035, SH3_MPP1-like, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1)-like proteins Back     alignment and domain information
>gnl|CDD|214504 smart00072, GuKc, Guanylate kinase homologues Back     alignment and domain information
>gnl|CDD|238026 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|213013 cd12080, SH3_MPP1, Src Homology 3 domain of Membrane Protein, Palmitoylated 1 (or MAGUK p55 subfamily member 1) Back     alignment and domain information
>gnl|CDD|213788 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information
>gnl|CDD|212971 cd12038, SH3_MPP6, Src Homology 3 domain of Membrane Protein, Palmitoylated 6 (or MAGUK p55 subfamily member 6) Back     alignment and domain information
>gnl|CDD|238026 cd00071, GMPK, Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>gnl|CDD|213788 TIGR03263, guanyl_kin, guanylate kinase Back     alignment and domain information
>gnl|CDD|213014 cd12081, SH3_CASK, Src Homology 3 domain of Calcium/calmodulin-dependent Serine protein Kinase Back     alignment and domain information
>gnl|CDD|212969 cd12036, SH3_MPP5, Src Homology 3 domain of Membrane Protein, Palmitoylated 5 (or MAGUK p55 subfamily member 5) Back     alignment and domain information
>gnl|CDD|223272 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|212966 cd12033, SH3_MPP7, Src Homology 3 domain of Membrane Protein, Palmitoylated 7 (or MAGUK p55 subfamily member 7) Back     alignment and domain information
>gnl|CDD|212972 cd12039, SH3_MPP3, Src Homology 3 domain of Membrane Protein, Palmitoylated 3 (or MAGUK p55 subfamily member 3) Back     alignment and domain information
>gnl|CDD|234719 PRK00300, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|234719 PRK00300, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|223272 COG0194, Gmk, Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|215414 PLN02772, PLN02772, guanylate kinase Back     alignment and domain information
>gnl|CDD|212795 cd11861, SH3_DLG-like, Src Homology 3 domain of Disks large homolog proteins Back     alignment and domain information
>gnl|CDD|212967 cd12034, SH3_MPP4, Src Homology 3 domain of Membrane Protein, Palmitoylated 4 (or MAGUK p55 subfamily member 4) Back     alignment and domain information
>gnl|CDD|212965 cd12032, SH3_DLG2, Src Homology 3 domain of Disks Large homolog 2 Back     alignment and domain information
>gnl|CDD|212962 cd12029, SH3_DLG3, Src Homology 3 domain of Disks Large homolog 3 Back     alignment and domain information
>gnl|CDD|212964 cd12031, SH3_DLG1, Src Homology 3 domain of Disks Large homolog 1 Back     alignment and domain information
>gnl|CDD|201332 pfam00595, PDZ, PDZ domain (Also known as DHR or GLGF) Back     alignment and domain information
>gnl|CDD|237809 PRK14738, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|212706 cd11772, SH3_OSTF1, Src Homology 3 domain of metazoan osteoclast stimulating factor 1 Back     alignment and domain information
>gnl|CDD|237809 PRK14738, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|214570 smart00228, PDZ, Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>gnl|CDD|214620 smart00326, SH3, Src homology 3 domains Back     alignment and domain information
>gnl|CDD|238492 cd00992, PDZ_signaling, PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>gnl|CDD|212882 cd11949, SH3_GRB2_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|212690 cd00174, SH3, Src Homology 3 domain superfamily Back     alignment and domain information
>gnl|CDD|173199 PRK14737, gmk, guanylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|212963 cd12030, SH3_DLG4, Src Homology 3 domain of Disks Large homolog 4 Back     alignment and domain information
>gnl|CDD|238080 cd00136, PDZ, PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>gnl|CDD|212779 cd11845, SH3_Src_like, Src homology 3 domain of Src kinase-like Protein Tyrosine Kinases Back     alignment and domain information
>gnl|CDD|238487 cd00987, PDZ_serine_protease, PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>gnl|CDD|238489 cd00989, PDZ_metalloprotease, PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>gnl|CDD|219499 pfam07653, SH3_2, Variant SH3 domain Back     alignment and domain information
>gnl|CDD|215659 pfam00018, SH3_1, SH3 domain Back     alignment and domain information
>gnl|CDD|212928 cd11995, SH3_Intersectin1_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-1 Back     alignment and domain information
>gnl|CDD|212738 cd11804, SH3_GRB2_like_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|238488 cd00988, PDZ_CTP_protease, PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>gnl|CDD|233695 TIGR02037, degP_htrA_DO, periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>gnl|CDD|212897 cd11964, SH3_STAM1, Src homology 3 domain of Signal Transducing Adaptor Molecule 1 Back     alignment and domain information
>gnl|CDD|212774 cd11840, SH3_Intersectin_5, Fifth Src homology 3 domain (or SH3E) of Intersectin Back     alignment and domain information
>gnl|CDD|212754 cd11820, SH3_STAM, Src homology 3 domain of Signal Transducing Adaptor Molecules Back     alignment and domain information
>gnl|CDD|212884 cd11951, SH3_GRAP_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212703 cd11769, SH3_CSK, Src Homology 3 domain of C-terminal Src kinase Back     alignment and domain information
>gnl|CDD|212929 cd11996, SH3_Intersectin2_5, Fifth Src homology 3 domain (or SH3E) of Intersectin-2 Back     alignment and domain information
>gnl|CDD|212720 cd11786, SH3_SH3RF_1, First Src Homology 3 domain of SH3 domain containing ring finger proteins Back     alignment and domain information
>gnl|CDD|212883 cd11950, SH3_GRAP2_C, C-terminal Src homology 3 domain of GRB2-related adaptor protein 2 Back     alignment and domain information
>gnl|CDD|212946 cd12013, SH3_RIM-BP_3, Third Src homology 3 domain of Rab3-interacting molecules (RIMs) binding proteins Back     alignment and domain information
>gnl|CDD|212701 cd11767, SH3_Nck_3, Third Src Homology 3 domain of Nck adaptor proteins Back     alignment and domain information
>gnl|CDD|212940 cd12007, SH3_Yes, Src homology 3 domain of Yes Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212758 cd11824, SH3_PSTPIP1, Src homology 3 domain of Proline-Serine-Threonine Phosphatase-Interacting Protein 1 Back     alignment and domain information
>gnl|CDD|223343 COG0265, DegQ, Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|212896 cd11963, SH3_STAM2, Src homology 3 domain of Signal Transducing Adaptor Molecule 2 Back     alignment and domain information
>gnl|CDD|212881 cd11948, SH3_GRAP_N, N-terminal Src homology 3 domain of GRB2-related adaptor protein Back     alignment and domain information
>gnl|CDD|212761 cd11827, SH3_MyoIe_If_like, Src homology 3 domain of Myosins Ie, If, and similar proteins Back     alignment and domain information
>gnl|CDD|221961 pfam13180, PDZ_2, PDZ domain Back     alignment and domain information
>gnl|CDD|212941 cd12008, SH3_Src, Src homology 3 domain of Src Protein Tyrosine Kinase Back     alignment and domain information
>gnl|CDD|212707 cd11773, SH3_Sla1p_1, First Src Homology 3 domain of the fungal endocytic adaptor protein Sla1p Back     alignment and domain information
>gnl|CDD|212739 cd11805, SH3_GRB2_like_C, C-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 (GRB2) and related proteins Back     alignment and domain information
>gnl|CDD|212816 cd11883, SH3_Sdc25, Src Homology 3 domain of Sdc25/Cdc25 guanine nucleotide exchange factors Back     alignment and domain information
>gnl|CDD|223864 COG0793, Prc, Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|212879 cd11946, SH3_GRB2_N, N-terminal Src homology 3 domain of Growth factor receptor-bound protein 2 Back     alignment and domain information
>gnl|CDD|212939 cd12006, SH3_Fyn_Yrk, Src homology 3 domain of Fyn and Yrk Protein Tyrosine Kinases Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 440
KOG0609|consensus542 100.0
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 100.0
PRK14737186 gmk guanylate kinase; Provisional 100.0
PLN02772398 guanylate kinase 99.97
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 99.97
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 99.97
KOG0708|consensus359 99.97
KOG3580|consensus 1027 99.95
KOG0707|consensus231 99.92
PRK14738206 gmk guanylate kinase; Provisional 99.91
COG0194191 Gmk Guanylate kinase [Nucleotide transport and met 99.87
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 99.83
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.82
PRK14737186 gmk guanylate kinase; Provisional 99.8
PRK00300205 gmk guanylate kinase; Provisional 99.79
PF00625183 Guanylate_kin: Guanylate kinase; InterPro: IPR0081 99.74
KOG0609|consensus542 99.71
PLN02772398 guanylate kinase 99.69
smart00072184 GuKc Guanylate kinase homologues. Active enzymes c 99.69
PRK14738206 gmk guanylate kinase; Provisional 99.58
KOG0707|consensus231 99.44
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. 99.34
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 99.34
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 99.28
PF0059581 PDZ: PDZ domain (Also known as DHR or GLGF) Coordi 99.26
KOG3550|consensus207 99.23
PRK08356195 hypothetical protein; Provisional 99.11
TIGR03263180 guanyl_kin guanylate kinase. Members of this famil 99.08
PRK00300205 gmk guanylate kinase; Provisional 99.04
COG3709192 Uncharacterized component of phosphonate metabolis 98.96
KOG1029|consensus1118 98.93
PF1460449 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3 98.93
PF0001848 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Ho 98.9
KOG2199|consensus462 98.89
PF0765355 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 98.79
KOG3551|consensus506 98.79
cd0099282 PDZ_signaling PDZ domain found in a variety of Eum 98.76
KOG3209|consensus984 98.7
KOG3549|consensus505 98.7
cd0013670 PDZ PDZ domain, also called DHR (Dlg homologous re 98.68
smart0022885 PDZ Domain present in PSD-95, Dlg, and ZO-1/2. Als 98.63
KOG3209|consensus984 98.58
PF1318082 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_ 98.55
KOG3812|consensus475 98.55
KOG3606|consensus358 98.48
KOG4792|consensus293 98.48
KOG1118|consensus366 98.47
cd0017454 SH3 Src homology 3 domains; SH3 domains bind to pr 98.39
KOG2070|consensus 661 98.39
smart0032658 SH3 Src homology 3 domains. Src homology 3 (SH3) d 98.39
KOG0708|consensus359 98.34
KOG1892|consensus 1629 98.31
KOG4226|consensus379 98.22
KOG3651|consensus429 98.18
KOG3553|consensus124 98.18
PRK10078186 ribose 1,5-bisphosphokinase; Provisional 98.17
cd0098885 PDZ_CTP_protease PDZ domain of C-terminal processi 98.15
KOG3571|consensus626 98.11
TIGR02322179 phosphon_PhnN phosphonate metabolism protein/1,5-b 98.08
cd0099179 PDZ_archaeal_metalloprotease PDZ domain of archaea 98.05
KOG3580|consensus 1027 98.03
cd0099080 PDZ_glycyl_aminopeptidase PDZ domain associated wi 97.99
cd0098979 PDZ_metalloprotease PDZ domain of bacterial and pl 97.98
KOG3605|consensus829 97.95
KOG0162|consensus1106 97.87
KOG4226|consensus379 97.85
cd0098790 PDZ_serine_protease PDZ domain of tryspin-like ser 97.85
KOG3938|consensus334 97.79
KOG4225|consensus489 97.77
KOG3601|consensus222 97.76
KOG4225|consensus489 97.73
KOG4348|consensus627 97.7
cd0098679 PDZ_LON_protease PDZ domain of ATP-dependent LON s 97.68
PRK00091307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 97.68
KOG3552|consensus 1298 97.61
KOG2856|consensus472 97.58
KOG3605|consensus829 97.51
COG0793406 Prc Periplasmic protease [Cell envelope biogenesis 97.51
PRK10139455 serine endoprotease; Provisional 97.46
TIGR00225334 prc C-terminal peptidase (prc). A C-terminal pepti 97.45
KOG3542|consensus 1283 97.45
KOG4348|consensus 627 97.44
PLN00049389 carboxyl-terminal processing protease; Provisional 97.43
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.32
PRK10779449 zinc metallopeptidase RseP; Provisional 97.28
TIGR03279433 cyano_FeS_chp putative FeS-containing Cyanobacteri 97.27
KOG3875|consensus362 97.24
PRK10942473 serine endoprotease; Provisional 97.24
PRK11186667 carboxy-terminal protease; Provisional 97.23
KOG0515|consensus752 97.23
KOG2996|consensus865 97.23
TIGR02037428 degP_htrA_DO periplasmic serine protease, Do/DeqQ 97.14
TIGR00174287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 97.11
TIGR01713259 typeII_sec_gspC general secretion pathway protein 97.09
KOG2546|consensus483 97.03
PRK10942473 serine endoprotease; Provisional 97.01
KOG3655|consensus484 96.98
KOG3632|consensus1335 96.94
PRK08356195 hypothetical protein; Provisional 96.92
TIGR02038351 protease_degS periplasmic serine pepetdase DegS. T 96.91
PRK10139455 serine endoprotease; Provisional 96.88
PF04495138 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: 96.87
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 96.86
KOG0197|consensus 468 96.83
PRK10898353 serine endoprotease; Provisional 96.82
PRK00091 307 miaA tRNA delta(2)-isopentenylpyrophosphate transf 96.79
KOG1264|consensus 1267 96.7
TIGR02860402 spore_IV_B stage IV sporulation protein B. SpoIVB, 96.57
PF1468588 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6 96.57
PRK10779449 zinc metallopeptidase RseP; Provisional 96.49
TIGR00054420 RIP metalloprotease RseP. A model that detects fra 96.44
KOG1029|consensus1118 96.37
KOG1843|consensus473 96.04
TIGR00174 287 miaA tRNA isopentenyltransferase (miaA). Catalyzes 95.76
KOG4278|consensus 1157 95.42
KOG3532|consensus 1051 95.36
KOG4575|consensus 874 95.19
PRK04040188 adenylate kinase; Provisional 95.01
KOG3129|consensus231 94.95
COG3975558 Predicted protease with the C-terminal PDZ domain 94.88
KOG1702|consensus264 94.72
KOG1738|consensus638 94.44
KOG3557|consensus721 94.29
KOG3632|consensus1335 94.17
KOG0606|consensus 1205 94.09
KOG3601|consensus222 94.02
PLN02840 421 tRNA dimethylallyltransferase 93.88
COG0265347 DegQ Trypsin-like serine proteases, typically peri 93.43
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). 93.36
PRK00098298 GTPase RsgA; Reviewed 93.13
KOG3771|consensus460 92.72
COG3031275 PulC Type II secretory pathway, component PulC [In 92.07
COG3480342 SdrC Predicted secreted protein containing a PDZ d 91.87
KOG2222|consensus848 91.78
KOG3523|consensus695 91.62
COG3709192 Uncharacterized component of phosphonate metabolis 91.47
KOG1451|consensus812 91.43
KOG1320|consensus473 90.62
KOG1421|consensus 955 90.57
PRK09681276 putative type II secretion protein GspC; Provision 90.52
PF1281278 PDZ_1: PDZ-like domain 89.89
PRK00698205 tmk thymidylate kinase; Validated 88.47
PRK00098298 GTPase RsgA; Reviewed 86.42
KOG4792|consensus293 85.32
PRK00081194 coaE dephospho-CoA kinase; Reviewed 85.02
PTZ00451244 dephospho-CoA kinase; Provisional 84.92
KOG3725|consensus375 80.76
KOG4773|consensus386 80.49
KOG3775|consensus482 80.31
>KOG0609|consensus Back     alignment and domain information 
Probab=100.00  E-value=2e-76  Score=592.61  Aligned_cols=366  Identities=41%  Similarity=0.671  Sum_probs=310.2

Q ss_pred             CCCeEEEEeeC-CCCccEEEEecCCCcEEEEEEcCCChhhhcCCCCCCCEEEeECCccC--CCHHHHHHHHHhcCCceee
Q psy4417           5 PHPLKKILGTG-LSPCGLTVEQDANGNLIIARILAGSLIDKQGVLKVGDVILGVNGENV--SSPEDLQIEVVKSDGNIQF   81 (440)
Q Consensus         5 ~~~r~v~l~r~-g~~lGiti~~~~~~~i~V~~V~~gs~A~~~G~L~~GD~Il~VNg~~v--~t~~e~~~~L~~~~~~v~l   81 (440)
                      ...+.|.++|+ +.++|++++..+++.++|++|+.||.|+++|.|++||+|++|||+++  ..+++++++|+++.|.++|
T Consensus       121 ~~vriv~i~k~~~eplG~Tik~~e~~~~~vARI~~GG~~~r~glL~~GD~i~EvNGi~v~~~~~~e~q~~l~~~~G~itf  200 (542)
T KOG0609|consen  121 EAVRIVRIVKNTGEPLGATIRVEEDTKVVVARIMHGGMADRQGLLHVGDEILEVNGISVANKSPEELQELLRNSRGSITF  200 (542)
T ss_pred             ceeEEEEEeecCCCccceEEEeccCCccEEeeeccCCcchhccceeeccchheecCeecccCCHHHHHHHHHhCCCcEEE
Confidence            34567778887 89999999987667899999999999999999999999999999999  6799999999999999999


Q ss_pred             eeccCCCCCCCCCCccccccccccCCCCCCCCCCCccccceeccCCEEEEeecCCCCceEEEecCC--CCCCccccchhH
Q psy4417          82 TIAPQGDDASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEP--TGPMGLVPSQEL  159 (440)
Q Consensus        82 ~v~p~~~~~~~~~~~~~~vRal~dy~p~~d~~~p~~e~~L~f~~GdIl~V~~~~d~~ww~a~~~~~--~~~~G~iPs~~~  159 (440)
                      +++|... + .+....+|+||+|||+|..|+.+||+|++|+|++||||+|++++|.+||||++++.  .+.+|+|||+.+
T Consensus       201 kiiP~~~-~-~~~~~~~~vra~FdYdP~~D~~IPCkEagl~F~~GDILqIv~qdD~nWWQA~~~~~~~~~~AGLiPS~~~  278 (542)
T KOG0609|consen  201 KIIPSYR-P-PPQQQVVFVRALFDYDPKEDDLIPCKEAGLPFQRGDILQIVSQDDPNWWQARRVGDPFGGLAGLIPSKEL  278 (542)
T ss_pred             EEccccc-C-CCceeeeeehhhcCcCcccCCcccchhcCCcccccceeeeccCCCcchhhhhcccCccccccccccCHHH
Confidence            9999988 3 33334699999999999999999999999999999999999999999999999974  478999999999


Q ss_pred             HHhhhcccCCCcccccccccccccccccc-ccc----------------cccc-----------------------cc--
Q psy4417         160 EERRKAFVPPEADYVHKIGICGTRYIKQY-NTL----------------QYNS-----------------------TL--  197 (440)
Q Consensus       160 ~~rr~~~~~~~~~~~gk~~~~~~~~~~~~-~~~----------------~~~~-----------------------~~--  197 (440)
                      ++||.++.....+-.-..+.|..+.++++ .+.                .|+.                       ++  
T Consensus       279 qerr~a~~~~~~~~~~~~~~c~~l~kkkk~~~~~y~~~~~~~~d~~~~~tYEEV~~~~~~~rrtlVLiGa~GvGr~elk~  358 (542)
T KOG0609|consen  279 QERRVACLRREVSKEPEKTRCQRLSKKKKKKKSKYLGKHSAVFDQPELLTYEEVVRYPPFRRRTLVLIGAQGVGRRELKN  358 (542)
T ss_pred             HHHHHHHHhhhcccCCcCchhcccchhhhhhhhhhhhhcchhhhccccccHHHHhhhcccccceEEEECCcccchHHHHH
Confidence            99999876543331111123333222211 111                1111                       11  


Q ss_pred             ---------CcccccCCCCCCCCCccCCCcceecCHHHHHHhhhcCCeeEEEEEcCCccccchhhHHHHHhcCCeEEeec
Q psy4417         198 ---------MSRSFPDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDC  268 (440)
Q Consensus       198 ---------~~~~~~~ttr~~r~~e~~g~~y~fvs~~~f~~~i~~~~fle~~~~~g~~yg~~~~~i~~v~~~g~~~il~~  268 (440)
                               +..+||||||+||++|++|++|+|||+++|+++|.+|+||||++|.+++|||++++|++++++||+|||++
T Consensus       359 ~Li~~~p~~f~~~VPhTtR~~r~~E~dG~eY~FVSk~~~e~dI~~~~~lE~GEy~~nlYGTs~dsVr~v~~~gKicvLdv  438 (542)
T KOG0609|consen  359 KLIELNPDRFGTAVPHTTRPPRSDEVDGVEYHFVSKEEMEADIRAGKFLEYGEYEGNLYGTSLDSVRNVIASGKICVLDV  438 (542)
T ss_pred             HHHhhCccccccCCCCcCCCCCCCCCCCccceeeehHHHhhhhhcCCceecCcchhccccchHHHHHHHHHhCCEEEEec
Confidence                     22899999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CcchhhhhhhhhccccccccCCCceEEecCCCccceeecCCCcccchhhccCccccccCHHHHHHHHHcCceeeEEEEcC
Q psy4417         269 SPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFTSREVMERDIQDHKFLEYGEHNG  348 (440)
Q Consensus       269 ~~~g~~~l~~~l~~~~~~~~~~p~~i~i~~~~~~~f~~~~ttr~~~~~e~~g~~y~f~s~~~f~~~~~~~~fle~~~~~~  348 (440)
                      .|++++.|        ++++|.|++|         ||.||+-..++..+..   +.                        
T Consensus       439 ~Pqalk~l--------Rt~Ef~PyVI---------FI~pP~~~~~r~~r~~---~~------------------------  474 (542)
T KOG0609|consen  439 EPQALKVL--------RTAEFKPYVI---------FIAPPSLEELRALRKV---AV------------------------  474 (542)
T ss_pred             CHHHhhhh--------hhhcccceEE---------EecCCCchhHHHHhhh---cc------------------------
Confidence            99999999        8999999999         9999993333333211   00                        


Q ss_pred             ccccccHHHHHHHHhcCCeeEecCCCcHHHHHHHHHHHHHHHHHhcCCccEEEEcCCHHHHHHHHHHHHHhccCCCeeee
Q psy4417         349 HLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLDTLSNKHQVDS  428 (440)
Q Consensus       349 ~~yGt~~~~i~~~~~~~~~~i~~~~~s~e~l~~~l~~~~~~e~~~~~~fd~vi~Nddl~~a~~~l~~~i~~~~~~~~wvp  428 (440)
                        +-               .+...++++++|++++.++++|+++|+|+||.+|+|+|+|.|+++|+.+|..++++|||||
T Consensus       475 --~~---------------~~~~~~~~d~~Lq~i~~eS~~ie~~yghyfD~iIvN~dld~t~~eL~~~iekl~tepqWVP  537 (542)
T KOG0609|consen  475 --MS---------------TIVAKQFTDEDLQEIIDESARIEQQYGHYFDLIIVNSDLDKTFRELKTAIEKLRTEPQWVP  537 (542)
T ss_pred             --cc---------------ccccccCCHHHHHHHHHHHHHHHHHhhhheeEEEEcCcHHHHHHHHHHHHHHhccCCceee
Confidence              00               0123457899999999999999999999999999999999999999999999999999999


Q ss_pred             cccee
Q psy4417         429 RPTIL  433 (440)
Q Consensus       429 ~~w~~  433 (440)
                      ++|++
T Consensus       538 vsWv~  542 (542)
T KOG0609|consen  538 VSWVY  542 (542)
T ss_pred             eeccC
Confidence            99985

>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK14737 gmk guanylate kinase; Provisional Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 Back     alignment and domain information
>KOG0609|consensus Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>smart00072 GuKc Guanylate kinase homologues Back     alignment and domain information
>PRK14738 gmk guanylate kinase; Provisional Back     alignment and domain information
>KOG0707|consensus Back     alignment and domain information
>cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>PF00595 PDZ: PDZ domain (Also known as DHR or GLGF) Coordinates are not yet available; InterPro: IPR001478 PDZ domains are found in diverse signalling proteins in bacteria, yeasts, plants, insects and vertebrates [, ] Back     alignment and domain information
>KOG3550|consensus Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03263 guanyl_kin guanylate kinase Back     alignment and domain information
>PRK00300 gmk guanylate kinase; Provisional Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF14604 SH3_9: Variant SH3 domain; PDB: 2CRE_A 2E5K_A 2CT3_A 2DE0_X 2D8H_A 2DA9_A 2X3X_E 2X3W_D 2KRN_A 2ED0_A Back     alignment and domain information
>PF00018 SH3_1: SH3 domain; InterPro: IPR001452 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG2199|consensus Back     alignment and domain information
>PF07653 SH3_2: Variant SH3 domain; InterPro: IPR011511 SH3 (src Homology-3) domains are small protein modules containing approximately 50 amino acid residues [, ] Back     alignment and domain information
>KOG3551|consensus Back     alignment and domain information
>cd00992 PDZ_signaling PDZ domain found in a variety of Eumetazoan signaling molecules, often in tandem arrangements Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>KOG3549|consensus Back     alignment and domain information
>cd00136 PDZ PDZ domain, also called DHR (Dlg homologous region) or GLGF (after a conserved sequence motif) Back     alignment and domain information
>smart00228 PDZ Domain present in PSD-95, Dlg, and ZO-1/2 Back     alignment and domain information
>KOG3209|consensus Back     alignment and domain information
>PF13180 PDZ_2: PDZ domain; PDB: 2L97_A 1Y8T_A 2Z9I_A 1LCY_A 2PZD_B 2P3W_A 1VCW_C 1TE0_B 1SOZ_C 1SOT_C Back     alignment and domain information
>KOG3812|consensus Back     alignment and domain information
>KOG3606|consensus Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>KOG1118|consensus Back     alignment and domain information
>cd00174 SH3 Src homology 3 domains; SH3 domains bind to proline-rich ligands with moderate affinity and selectivity, preferentially to PxxP motifs; they play a role in the regulation of enzymes by intramolecular interactions, changing the subcellular localization of signal pathway components and mediate multiprotein complex assemblies Back     alignment and domain information
>KOG2070|consensus Back     alignment and domain information
>smart00326 SH3 Src homology 3 domains Back     alignment and domain information
>KOG0708|consensus Back     alignment and domain information
>KOG1892|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>KOG3651|consensus Back     alignment and domain information
>KOG3553|consensus Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>cd00988 PDZ_CTP_protease PDZ domain of C-terminal processing-, tail-specific-, and tricorn proteases, which function in posttranslational protein processing, maturation, and disassembly or degradation, in Bacteria, Archaea, and plant chloroplasts Back     alignment and domain information
>KOG3571|consensus Back     alignment and domain information
>TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN Back     alignment and domain information
>cd00991 PDZ_archaeal_metalloprotease PDZ domain of archaeal zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3580|consensus Back     alignment and domain information
>cd00990 PDZ_glycyl_aminopeptidase PDZ domain associated with archaeal and bacterial M61 glycyl-aminopeptidases Back     alignment and domain information
>cd00989 PDZ_metalloprotease PDZ domain of bacterial and plant zinc metalloprotases, presumably membrane-associated or integral membrane proteases, which may be involved in signalling and regulatory mechanisms Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>KOG4226|consensus Back     alignment and domain information
>cd00987 PDZ_serine_protease PDZ domain of tryspin-like serine proteases, such as DegP/HtrA, which are oligomeric proteins involved in heat-shock response, chaperone function, and apoptosis Back     alignment and domain information
>KOG3938|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>KOG4225|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>cd00986 PDZ_LON_protease PDZ domain of ATP-dependent LON serine proteases Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>KOG3552|consensus Back     alignment and domain information
>KOG2856|consensus Back     alignment and domain information
>KOG3605|consensus Back     alignment and domain information
>COG0793 Prc Periplasmic protease [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>TIGR00225 prc C-terminal peptidase (prc) Back     alignment and domain information
>KOG3542|consensus Back     alignment and domain information
>KOG4348|consensus Back     alignment and domain information
>PLN00049 carboxyl-terminal processing protease; Provisional Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR03279 cyano_FeS_chp putative FeS-containing Cyanobacterial-specific oxidoreductase Back     alignment and domain information
>KOG3875|consensus Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>PRK11186 carboxy-terminal protease; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG2996|consensus Back     alignment and domain information
>TIGR02037 degP_htrA_DO periplasmic serine protease, Do/DeqQ family Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>TIGR01713 typeII_sec_gspC general secretion pathway protein C Back     alignment and domain information
>KOG2546|consensus Back     alignment and domain information
>PRK10942 serine endoprotease; Provisional Back     alignment and domain information
>KOG3655|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02038 protease_degS periplasmic serine pepetdase DegS Back     alignment and domain information
>PRK10139 serine endoprotease; Provisional Back     alignment and domain information
>PF04495 GRASP55_65: GRASP55/65 PDZ-like domain ; InterPro: IPR007583 GRASP55 (Golgi reassembly stacking protein of 55 kDa) and GRASP65 (a 65 kDa) protein are highly homologous Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG0197|consensus Back     alignment and domain information
>PRK10898 serine endoprotease; Provisional Back     alignment and domain information
>PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>TIGR02860 spore_IV_B stage IV sporulation protein B Back     alignment and domain information
>PF14685 Tricorn_PDZ: Tricorn protease PDZ domain; PDB: 1N6F_D 1N6D_C 1N6E_C 1K32_A Back     alignment and domain information
>PRK10779 zinc metallopeptidase RseP; Provisional Back     alignment and domain information
>TIGR00054 RIP metalloprotease RseP Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>KOG1843|consensus Back     alignment and domain information
>TIGR00174 miaA tRNA isopentenyltransferase (miaA) Back     alignment and domain information
>KOG4278|consensus Back     alignment and domain information
>KOG3532|consensus Back     alignment and domain information
>KOG4575|consensus Back     alignment and domain information
>PRK04040 adenylate kinase; Provisional Back     alignment and domain information
>KOG3129|consensus Back     alignment and domain information
>COG3975 Predicted protease with the C-terminal PDZ domain [General function prediction only] Back     alignment and domain information
>KOG1702|consensus Back     alignment and domain information
>KOG1738|consensus Back     alignment and domain information
>KOG3557|consensus Back     alignment and domain information
>KOG3632|consensus Back     alignment and domain information
>KOG0606|consensus Back     alignment and domain information
>KOG3601|consensus Back     alignment and domain information
>PLN02840 tRNA dimethylallyltransferase Back     alignment and domain information
>COG0265 DegQ Trypsin-like serine proteases, typically periplasmic, contain C-terminal PDZ domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG3771|consensus Back     alignment and domain information
>COG3031 PulC Type II secretory pathway, component PulC [Intracellular trafficking and secretion] Back     alignment and domain information
>COG3480 SdrC Predicted secreted protein containing a PDZ domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2222|consensus Back     alignment and domain information
>KOG3523|consensus Back     alignment and domain information
>COG3709 Uncharacterized component of phosphonate metabolism [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1451|consensus Back     alignment and domain information
>KOG1320|consensus Back     alignment and domain information
>KOG1421|consensus Back     alignment and domain information
>PRK09681 putative type II secretion protein GspC; Provisional Back     alignment and domain information
>PF12812 PDZ_1: PDZ-like domain Back     alignment and domain information
>PRK00698 tmk thymidylate kinase; Validated Back     alignment and domain information
>PRK00098 GTPase RsgA; Reviewed Back     alignment and domain information
>KOG4792|consensus Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>PTZ00451 dephospho-CoA kinase; Provisional Back     alignment and domain information
>KOG3725|consensus Back     alignment and domain information
>KOG4773|consensus Back     alignment and domain information
>KOG3775|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 1e-30
2xkx_A721 Single Particle Analysis Of Psd-95 In Negative Stai 3e-16
3uat_A296 Guanylate Kinase Domains Of The Maguk Family Scaffo 6e-30
3uat_A296 Guanylate Kinase Domains Of The Maguk Family Scaffo 5e-16
3tvt_A292 Structural Basis For Discs Large Interaction With P 2e-29
3tvt_A292 Structural Basis For Discs Large Interaction With P 4e-15
1kjw_A295 Sh3-Guanylate Kinase Module From Psd-95 Length = 29 2e-26
1kjw_A295 Sh3-Guanylate Kinase Module From Psd-95 Length = 29 4e-16
1jxm_A301 Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag 2e-26
1jxm_A301 Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Frag 4e-16
1kgd_A180 Crystal Structure Of The Guanylate Kinase-Like Doma 1e-17
3ney_A197 Crystal Structure Of The Kinase Domain Of Mpp1P55 L 9e-14
1lvg_A198 Crystal Structure Of Mouse Guanylate Kinase In Comp 5e-13
1lvg_A198 Crystal Structure Of Mouse Guanylate Kinase In Comp 1e-12
1gky_A187 Refined Structure Of The Complex Between Guanylate 4e-10
1ex6_A186 Crystal Structure Of Unliganded Form Of Guanylate K 4e-10
3tau_A208 Crystal Structure Of A Putative Guanylate Monophosp 5e-10
3tau_A208 Crystal Structure Of A Putative Guanylate Monophosp 4e-09
4f4j_A202 Conversion Of The Enzyme Guanylate Kinase Into A Mi 2e-09
2j41_A207 Crystal Structure Of Staphylococcus Aureus Guanylat 5e-08
2qor_A204 Crystal Structure Of Plasmodium Vivax Guanylate Kin 5e-07
2ev8_A97 Solution Structure Of The Erythroid P55 Pdz Domain 3e-06
1kwa_A88 Human CaskLIN-2 Pdz Domain Length = 88 5e-06
1z6g_A218 Crystal Structure Of Guanylate Kinase From Plasmodi 6e-06
2ejy_A97 Solution Structure Of The P55 Pdz T85c Domain Compl 1e-05
2e7k_A91 Solution Structure Of The Pdz Domain From Human Mag 2e-05
1k76_A62 Solution Structure Of The C-Terminal Sem-5 Sh3 Doma 4e-05
3sem_A60 Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Le 5e-05
1sem_A58 Structural Determinants Of Peptide-Binding Orientat 5e-05
1udl_A98 The Solution Structure Of The Fifth Sh3 Domain Of I 6e-05
3o46_A93 Crystal Structure Of The Pdz Domain Of Mpp7 Length 8e-05
2vwf_A58 Grb2 Sh3c (2) Length = 58 1e-04
1gcq_A61 Crystal Structure Of Vav And Grb2 Sh3 Domains Lengt 1e-04
1io6_A59 Growth Factor Receptor-Bound Protein 2 (Grb2) C-Ter 1e-04
1gri_A217 Grb2 Length = 217 1e-04
3lnc_A231 Crystal Structure Of Guanylate Kinase From Anaplasm 4e-04
1s96_A219 The 2.0 A X-Ray Structure Of Guanylate Kinase From 4e-04
2an9_A207 Crystal Structure Of Oligomeric E.Coli Guanylate Ki 7e-04
2eyy_A204 Ct10-Regulated Kinase Isoform I Length = 204 8e-04
2dvj_A230 Phosphorylated Crk-Ii Length = 230 8e-04
2vvk_A56 Grb2 Sh3c (1) Length = 56 8e-04
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure 
Iteration: 1

 Score =  130 bits (327), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 101/327 (30%), Positives = 146/327 (44%), Gaps = 64/327 (19%)
Query: 4   PPHPLKKILGTGLSPCGLTVEQDANG-NLIIARILAGSLIDKQGVLKVGDVILGVNGENV 62
           P  P + ++  G +  G  +    +G  + I+ ILAG   D  G L+ GD IL VNG ++
Sbjct: 305 PREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDL 364
Query: 63  SSPEDLQIEVVKSDGNIQFTIAPQ--------------------------GDDASLPIKP 96
            +    Q  +   +     TI  Q                             ASL   P
Sbjct: 365 RNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNP 424
Query: 97  V--CYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEP---TGPM 151
               Y+R LF YD  +D     +   L+F  GD+L +++  D  WWQA+ +     T  +
Sbjct: 425 KRGFYIRALFDYDKTKDCGFLSQ--ALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDI 482
Query: 152 GLVPSQELEERRKAFVPPEADYVHKIGICGTR-YIKQYNTL------------------- 191
           G +PS+   ERR+       D+    G  G    +  Y T+                   
Sbjct: 483 GFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKD 542
Query: 192 QYNSTLMSRSFPD--------TTRPMRELEENGQNYWF-TSREVMERDIQDHKFLEYGEH 242
           + N  L+S  FPD        TTRP RE E +G++Y F +SRE ME+DI+ HKF+E G++
Sbjct: 543 RANDDLLS-EFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIRAHKFIEAGQY 601
Query: 243 NGHLYGTHLDSIREVILSGKICVLDCS 269
           N HLYGT + S+REV   GK C+LD S
Sbjct: 602 NSHLYGTSVQSVREVAEQGKHCILDVS 628
>pdb|2XKX|A Chain A, Single Particle Analysis Of Psd-95 In Negative Stain Length = 721 Back     alignment and structure
>pdb|3UAT|A Chain A, Guanylate Kinase Domains Of The Maguk Family Scaffold Proteins As Specific Phospho-Protein Binding Modules Length = 296 Back     alignment and structure
>pdb|3UAT|A Chain A, Guanylate Kinase Domains Of The Maguk Family Scaffold Proteins As Specific Phospho-Protein Binding Modules Length = 296 Back     alignment and structure
>pdb|3TVT|A Chain A, Structural Basis For Discs Large Interaction With Pins Length = 292 Back     alignment and structure
>pdb|3TVT|A Chain A, Structural Basis For Discs Large Interaction With Pins Length = 292 Back     alignment and structure
>pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 Back     alignment and structure
>pdb|1KJW|A Chain A, Sh3-Guanylate Kinase Module From Psd-95 Length = 295 Back     alignment and structure
>pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 Back     alignment and structure
>pdb|1JXM|A Chain A, Crystal Structure Of The Gmp Bound Sh3-Hook-Gk Fragment Of Psd-95 Length = 301 Back     alignment and structure
>pdb|1KGD|A Chain A, Crystal Structure Of The Guanylate Kinase-Like Domain Of Human Cask Length = 180 Back     alignment and structure
>pdb|3NEY|A Chain A, Crystal Structure Of The Kinase Domain Of Mpp1P55 Length = 197 Back     alignment and structure
>pdb|1LVG|A Chain A, Crystal Structure Of Mouse Guanylate Kinase In Complex With Gmp And Adp Length = 198 Back     alignment and structure
>pdb|1LVG|A Chain A, Crystal Structure Of Mouse Guanylate Kinase In Complex With Gmp And Adp Length = 198 Back     alignment and structure
>pdb|1GKY|A Chain A, Refined Structure Of The Complex Between Guanylate Kinase And Its Substrate Gmp At 2.0 Angstroms Resolution Length = 187 Back     alignment and structure
>pdb|1EX6|A Chain A, Crystal Structure Of Unliganded Form Of Guanylate Kinase From Yeast Length = 186 Back     alignment and structure
>pdb|3TAU|A Chain A, Crystal Structure Of A Putative Guanylate Monophosphaste Kinase From Listeria Monocytogenes Egd-E Length = 208 Back     alignment and structure
>pdb|3TAU|A Chain A, Crystal Structure Of A Putative Guanylate Monophosphaste Kinase From Listeria Monocytogenes Egd-E Length = 208 Back     alignment and structure
>pdb|4F4J|A Chain A, Conversion Of The Enzyme Guanylate Kinase Into A Mitotic Spindle Orienting Protein By A Single Mutation That Inhibits Gmp- Induced Closing Length = 202 Back     alignment and structure
>pdb|2J41|A Chain A, Crystal Structure Of Staphylococcus Aureus Guanylate Monophosphate Kinase Length = 207 Back     alignment and structure
>pdb|2QOR|A Chain A, Crystal Structure Of Plasmodium Vivax Guanylate Kinase Length = 204 Back     alignment and structure
>pdb|2EV8|A Chain A, Solution Structure Of The Erythroid P55 Pdz Domain Length = 97 Back     alignment and structure
>pdb|1KWA|A Chain A, Human CaskLIN-2 Pdz Domain Length = 88 Back     alignment and structure
>pdb|1Z6G|A Chain A, Crystal Structure Of Guanylate Kinase From Plasmodium Falciparum Length = 218 Back     alignment and structure
>pdb|2EJY|A Chain A, Solution Structure Of The P55 Pdz T85c Domain Complexed With The Glycophorin C F127c Peptide Length = 97 Back     alignment and structure
>pdb|2E7K|A Chain A, Solution Structure Of The Pdz Domain From Human Maguk P55 Subfamily Member 2 Length = 91 Back     alignment and structure
>pdb|1K76|A Chain A, Solution Structure Of The C-Terminal Sem-5 Sh3 Domain (Minimized Average Structure) Length = 62 Back     alignment and structure
>pdb|3SEM|A Chain A, Sem5 Sh3 Domain Complexed With Peptoid Inhibitor Length = 60 Back     alignment and structure
>pdb|1SEM|A Chain A, Structural Determinants Of Peptide-Binding Orientation And Of Sequence Specificity In Sh3 Domains Length = 58 Back     alignment and structure
>pdb|1UDL|A Chain A, The Solution Structure Of The Fifth Sh3 Domain Of Intersectin 2 (Kiaa1256) Length = 98 Back     alignment and structure
>pdb|3O46|A Chain A, Crystal Structure Of The Pdz Domain Of Mpp7 Length = 93 Back     alignment and structure
>pdb|2VWF|A Chain A, Grb2 Sh3c (2) Length = 58 Back     alignment and structure
>pdb|1GCQ|A Chain A, Crystal Structure Of Vav And Grb2 Sh3 Domains Length = 61 Back     alignment and structure
>pdb|1IO6|A Chain A, Growth Factor Receptor-Bound Protein 2 (Grb2) C-Terminal Sh3 Domain Complexed With A Ligand Peptide (Nmr, Minimized Mean Structure) Length = 59 Back     alignment and structure
>pdb|1GRI|A Chain A, Grb2 Length = 217 Back     alignment and structure
>pdb|3LNC|A Chain A, Crystal Structure Of Guanylate Kinase From Anaplasma Phagocytophilum Length = 231 Back     alignment and structure
>pdb|1S96|A Chain A, The 2.0 A X-Ray Structure Of Guanylate Kinase From E.Coli Length = 219 Back     alignment and structure
>pdb|2AN9|A Chain A, Crystal Structure Of Oligomeric E.Coli Guanylate Kinase In Complex With Gdp Length = 207 Back     alignment and structure
>pdb|2EYY|A Chain A, Ct10-Regulated Kinase Isoform I Length = 204 Back     alignment and structure
>pdb|2DVJ|A Chain A, Phosphorylated Crk-Ii Length = 230 Back     alignment and structure
>pdb|2VVK|A Chain A, Grb2 Sh3c (1) Length = 56 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query440
1kjw_A295 Postsynaptic density protein 95; protein-protein i 8e-59
1kjw_A295 Postsynaptic density protein 95; protein-protein i 2e-39
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 2e-58
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 7e-39
2xkx_A721 Disks large homolog 4; structural protein, scaffol 9e-53
2xkx_A 721 Disks large homolog 4; structural protein, scaffol 2e-07
4dey_A337 Voltage-dependent L-type calcium channel subunit; 3e-40
4dey_A337 Voltage-dependent L-type calcium channel subunit; 2e-19
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 6e-40
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 1e-29
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 2e-39
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 2e-29
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 5e-33
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 2e-13
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 2e-31
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 3e-21
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 7e-19
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 2e-20
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 7e-19
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 2e-20
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 3e-19
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 7e-20
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 8e-19
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 6e-19
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 7e-18
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 8e-19
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 8e-18
3kfv_A308 Tight junction protein ZO-3; structural genomics c 1e-17
3kfv_A308 Tight junction protein ZO-3; structural genomics c 4e-08
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 2e-17
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 5e-16
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 4e-16
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 5e-16
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 8e-15
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 7e-14
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 2e-14
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 1e-13
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 2e-14
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 6e-14
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 2e-14
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 3e-14
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 9e-13
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 1e-12
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 9e-12
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 7e-11
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 1e-10
1awj_A77 ITK; transferase, regulatory intramolecular comple 4e-10
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 8e-10
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 1e-09
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 1e-09
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 2e-09
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 3e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 4e-09
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 4e-09
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 4e-09
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 5e-09
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 5e-09
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 6e-09
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 7e-09
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 7e-09
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 8e-09
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 8e-09
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 1e-08
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 1e-08
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 1e-08
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 2e-08
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 2e-08
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 2e-08
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 2e-08
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 3e-08
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 3e-08
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 4e-08
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 4e-08
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 4e-08
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 4e-08
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 4e-08
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 2e-04
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 4e-08
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 5e-08
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 5e-08
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 6e-08
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 6e-08
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 6e-08
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 9e-08
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 9e-08
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 1e-07
1uti_A58 GRB2-related adaptor protein 2; signaling protein 1e-07
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 1e-07
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 1e-07
1wxb_A68 Epidermal growth factor receptor pathway substrate 2e-07
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 2e-07
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 2e-07
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 2e-07
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 2e-07
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 2e-07
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 2e-07
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 2e-04
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 2e-07
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 2e-07
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 2e-07
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 2e-07
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 3e-07
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 3e-07
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 3e-07
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 3e-07
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 3e-07
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 3e-07
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 3e-07
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 4e-07
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 4e-07
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 4e-07
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 6e-07
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 6e-07
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 6e-07
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 6e-07
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 6e-07
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 6e-07
2dil_A69 Proline-serine-threonine phosphatase-interacting p 7e-07
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 7e-07
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 7e-07
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 8e-07
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 8e-07
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 8e-07
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 9e-07
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 9e-07
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 1e-06
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 1e-06
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 1e-06
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 1e-06
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 1e-06
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 1e-06
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 1e-06
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 1e-06
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 1e-06
2cuc_A70 SH3 domain containing ring finger 2; structural ge 1e-06
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 1e-06
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 1e-06
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 1e-06
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 1e-06
3u23_A65 CD2-associated protein; structural genomics, struc 1e-06
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 1e-06
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 2e-04
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 2e-06
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 2e-06
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 2e-06
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 2e-06
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 2e-06
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} Length 2e-06
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-06
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 2e-05
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 2e-06
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 3e-06
1i07_A60 Epidermal growth factor receptor kinase substrate 3e-06
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 3e-06
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 3e-06
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 3e-06
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 3e-06
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 3e-06
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 3e-06
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 3e-06
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 4e-06
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 4e-06
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 4e-06
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 4e-06
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 4e-06
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 4e-06
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 4e-06
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 5e-05
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 5e-06
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 5e-06
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 5e-06
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 5e-06
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 5e-06
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 6e-06
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 6e-06
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 6e-06
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 6e-06
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 7e-06
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 7e-06
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 7e-06
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 7e-06
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 9e-05
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 7e-06
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 7e-06
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 7e-06
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 8e-06
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 3e-04
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 9e-06
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 9e-06
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 9e-06
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 1e-05
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 1e-05
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 2e-04
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 1e-05
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 1e-05
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 3e-05
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 1e-05
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 1e-05
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 1e-05
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 1e-05
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 1e-05
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 1e-05
2eaq_A90 LIM domain only protein 7; conserved hypothetical 1e-05
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 2e-05
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 2e-05
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 2e-05
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 2e-05
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 2e-05
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 2e-05
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 2e-05
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 2e-05
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 2e-05
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 2e-05
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 2e-05
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 2e-05
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 2e-05
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 3e-05
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 3e-05
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 3e-05
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 3e-05
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 3e-05
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 3e-05
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 3e-05
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 3e-05
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 3e-05
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 3e-05
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 4e-04
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 3e-05
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 3e-05
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 3e-05
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 3e-05
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 3e-05
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 4e-05
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 4e-05
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 4e-05
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 4e-05
2hga_A125 Conserved protein MTH1368; GFT structural genomics 4e-05
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 4e-05
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 4e-05
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 4e-05
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 4e-05
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 5e-05
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 5e-05
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 5e-05
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 6e-05
2kl1_A94 YLBL protein; structure genomics, structural genom 6e-05
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 6e-05
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 6e-05
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 6e-05
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 6e-05
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 6e-05
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 6e-05
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 7e-05
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 7e-05
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 7e-05
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 7e-05
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 7e-05
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 8e-05
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 8e-05
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 8e-05
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 8e-05
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 8e-05
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 9e-05
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 9e-05
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 1e-04
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 1e-04
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 1e-04
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 1e-04
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 1e-04
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 1e-04
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 1e-04
2o2t_A117 Multiple PDZ domain protein; structural protein, s 1e-04
2eeh_A100 PDZ domain-containing protein 7; structural genomi 1e-04
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 1e-04
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 1e-04
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 1e-04
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 1e-04
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 1e-04
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 1e-04
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 1e-04
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 1e-04
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 2e-04
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 2e-04
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 2e-04
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 2e-04
2opg_A98 Multiple PDZ domain protein; structural protein, s 2e-04
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 2e-04
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 2e-04
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 2e-04
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 2e-04
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-04
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 2e-04
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 2e-04
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 2e-04
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 2e-04
2da9_A70 SH3-domain kinase binding protein 1; structural ge 2e-04
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 2e-04
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 2e-04
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 2e-04
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 2e-04
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 2e-04
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 2e-04
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 2e-04
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 3e-04
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 3e-04
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 3e-04
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 3e-04
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 3e-04
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 3e-04
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 3e-04
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 3e-04
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 3e-04
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 3e-04
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 3e-04
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 4e-04
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 4e-04
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 4e-04
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 4e-04
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 4e-04
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 4e-04
2fne_A117 Multiple PDZ domain protein; structural protein, s 4e-04
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 4e-04
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 4e-04
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 4e-04
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 4e-04
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 4e-04
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 4e-04
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 4e-04
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 5e-04
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 5e-04
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 5e-04
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 5e-04
2djt_A104 Unnamed protein product; PDZ domain, structural ge 5e-04
2d90_A102 PDZ domain containing protein 1; structural genomi 6e-04
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 6e-04
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 6e-04
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 7e-04
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 7e-04
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 7e-04
3k1r_A192 Harmonin; protein-protein complex, alternative spl 7e-04
2v90_A96 PDZ domain-containing protein 3; membrane, protein 7e-04
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 7e-04
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 7e-04
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 8e-04
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 8e-04
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 8e-04
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 8e-04
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 8e-04
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 8e-04
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
 Score =  193 bits (493), Expect = 8e-59
 Identities = 69/206 (33%), Positives = 97/206 (47%), Gaps = 33/206 (16%)

Query: 99  YMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEP---TGPMGLVP 155
           Y+R LF YD  +D     +   L+F  GD+L +++  D  WWQA+ +     T  +G +P
Sbjct: 3   YIRALFDYDKTKDCGFLSQ--ALSFRFGDVLHVIDAGDEEWWQARRVHSDSETDDIGFIP 60

Query: 156 SQELEERRKAFVPPEADYVHKIGICGTRY-------IKQYNT------------------ 190
           S+   ERR+       D+    G  G          + Q                     
Sbjct: 61  SKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRAND 120

Query: 191 --LQYNSTLMSRSFPDTTRPMRELEENGQNYWF-TSREVMERDIQDHKFLEYGEHNGHLY 247
             L           P TTRP RE E +G++Y F +SRE ME+DIQ HKF+E G++N HLY
Sbjct: 121 DLLSEFPDKFGSCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQYNSHLY 180

Query: 248 GTHLDSIREVILSGKICVLDCSPVGL 273
           GT + S+REV   GK C+LD S   +
Sbjct: 181 GTSVQSVREVAEQGKHCILDVSANAV 206
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Length = 295 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Length = 292 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Length = 721 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Length = 337 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Length = 180 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Length = 180 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} Length = 197 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Length = 391 Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Length = 468 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Length = 204 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Length = 204 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Length = 198 Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Length = 198 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Length = 218 Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Length = 218 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Length = 208 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Length = 208 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Length = 207 Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Length = 207 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Length = 308 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Length = 207 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Length = 207 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Length = 97 Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Length = 88 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Length = 205 Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Length = 205 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Length = 231 Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Length = 231 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Length = 219 Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Length = 219 Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} Length = 93 Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Length = 67 Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Length = 77 Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Length = 95 Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Length = 128 Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Length = 65 Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} PDB: 3h0i_A 3h0f_A* Length = 73 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Length = 57 Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 96 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 98 Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Length = 92 Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Length = 83 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Length = 67 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Length = 79 Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Length = 65 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A 1qwf_A 1prl_C ... Length = 84 Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Length = 120 Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 76 Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Length = 96 Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Length = 113 Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Length = 58 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Length = 193 Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Length = 68 Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Length = 76 Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Length = 62 Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Length = 58 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Length = 86 Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Length = 108 Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Length = 174 Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Length = 448 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Length = 112 Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Length = 73 Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Length = 82 Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Length = 71 Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Length = 71 Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Length = 58 Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 76 Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Length = 106 Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Length = 142 Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Length = 60 Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Length = 59 Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Length = 86 Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Length = 69 Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Length = 325 Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Length = 73 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Length = 58 Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Length = 58 Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Length = 97 Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Length = 62 Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Length = 70 Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Length = 67 Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 124 Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Length = 60 Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Length = 70 Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Length = 58 Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Length = 67 Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Length = 65 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Length = 436 Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 90 Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Length = 58 Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Length = 68 Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Length = 68 Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Length = 64 Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Length = 65 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Length = 196 Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Length = 59 Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Length = 60 Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Length = 73 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Length = 58 Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Length = 73 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Length = 90 Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Length = 88 Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Length = 60 Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Length = 118 Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Length = 63 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Length = 58 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Length = 451 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Length = 68 Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Length = 69 Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Length = 80 Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 3nwu_A 2ytw_A 2joa_A Length = 332 Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Length = 73 Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Length = 112 Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Length = 64 Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Length = 62 Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Length = 60 Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Length = 196 Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Length = 95 Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Length = 65 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Length = 308 Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 69 Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 69 Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 80 Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Length = 206 Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Length = 200 Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Length = 74 Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 79 Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Length = 89 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Length = 126 Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Length = 90 Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Length = 72 Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 62 Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Length = 77 Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 114 Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 77 Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 122 Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Length = 90 Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Length = 108 Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Length = 63 Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Length = 230 Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Length = 81 Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 94 Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Length = 127 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Length = 61 Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Length = 217 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Length = 106 Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Length = 91 Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Length = 87 Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Length = 89 Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Length = 125 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Length = 71 Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Length = 85 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Length = 95 Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Length = 94 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 117 Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} Length = 67 Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Length = 91 Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Length = 94 Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Length = 85 Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Length = 93 Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Length = 58 Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 128 Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} PDB: 2d1x_A Length = 65 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Length = 92 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Length = 114 Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Length = 105 Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Length = 128 Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 93 Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Length = 131 Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Length = 68 Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 119 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Length = 100 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Length = 67 Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Length = 64 Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 74 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Length = 98 Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 113 Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Length = 112 Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 117 Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Length = 119 Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} Length = 106 Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Length = 452 Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Length = 88 Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Length = 90 Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Length = 60 Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Length = 303 Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Length = 91 Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Length = 87 Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Length = 67 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Length = 98 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 111 Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Length = 318 Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Length = 97 Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Length = 54 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Length = 120 Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Length = 118 Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Length = 114 Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 107 Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Length = 104 Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 70 Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Length = 104 Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Length = 109 Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Length = 103 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Length = 129 Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Length = 123 Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Length = 345 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 81 Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 105 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Length = 91 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Length = 69 Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Length = 130 Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 92 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Length = 324 Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Length = 450 Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Length = 113 Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 73 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Length = 90 Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Length = 83 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Length = 125 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 101 Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Length = 117 Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Length = 115 Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Length = 111 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Length = 454 Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Length = 93 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Length = 304 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Length = 263 Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Length = 97 Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 119 Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 120 Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 123 Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Length = 96 Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 102 Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Length = 91 Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Length = 166 Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Length = 341 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Length = 114 Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A Length = 192 Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Length = 96 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Length = 110 Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Length = 69 Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Length = 101 Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Length = 62 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Length = 121 Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Length = 104 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Length = 129 Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Length = 486 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
2xkx_A721 Disks large homolog 4; structural protein, scaffol 100.0
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 100.0
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 100.0
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 100.0
1kjw_A295 Postsynaptic density protein 95; protein-protein i 100.0
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 100.0
3kfv_A308 Tight junction protein ZO-3; structural genomics c 100.0
4dey_A337 Voltage-dependent L-type calcium channel subunit; 100.0
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 100.0
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 99.89
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 99.88
2xkx_A721 Disks large homolog 4; structural protein, scaffol 99.88
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 99.87
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 99.85
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 99.82
1ex7_A186 Guanylate kinase; substrate-induced FIT, domain mo 99.82
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 99.77
3tvt_A292 Disks large 1 tumor suppressor protein; DLG, SRC-h 99.74
1kjw_A295 Postsynaptic density protein 95; protein-protein i 99.71
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 99.59
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 99.54
3gge_A95 PDZ domain-containing protein GIPC2; structural ge 99.52
3ney_A197 55 kDa erythrocyte membrane protein; structural ge 99.47
1r6j_A82 Syntenin 1; PDZ, membrane protein; 0.73A {Homo sap 99.45
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 99.43
3o46_A93 Maguk P55 subfamily member 7; PDZ domain, structur 99.37
2ejy_A97 55 kDa erythrocyte membrane protein; GPC, maguk, P 99.34
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 99.34
1kwa_A88 Hcask/LIN-2 protein; PDZ domain, neurexin, syndeca 99.31
2he4_A90 Na(+)/H(+) exchange regulatory cofactor NHE-RF2; p 99.29
3i4w_A104 Disks large homolog 4; alpha and beta protein, alt 99.27
2d92_A108 INAD-like protein; PDZ domain, inadl protein, hina 99.27
2dkr_A93 LIN-7 homolog B; LIN-7B, PDZ, structural genomics, 99.26
2jik_A101 Synaptojanin-2 binding protein; transmembrane, out 99.25
1g9o_A91 NHE-RF; PDZ domain, complex, signaling protein; 1. 99.25
3r68_A95 Na(+)/H(+) exchange regulatory cofactor NHE-RF3; P 99.25
3b76_A118 E3 ubiquitin-protein ligase LNX; PDZ, bound ligand 99.25
1d5g_A96 Human phosphatase HPTP1E; protein-peptide complex, 99.25
2fne_A117 Multiple PDZ domain protein; structural protein, s 99.24
2awx_A105 Synapse associated protein 97; membrane protein, s 99.24
2e7k_A91 Maguk P55 subfamily member 2; PDZ domain, MPP2 pro 99.23
3l4f_D132 SH3 and multiple ankyrin repeat domains protein 1; 99.23
1wha_A105 KIAA0147 protein, scribble; PDZ domain, cellular s 99.23
2vsp_A91 PDZ domain-containing protein 1; membrane, cytopla 99.23
1n7e_A97 AMPA receptor interacting protein GRIP; PDZ, prote 99.22
2lj0_A65 Sorbin and SH3 domain-containing protein 1; R85FL, 99.21
2lx7_A60 GAS-7, growth arrest-specific protein 7; structura 99.21
2ego_A96 General receptor for phosphoinositides 1- associat 99.2
1v62_A117 KIAA1719 protein; structural genomics, synaptic tr 99.2
2iwo_A120 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 99.2
2v90_A96 PDZ domain-containing protein 3; membrane, protein 99.2
2ege_A75 Uncharacterized protein KIAA1666; SH3 domain, KIAA 99.2
1wi4_A109 Synip, syntaxin binding protein 4; syntaxin4-inter 99.19
1uhp_A107 Hypothetical protein KIAA1095; PDZ domain, semapho 99.19
2dlu_A111 INAD-like protein; PDZ domain, inadl protein, hina 99.19
1ujd_A117 KIAA0559 protein; PDZ domain, structural genomics, 99.19
2opg_A98 Multiple PDZ domain protein; structural protein, s 99.19
2fe5_A94 Presynaptic protein SAP102; PDZ domain, DLG3, huma 99.19
2i1n_A102 Discs, large homolog 3; DLG3, PDZ, PDZ domain, sig 99.18
2byg_A117 Channel associated protein of synapse-110; DLG2, P 99.18
2d90_A102 PDZ domain containing protein 1; structural genomi 99.18
3cbz_A108 Dishevelled-2; PDZ domain, phage derived high affi 99.18
2dc2_A103 GOPC, golgi associated PDZ and coiled-coil motif c 99.18
2yt7_A101 Amyloid beta A4 precursor protein-binding family A 99.18
2db5_A128 INAD-like protein; PDZ domain, hinadl, PALS1- asso 99.17
1nf3_C128 PAR-6B; semi-CRIB motif, switch I and II, PDZ doma 99.17
2r4h_A112 Membrane-associated guanylate kinase, WW and PDZ c 99.17
2q9v_A90 Membrane-associated guanylate kinase, WW and PDZ c 99.17
3qe1_A107 Sorting nexin-27, G protein-activated inward RECT 99.17
4e34_A87 Golgi-associated PDZ and coiled-coil motif-contai 99.16
2f5y_A91 Regulator of G-protein signalling 3 isoform 1; PDZ 99.16
1qav_A90 Alpha-1 syntrophin (residues 77-171); beta-finger, 99.16
1wf8_A107 Neurabin-I; PDZ domain, structural genomics, NPPSF 99.16
2ehr_A117 INAD-like protein; PDZ domain, inadl protein, hina 99.16
2jil_A97 GRIP1 protein, glutamate receptor interacting prot 99.16
1uju_A111 Scribble; PDZ domain, cellular signaling, structur 99.16
1i16_A130 Interleukin 16, LCF; cytokine, lymphocyte chemoatt 99.15
2qg1_A92 Multiple PDZ domain protein; MPDZ, MUPP1, structur 99.15
2daz_A124 INAD-like protein; PDZ domain, inadl protein, hina 99.15
1wi2_A104 Riken cDNA 2700099C19; structural genomics, riken 99.15
1um1_A110 KIAA1849 protein, RSGI RUH-007; PDZ domain, human 99.14
3axa_A106 Afadin, nectin-3, protein AF-6; PDZ domain, fusion 99.14
2csi_A76 RIM-BP2, RIM binding protein 2; SH3 domain, struct 99.14
1ufx_A103 KIAA1526 protein; PDZ domain, structural genomics, 99.14
2kpk_A129 Membrane-associated guanylate kinase, WW and PDZ c 99.14
1ueq_A123 Membrane associated guanylate kinase inverted-2 (M 99.14
1uep_A103 Membrane associated guanylate kinase inverted-2 (M 99.13
2vwr_A95 Ligand of NUMB protein X 2; protein-binding, metal 99.13
2eei_A106 PDZ domain-containing protein 1; regulatory factor 99.12
1m5z_A91 GRIP, AMPA receptor interacting protein; six beta- 99.12
2i04_A85 Membrane-associated guanylate kinase, WW and PDZ d 99.12
2eno_A120 Synaptojanin-2-binding protein; mitochondrial oute 99.12
2dls_A93 PDZ-rhogef, RHO guanine nucleotide exchange factor 99.12
1q7x_A108 PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, str 99.12
2ed1_A76 130 kDa phosphatidylinositol 4,5-biphosphate- depe 99.11
1tp5_A119 Presynaptic density protein 95; PDZ-peptide ligand 99.11
2uzc_A88 Human pdlim5, PDZ and LIM domain 5; metal-binding, 99.11
3e17_A88 Tight junction protein ZO-2; domain swapping, alte 99.1
2la8_A106 Inactivation-NO-after-potential D protein, KON-TI 99.1
3egg_C170 Spinophilin; PP1, serine/threonine phosphatase, po 99.1
2o2t_A117 Multiple PDZ domain protein; structural protein, s 99.1
2kv8_A83 RGS12, regulator of G-protein signaling 12; PDZ do 99.1
1b07_A65 Protein (proto-oncogene CRK (CRK)); SH3 domain, in 99.09
2gzv_A114 PRKCA-binding protein; protein kinase C, PDZ domai 99.09
1uew_A114 Membrane associated guanylate kinase inverted-2 (M 99.09
1ihj_A98 INAD; intermolecular disulfide bond, PDZ domain, s 99.09
3tau_A208 Guanylate kinase, GMP kinase; structural genomics, 99.08
1va8_A113 Maguk P55 subfamily member 5; PDZ domain, palmitoy 99.08
2vsv_A109 Rhophilin-2; scaffold protein, RHO GTPase binding, 99.07
2fcf_A103 Multiple PDZ domain protein; adaptor molecule, pro 99.07
3hpk_A125 Protein interacting with PRKCA 1; oxidized, PDZ do 99.06
1tg0_A68 BBC1 protein, myosin tail region-interacting prote 99.06
1zlm_A58 Osteoclast stimulating factor 1; beta barrel, sign 99.06
2djt_A104 Unnamed protein product; PDZ domain, structural ge 99.05
2jxo_A98 Ezrin-radixin-moesin-binding phosphoprotein 50; nh 99.05
2g5m_B113 Neurabin-2; spinophilin, PDZ domain, CNS, synaptic 99.05
2gnc_A60 SLIT-ROBO RHO GTPase-activating protein 1; beta ba 99.05
1q3o_A109 Shank1; PDZ, GKAP, peptide binding protein; 1.80A 99.05
4amh_A106 Disks large homolog 1; permutation, protein foldin 99.05
2dm8_A116 INAD-like protein; PDZ domain, inadl protein, hina 99.04
1k4u_S62 Phagocyte NADPH oxidase subunit P67PHOX; SH3-pepti 99.04
2dmz_A129 INAD-like protein; PDZ domain, inadl protein, hina 99.04
3ulr_B65 SRC substrate cortactin; SH3, protein-protein inte 99.03
3nfk_A107 Tyrosine-protein phosphatase non-receptor type 4; 99.03
1uti_A58 GRB2-related adaptor protein 2; signaling protein 99.03
1w70_A60 Neutrophil cytosol factor 4; NADPH oxidase, P40PHO 99.03
1v6b_A118 Harmonin isoform A1; structural genomics, usher sy 99.03
3bpu_A88 Membrane-associated guanylate kinase, WW and PDZ c 99.03
1jo8_A58 ABP1P, actin binding protein; SH3 domain actin-bin 99.03
3ngh_A106 PDZ domain-containing protein 1; adaptor protein, 99.03
1n7t_A103 99-MER peptide of densin-180-like protein; PDZ dom 99.03
2cs5_A119 Tyrosine-protein phosphatase, non-receptor type 4; 99.03
2drm_A58 Acanthamoeba myosin IB; SH3 domain, contractIle pr 99.03
1um7_A113 Synapse-associated protein 102; PDZ, discs large h 99.03
2fei_A65 CD2-associated protein; CMS SH3 domain, structural 99.03
2bz8_A58 SH3-domain kinase binding protein 1; SH3 domain, C 99.02
1uj0_A62 Signal transducing adaptor molecule (SH3 domain an 99.02
2ew3_A68 SH3-containing GRB2-like protein 3; SH3GL3, soluti 99.02
1cka_A57 C-CRK N-terminal SH3 domain; complex (oncogene pro 99.02
2eyx_A67 V-CRK sarcoma virus CT10 oncogene homolog isoform 99.02
2ak5_A64 RHO guanine nucleotide exchange factor 7; adaptor 99.02
1sem_A58 SEM-5; SRC-homology 3 (SH3) domain, peptide-bindin 99.02
2pa1_A87 PDZ and LIM domain protein 2; PDZ domain, structur 99.02
2z17_A104 Pleckstrin homology SEC7 and coiled-coil domains- 99.02
1wg6_A127 Hypothetical protein (riken cDNA 2810455B10); stru 99.01
2qkv_A96 Inactivation-NO-after-potential D protein; PDZ dom 99.01
1wfg_A131 Regulating synaptic membrane exocytosis protein 2; 99.01
2nwm_A65 Vinexin; cell adhesion; NMR {Homo sapiens} 99.01
1rgw_A85 ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, 99.01
1x5q_A110 LAP4 protein; PDZ domain, scribble homolog protein 99.01
2b86_A67 Cytoplasmic protein NCK2; NCK SH3 domain, signalin 99.01
2w4f_A97 Protein LAP4; structural protein, phosphoprotein, 99.01
2iim_A62 Proto-oncogene tyrosine-protein kinase LCK; beta-b 99.01
2jre_A108 C60-1 PDZ domain peptide; de novo protein; NMR {Sy 99.01
2l0a_A72 STAM-1, signal transducing adapter molecule 1; str 99.01
1uit_A117 Human discs large 5 protein; PDZ domain, HDLG5, ma 99.01
1zx6_A58 YPR154WP; SH3 domain, protein binding; 1.60A {Sacc 99.0
2ke9_A83 Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosp 99.0
2q3g_A89 PDZ and LIM domain protein 7; structural genomics, 99.0
2rqv_A108 BUD emergence protein 1; BEM1P, SH3, CDC42P, cytop 99.0
2g6f_X59 RHO guanine nucleotide exchange factor 7; SH3 doma 99.0
2eeg_A94 PDZ and LIM domain protein 4; PDZ domain, structur 99.0
1mfg_A95 ERB-B2 interacting protein; PDZ domain, protein-pe 99.0
2vwf_A58 Growth factor receptor-bound protein 2; polymorphi 99.0
2koj_A111 Partitioning defective 3 homolog; PDZ domain, stru 99.0
2fpe_A62 C-JUN-amino-terminal kinase interacting protein 1; 99.0
2iwq_A123 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.99
3khf_A99 Microtubule-associated serine/threonine-protein ki 98.99
2i0n_A80 Class VII unconventional myosin; beta-sheet loop, 98.99
3h0h_A73 Proto-oncogene tyrosine-protein kinase FYN; beta b 98.99
2bzy_A67 CRK-like protein, CRKL SH3C; SH3 domain, dimer, nu 98.99
2yuy_A126 RHO GTPase activating protein 21; PDZ domain, stru 98.99
2xmf_A60 Myosin 1E SH3; motor protein, SH3 domain; HET: DIA 98.99
2jte_A64 CD2-associated protein; SH3 domain, coiled coil, c 98.99
3a00_A186 Guanylate kinase, GMP kinase; domain movement, dim 98.99
2yt6_A109 Adult MALE urinary bladder cDNA, riken FULL- lengt 98.99
1y7n_A90 Amyloid beta A4 precursor protein-binding family A 98.99
2qor_A204 Guanylate kinase; phosphotransferase, purine metab 98.99
2yuq_A85 Tyrosine-protein kinase ITK/TSK; T-cell-specific k 98.99
2cud_A79 SRC-like-adapter; SH3 domain, negative mitogenesis 98.99
2dl4_A68 Protein STAC; SH3 domain, STAC protein, SRC homolo 98.99
2dmo_A68 Neutrophil cytosol factor 2; SH3 domain, structura 98.98
2pkt_A91 PDZ and LIM domain protein 1; PDZ domain, structur 98.98
1wie_A96 RIM binding protein 2; beta barrel, KIAA0318 prote 98.98
1z87_A263 Alpha-1-syntrophin; protein binding; NMR {Mus musc 98.98
1csk_A71 C-SRC SH3 domain; phosphotransferase; 2.50A {Homo 98.98
1wyx_A69 CRK-associated substrate; beta sheets, cell adhesi 98.98
2k2m_A68 EPS8-like protein 1; alternative splicing, coiled 98.98
3kzd_A94 TIAM-1, T-lymphoma invasion and metastasis-inducin 98.97
2ydl_A69 SH3 domain-containing kinase-binding protein 1; si 98.97
1wf7_A103 Enigma homologue protein; PDZ domain, structural g 98.97
2csj_A117 TJP2 protein; PDZ domain, structural genomics, NPP 98.97
2d8j_A77 FYN-related kinase; SH3 domain, structural genomic 98.97
1x6d_A119 Interleukin-16; PDZ domain, lymphocyte chemoattrac 98.97
1oot_A60 Hypothetical 40.4 kDa protein in PES4-His2 interge 98.97
1x2q_A88 Signal transducing adapter molecule 2; SH3 domain, 98.97
2j6f_A62 CD2-associated protein; metal-binding, immune resp 98.97
2dbk_A88 CRK-like protein; structural genomics, NPPSFA, nat 98.96
1x2k_A68 OSTF1, osteoclast stimulating factor 1; SH3 domain 98.96
1wfv_A103 Membrane associated guanylate kinase inverted-2; a 98.96
2kym_A120 BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI 98.96
1kgd_A180 CASK, peripheral plasma membrane CASK; maguk, guan 98.96
4e6r_A58 Cytoplasmic protein NCK2; SH3 domain, protein bind 98.96
2kgt_A72 Tyrosine-protein kinase 6; SH3 domain, SRC kinase, 98.96
1awj_A77 ITK; transferase, regulatory intramolecular comple 98.96
2iwn_A97 Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUP 98.96
1x2p_A68 Protein arginine N-methyltransferase 2; SH3 domain 98.95
2j05_A65 RAS GTPase-activating protein 1; GTPase activation 98.95
3k1r_A192 Harmonin; protein-protein complex, alternative spl 98.95
3tsv_A124 Tight junction protein ZO-1; PDZ, scaffolding, JAM 98.95
2ebp_A73 SAM and SH3 domain-containing protein 1; proline-g 98.95
2dl8_A72 SLIT-ROBO RHO GTPase-activating protein 2; SH3 dom 98.95
1ue9_A80 Intersectin 2; beta barrel, SH3 domain, riken stru 98.95
2djq_A68 SH3 domain containing ring finger 2; MUS musculus 98.95
3c0c_A73 Endophilin-A2; endocytosis, SH3, voltage-gated cal 98.95
1aww_A67 ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linke 98.94
2egc_A75 SH3 and PX domain-containing protein 2A; SH3 domai 98.94
1v5q_A122 GRIP1 homolog, glutamate receptor interacting prot 98.94
1gl5_A67 Tyrosine-protein kinase TEC; transferase, ATP-bind 98.94
1uez_A101 KIAA1526 protein; PDZ domain, structural genomics, 98.94
1y0m_A61 1-phosphatidylinositol-4,5-bisphosphate phosphodie 98.94
2d8h_A80 SH3YL1 protein; SH3 domain, hypothetical protein S 98.94
2k9g_A73 SH3 domain-containing kinase-binding protein 1; CI 98.94
3soe_A113 Membrane-associated guanylate kinase, WW and PDZ c 98.94
1uhc_A79 KIAA1010 protein; beta barrel, SH3, human cDNA, st 98.94
2h2b_A107 Tight junction protein ZO-1; PDZ domain, phage der 98.93
2ysq_A81 RHO guanine nucleotide exchange factor 9; SH3 doma 98.93
2dlp_A85 KIAA1783 protein; SH3 domain, structural genomics, 98.93
2dl3_A68 Sorbin and SH3 domain-containing protein 1; ponsin 98.93
2dbm_A73 SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH 98.93
4glm_A72 Dynamin-binding protein; SH3 domain, DNMBP, struct 98.93
2o9s_A67 Ponsin; SH3 domain, signaling protein; 0.83A {Homo 98.93
1vb7_A94 PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, 98.92
2ed0_A78 ABL interactor 2; coiled coil, cytoskeleton, nucle 98.92
1ugv_A72 KIAA0621, olygophrenin-1 like protein; beta barrel 98.92
3u23_A65 CD2-associated protein; structural genomics, struc 98.92
1i07_A60 Epidermal growth factor receptor kinase substrate 98.92
3ngp_A62 Spectrin alpha chain, brain; beta barrel, structur 98.92
2cre_A71 HEF-like protein; SH3 domain, SRC homology 3 domai 98.92
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.92
2a28_A54 BZZ1 protein; SH3 domain, signaling protein; 1.07A 98.92
2eeh_A100 PDZ domain-containing protein 7; structural genomi 98.92
2kxd_A73 11-MER peptide, SH3 domain of spectrin alpha CHAI; 98.92
1x6g_A81 Megakaryocyte-associated tyrosine-protein kinase; 98.92
2eqi_A69 Phospholipase C, gamma 2; SH3 domain, PLCG2, struc 98.92
2dl7_A73 KIAA0769 protein; SH3 domain, FCHSD2, structural g 98.92
2v1q_A60 SLA1, cytoskeleton assembly control protein SLA1; 98.92
2oaw_A65 Spectrin alpha chain, brain; SH3 domain, chimera, 98.92
1z9q_A79 Neutrophil cytosol factor 4; oxidoreductase activa 98.91
3rnj_A67 Brain-specific angiogenesis inhibitor 1-associate 98.91
1yn8_A59 NBP2, NAP1-binding protein 2; SH3 domain, unknown 98.91
1zuu_A58 BZZ1 protein; SH3 domain, unknown function; 0.97A 98.91
4esr_A69 Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domai 98.91
2yuo_A78 CIP85, RUN and TBC1 domain containing 3; structura 98.91
2gqi_A71 RAS GTPase-activating protein 1; GAP, RAS P21 prot 98.91
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.91
3cqt_A79 P59-FYN, proto-oncogene tyrosine-protein kinase FY 98.91
2m0y_A74 Dedicator of cytokinesis protein 1; apoptosis; NMR 98.91
1ujy_A76 RHO guanine nucleotide exchange factor 6; structur 98.91
2kom_A121 Partitioning defective 3 homolog; PAR-3B, PDZ doma 98.91
1wxt_A68 Hypothetical protein FLJ21522; SH3 domain, EPS8-re 98.9
1x69_A79 Cortactin isoform A; SH3 domain, CTTN, oncogene EM 98.9
1neg_A83 Spectrin alpha chain, brain; SH3-domain fold, five 98.9
3eg3_A63 Proto-oncogene tyrosine-protein kinase ABL1; beta, 98.9
1zuy_A58 Myosin-5 isoform; SH3 domain, contractIle protein; 98.9
2kjd_A128 Sodium/hydrogen exchange regulatory cofactor NHE- 98.9
2lcs_A73 NAP1-binding protein 2; adaptor, transferase, sign 98.9
2edz_A114 PDZ domain-containing protein 1; CFTR-associated p 98.89
2csq_A97 RIM-BP2, RIM binding protein 2; SH3 domain, struct 98.89
1vae_A111 Rhophilin 2, rhophilin, RHO GTPase binding protein 98.89
2jw4_A72 Cytoplasmic protein NCK1; SH3 domain, phosphorylat 98.89
2fpf_A71 C-JUN-amino-terminal kinase interacting protein 1; 98.89
1gbq_A74 GRB2; complex (signal transduction/peptide), SH3 d 98.89
2dil_A69 Proline-serine-threonine phosphatase-interacting p 98.89
2jt4_A71 Cytoskeleton assembly control protein SLA1; endocy 98.89
2da9_A70 SH3-domain kinase binding protein 1; structural ge 98.89
2jxb_A86 T-cell surface glycoprotein CD3 epsilon chain, cyt 98.89
1uhf_A69 Intersectin 2; beta barrel, SH3 domain, riken stru 98.89
1wif_A126 RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, s 98.89
2dm1_A73 Protein VAV-2; RHO family guanine nucleotide excha 98.88
2edv_A96 FERM and PDZ domain-containing protein 1; cytoskel 98.88
2rf0_A89 Mitogen-activated protein kinase kinase kinase 10; 98.88
3thk_A73 Spectrin alpha chain, brain; SH3 domain, chimera, 98.88
1x43_A81 Endophilin B1, SH3 domain GRB2-like protein B1; st 98.88
2ecz_A70 Sorbin and SH3 domain-containing protein 1; glycop 98.88
4f14_A64 Nebulette; SH3 domain, heart muscle, actin-binding 98.88
1u5s_A71 Cytoplasmic protein NCK2; protein-protein complex, 98.88
1wi7_A68 SH3-domain kinase binding protein 1; beta barrel, 98.87
1wxb_A68 Epidermal growth factor receptor pathway substrate 98.87
2epd_A76 RHO GTPase-activating protein 4; SH3 domain, struc 98.87
2cuc_A70 SH3 domain containing ring finger 2; structural ge 98.87
1nm7_A69 Peroxisomal membrane protein PAS20; yeast, PEX5P, 98.87
2kxc_A67 Brain-specific angiogenesis inhibitor 1-associate 98.87
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.87
1spk_A72 RSGI RUH-010, riken cDNA 1300006M19; structural ge 98.87
4ag1_C84 Fynomer; hydrolase-de novo protein complex, inhibi 98.87
1ruw_A69 Myosin-3 isoform, MYO3; SH3 domain, yeast, high-th 98.87
2pqh_A80 Spectrin alpha chain, brain; SH3 domain, chimera, 98.86
2dl5_A78 KIAA0769 protein; SH3 domain, FCHSD2, structural g 98.86
2yun_A79 Nostrin; nitric oxide synthase trafficker, structu 98.86
2x3w_D60 Syndapin I, protein kinase C and casein kinase sub 98.86
1w1f_A65 Tyrosine-protein kinase LYN; SH3-domain, SH3 domai 98.86
2ct3_A70 Vinexin; SH3 domian, structural genomics, NPPSFA, 98.85
2ekh_A80 SH3 and PX domain-containing protein 2A; SH3 domai 98.85
1j3t_A74 Intersectin 2; beta barrel, SH3 domain, riken stru 98.85
2dnu_A71 RUH-061, SH3 multiple domains 1; RSGI, structural 98.85
2vz5_A139 TAX1-binding protein 3; WNT signaling pathway, pro 98.85
3qik_A101 Phosphatidylinositol 3,4,5-trisphosphate-dependen 98.84
2d8i_A114 T-cell lymphoma invasion and metastasis 1 variant; 98.84
2cub_A88 Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor 98.84
2lob_A112 Golgi-associated PDZ and coiled-coil motif-contai 98.34
1wx6_A91 Cytoplasmic protein NCK2; SH3 domain, structural g 98.83
2ega_A70 SH3 and PX domain-containing protein 2A; SH3 domai 98.83
1uff_A93 Intersectin 2; beta barrel, SH3 domain, endocytosi 98.83
2edp_A100 Fragment, shroom family member 4; APX/shroom famil 98.83
2vkn_A70 Protein SSU81; membrane, SH3 domain, transmembrane 98.83
2yup_A90 Vinexin; sorbin and SH3 domain-containing protein 98.83
2o2o_A92 SH3-domain kinase-binding protein 1; CIN85, protei 98.82
1x6b_A79 RHO guanine exchange factor (GEF) 16; SH3 domain, 98.82
2enm_A77 Sorting nexin-9; SH3-like barrel, protein transpor 98.82
1whd_A100 RGS3, regulator of G-protein signaling 3; PDZ doma 98.82
1udl_A98 Intersectin 2, KIAA1256; beta barrel, SH3 domain, 98.81
1hsq_A71 Phospholipase C-gamma (SH3 domain); phosphoric die 98.81
2rqr_A119 CED-12 homolog, engulfment and cell motility prote 98.8
1s1n_A68 Nephrocystin 1; beta barrel, cell adhesion; NMR {H 98.8
2ct4_A70 CDC42-interacting protein 4; thyroid receptor inte 98.79
1ujv_A96 Membrane associated guanylate kinase inverted-2 (M 98.79
1v5l_A103 PDZ and LIM domain 3; actinin alpha 2 associated L 98.79
1x5n_A114 Harmonin; PDZ domain, usher syndrome 1C protein, a 98.79
1bb9_A115 Amphiphysin 2; transferase, SH3 domain; 2.20A {Rat 98.78
1qau_A112 Neuronal nitric oxide synthase (residues 1-130); b 98.78
1i1j_A108 Melanoma derived growth regulatory protein; SH3 su 98.77
2oi3_A86 Tyrosine-protein kinase HCK; human HCK, SH3, SRC-t 98.77
3qwx_X174 Cell death abnormality protein 2; cell engulfment, 98.76
3reb_B90 Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain 98.76
3cyy_A92 Tight junction protein ZO-1; protein-ligand comple 98.75
2eaq_A90 LIM domain only protein 7; conserved hypothetical 98.75
1jqq_A92 PEX13P, peroxisomal membrane protein PAS20, PAS20P 98.75
3sfj_A104 TAX1-binding protein 3; PDZ:peptide complex, signa 98.74
1wh1_A124 KIAA1095 protein; PDZ domain, structural genomics, 98.73
2v1r_A80 Peroxisomal membrane protein PAS20; protein transp 98.73
1b8q_A127 Protein (neuronal nitric oxide synthase); PDZ doma 98.73
1u3o_A82 Huntingtin-associated protein-interacting protein; 98.73
1wxu_A93 Peroxisomal biogenesis factor 13; SH3 domain, PEX1 98.72
2e5k_A94 Suppressor of T-cell receptor signaling 1; SH3 dom 98.72
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.7
2krg_A216 Na(+)/H(+) exchange regulatory cofactor NHE-RF1; a 98.7
4d8k_A175 Tyrosine-protein kinase LCK; protein kinases, SH2 98.7
3gsl_A196 Disks large homolog 4; PDZ domain, tandem, PSD-95, 98.67
1k1z_A78 VAV; SH3, proto-oncogene, signaling protein; NMR { 98.67
1mv3_A213 MYC box dependent interacting protein 1; tumor sup 98.67
2qbw_A195 PDZ-fibronectin fusion protein; fibronectin PDZ, u 98.67
1lvg_A198 Guanylate kinase, GMP kinase; transferase; HET: AD 98.66
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.66
2kbt_A142 Chimera of proto-oncogene VAV, linker, immunoglobu 98.65
2rcz_A81 Tight junction protein ZO-1; PDZ, domain-swapping, 98.64
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.63
3i5r_A83 Phosphatidylinositol 3-kinase regulatory subunit a 98.61
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 98.6
3o5z_A90 Phosphatidylinositol 3-kinase regulatory subunit; 98.57
1gcq_C70 VAV proto-oncogene; SH3 domain, protein-protein co 98.57
2dvj_A230 V-CRK sarcoma virus CT10 oncogene homolog, isoform 98.56
3r0h_A206 INAD, inactivation-NO-after-potential D protein; p 98.55
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 98.55
1uf1_A128 KIAA1526 protein; PDZ domain, structural genomics, 98.54
2qt5_A200 Glutamate receptor-interacting protein 1; PDZ-pept 98.52
1g2b_A62 Spectrin alpha chain; capping protein, calcium-bin 98.47
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 98.44
2yub_A118 LIMK-2, LIM domain kinase 2; PDZ domain, structura 98.43
3a98_A184 DOCK2, dedicator of cytokinesis protein 2; protein 98.43
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.42
3jv3_A283 Intersectin-1; SH3 domain, DH domain, guanine nucl 98.42
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 98.39
2h8h_A 535 Proto-oncogene tyrosine-protein kinase SRC; SRC ki 98.38
1ng2_A193 Neutrophil cytosolic factor 1; P47PHOX, autoinhibi 98.37
1tuc_A63 Alpha-spectrin; capping protein, calcium-binding, 98.35
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.34
1v1c_A71 Obscurin; muscle, sarcomere, adapter, myogenesis, 98.3
2pz1_A 466 RHO guanine nucleotide exchange factor 4; helical 98.27
1fmk_A 452 C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros 98.27
1p1d_A196 PDZ45, glutamate receptor interacting protein; PDZ 98.26
1k9a_A 450 Carboxyl-terminal SRC kinase; COOH-terminal SRC ki 98.26
2eyz_A304 V-CRK sarcoma virus CT10 oncogene homolog isoform 98.23
3tsz_A391 Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffol 98.23
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 98.23
2jmc_A77 Spectrin alpha chain, brain and P41 peptide chimer 98.22
3lnc_A231 Guanylate kinase, GMP kinase; ALS collaborative cr 98.21
1gri_A217 Growth factor bound protein 2; SH2, SH3, signal tr 98.21
3shw_A468 Tight junction protein ZO-1; PDZ-SH3-GUK supramodu 98.17
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 97.45
2de0_X526 Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltran 98.12
1opk_A 495 P150, C-ABL, proto-oncogene tyrosine-protein kinas 98.12
3i18_A100 LMO2051 protein; alpha-beta protein, structural ge 98.11
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 98.1
2pzd_A113 Serine protease HTRA2; PDZ domain, apoptosis, mito 98.1
1qcf_A 454 Haematopoetic cell kinase (HCK); tyrosine kinase-i 98.08
2kjp_A91 Uncharacterized protein YLBL; mixed alpha-beta pro 98.08
2l97_A134 HTRA, putative serine protease; HTRA-PDZ, protein 98.07
2lqn_A303 CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT 97.34
2kl1_A94 YLBL protein; structure genomics, structural genom 98.06
3id1_A95 Regulator of sigma E protease; hydrolase, cell inn 98.01
2i6v_A87 General secretion pathway protein C; EPSC, GSPC, P 97.99
1ri9_A102 FYN-binding protein; SH3-like, helically extended, 97.97
2p3w_A112 Probable serine protease HTRA3; PDZ domain, phage 97.95
3suz_A388 Amyloid beta A4 precursor protein-binding family 2 97.94
2zpm_A91 Regulator of sigma E protease; metalloproteinase, 97.92
1w9e_A166 Syntenin 1; cell adhesion, adhesion/complex, PDZ d 97.9
3haj_A486 Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, 97.89
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.88
2gtj_A96 FYN-binding protein; SH3, redox, signaling protein 97.86
1gvn_B287 Zeta; postsegregational killing system, plasmid; 1 97.84
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 97.82
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.78
3qwy_A308 Cell death abnormality protein 2; cell engulfment, 97.77
3exa_A322 TRNA delta(2)-isopentenylpyrophosphate transferase 97.76
2j41_A207 Guanylate kinase; GMP, GMK, transferase, ATP-bindi 97.75
1te0_A318 Protease DEGS; two domains, serine protease, PDZ, 97.73
2i4s_A105 General secretion pathway protein C; EPSC, GSPC, P 97.71
2hga_A125 Conserved protein MTH1368; GFT structural genomics 97.67
1y8t_A324 Hypothetical protein RV0983; serine protease, stru 97.66
3stj_A345 Protease DEGQ; serine protease, PDZ domain, protea 97.64
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.63
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 97.61
1fc6_A388 Photosystem II D1 protease; D1 C-terminal processi 97.6
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 97.58
4fgm_A597 Aminopeptidase N family protein; structural genomi 97.55
3rle_A209 Golgi reassembly-stacking protein 2; PDZ, tether, 97.45
3k50_A403 Putative S41 protease; structural genomics, joint 97.44
1lcy_A325 HTRA2 serine protease; apoptosis, PDZ domain, casp 97.43
3qo6_A348 Protease DO-like 1, chloroplastic; protease, HTRA, 97.39
3pvl_A655 Myosin VIIA isoform 1; protein complex, novel fold 97.36
3foz_A316 TRNA delta(2)-isopentenylpyrophosphate transferas; 97.35
3pe0_A283 Plectin; cytoskeleton, plakin, spectrin repeat, SH 97.31
3pv2_A451 DEGQ; trypsin fold, PDZ domain, chaperone protease 97.21
4a8c_A436 Periplasmic PH-dependent serine endoprotease DEGQ; 97.19
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 96.91
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 96.87
3num_A332 Serine protease HTRA1; DEGP, hydrolase; 2.75A {Hom 96.86
3a8t_A339 Adenylate isopentenyltransferase; rossmann fold pr 96.64
1ky9_A448 Protease DO, DEGP, HTRA; protein quality control, 96.61
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 96.31
2dyb_A341 Neutrophil cytosol factor 4; P40(PHOX), NADPH oxid 96.23
1k32_A1045 Tricorn protease; protein degradation, substrate g 96.08
3r6n_A450 Desmoplakin; spectrin repeat, SH3 domain, cell adh 95.98
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 95.95
1ug1_A92 KIAA1010 protein; structural genomics, SH3 domain, 95.93
4fln_A539 Protease DO-like 2, chloroplastic; protease, DEG, 95.03
3eph_A 409 TRNA isopentenyltransferase; transferase, alternat 95.01
3foz_A 316 TRNA delta(2)-isopentenylpyrophosphate transferas; 94.89
3crm_A323 TRNA delta(2)-isopentenylpyrophosphate transferase 94.45
3kfv_A308 Tight junction protein ZO-3; structural genomics c 93.56
3exa_A 322 TRNA delta(2)-isopentenylpyrophosphate transferase 93.5
3tlx_A243 Adenylate kinase 2; structural genomics, structura 93.28
4dey_A337 Voltage-dependent L-type calcium channel subunit; 92.18
1zak_A222 Adenylate kinase; ATP:AMP-phosphotransferase, tran 89.44
3dl0_A216 Adenylate kinase; phosphotransferase, zinc coordin 89.27
3d3q_A340 TRNA delta(2)-isopentenylpyrophosphate transferase 88.58
3v9p_A227 DTMP kinase, thymidylate kinase; ssgcid, STRU geno 88.24
1kht_A192 Adenylate kinase; phosphotransferase, signaling pr 85.8
3fb4_A216 Adenylate kinase; psychrophIle, phosphotransferase 85.63
2ze6_A253 Isopentenyl transferase; crown GALL tumor, cytokin 85.26
1nks_A194 Adenylate kinase; thermophilic, transferase; HET: 83.92
4eaq_A229 DTMP kinase, thymidylate kinase; structural genomi 81.78
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 80.4
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
Probab=100.00  E-value=1.3e-59  Score=513.03  Aligned_cols=345  Identities=29%  Similarity=0.485  Sum_probs=288.2

Q ss_pred             CCeEEEEeeCCCCccEEEEecCC-CcEEEEEEcCCChhhhcCCCCCCCEEEeECCccC--CCHHHHHHHHHhcCCceeee
Q psy4417           6 HPLKKILGTGLSPCGLTVEQDAN-GNLIIARILAGSLIDKQGVLKVGDVILGVNGENV--SSPEDLQIEVVKSDGNIQFT   82 (440)
Q Consensus         6 ~~r~v~l~r~g~~lGiti~~~~~-~~i~V~~V~~gs~A~~~G~L~~GD~Il~VNg~~v--~t~~e~~~~L~~~~~~v~l~   82 (440)
                      +++.|.+.+...+|||++.++.+ .+++|..|.+||+|+++|.|+.||+|++|||+++  .+++++..+|+..++.+.|.
T Consensus       307 ~~~~v~l~~~~~~lG~~i~~~~~~~gv~V~~V~~gs~A~~aG~L~~GD~Il~VNg~~v~~~~~~e~~~~l~~~~~~v~L~  386 (721)
T 2xkx_A          307 EPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQILSVNGVDLRNASHEQAAIALKNAGQTVTII  386 (721)
T ss_pred             ceEEEEEEECCCCccEEEeccCCCCCeEEEEeCCCChHHhcCCCccCCEEEEECCEECCCCCHHHHHHHHHhcCCeEEEE
Confidence            56788888888899999987654 5799999999999999999999999999999999  46999999999888899988


Q ss_pred             eccCCCC--------------------------CCCCCCccccccccccCCCCCCCCCCCccccceeccCCEEEEeecCC
Q psy4417          83 IAPQGDD--------------------------ASLPIKPVCYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKD  136 (440)
Q Consensus        83 v~p~~~~--------------------------~~~~~~~~~~vRal~dy~p~~d~~~p~~e~~L~f~~GdIl~V~~~~d  136 (440)
                      |...+..                          ....++..+||||+|||++..|+.+|+  .+|+|++||||+|+++.|
T Consensus       387 v~r~~~~~~~~~~~~~~~~~~~~~~s~~~g~~~~~~~~~~~~~vrAl~dy~~~~d~~~p~--~~LsF~~GDil~v~~~~~  464 (721)
T 2xkx_A          387 AQYKPEEYSRFEAKIHDLREQLMNSSLGSGTASLRSNPKRGFYIRALFDYDKTKDCGFLS--QALSFRFGDVLHVIDAGD  464 (721)
T ss_pred             EEeCchhhhhhhhhhhhhhhhcccccccCCccccccccccceeEEEeeccCcCCCCCCcc--ccccccCCCEEEEeecCC
Confidence            8754421                          001235679999999999999998884  489999999999999999


Q ss_pred             CCceEEEecCCC---CCCccccchhHHHhhhcccCCCcc----------------------------------ccccccc
Q psy4417         137 PNWWQAQLIEPT---GPMGLVPSQELEERRKAFVPPEAD----------------------------------YVHKIGI  179 (440)
Q Consensus       137 ~~ww~a~~~~~~---~~~G~iPs~~~~~rr~~~~~~~~~----------------------------------~~gk~~~  179 (440)
                      ++||+|++.+..   +..|+|||+++++++.........                                  +.+|+++
T Consensus       465 ~~WW~a~~~~~~~~~~~~G~iPs~~~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~Ye~V~~~~~~~~r~vvl~GP~K~tl  544 (721)
T 2xkx_A          465 EEWWQARRVHSDSETDDIGFIPSKRRVERREWSRLKAKDWGSSSGSQGREDSVLSYETVTQMEVHYARPIIILGPTKDRA  544 (721)
T ss_pred             CCeEEEEECCCCCccCccceeecHHHHHHHHhhhcccccccCcchhhcccccCCCceeeecccCCCCCEEEEECCCHHHH
Confidence            999999998543   467999999999876432211111                                  1124444


Q ss_pred             ccccccccccccccccccCcccccCCCCCCCCCccCCCcceec-CHHHHHHhhhcCCeeEEEEEcCCccccchhhHHHHH
Q psy4417         180 CGTRYIKQYNTLQYNSTLMSRSFPDTTRPMRELEENGQNYWFT-SREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVI  258 (440)
Q Consensus       180 ~~~~~~~~~~~~~~~~~~~~~~~~~ttr~~r~~e~~g~~y~fv-s~~~f~~~i~~~~fle~~~~~g~~yg~~~~~i~~v~  258 (440)
                      +..++.....++.       ++++||||+||++|++|++|||+ |+++|++++++|+||||++++||+|||++++|++++
T Consensus       545 ~~~L~~~~~~~~~-------~~vs~TTR~~r~gE~~G~dY~Fv~s~~~f~~~i~~~~flE~~~~~g~~YGt~~~~v~~~~  617 (721)
T 2xkx_A          545 NDDLLSEFPDKFG-------SCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIRAHKFIEAGQYNSHLYGTSVQSVREVA  617 (721)
T ss_pred             HHHHHHhCcccee-------ecccccccCCCCCccCCceeEEecCHHHHHHHHhcCCceEEEEECCccceeeHHHHHHHH
Confidence            4444433222343       58999999999999999999999 999999999999999999999999999999999999


Q ss_pred             hcCCeEEeecCcchhhhhhhhhccccccccCCCceEEecCCCccceeecCCCcccchhhccCccccccCHHHHHHHHHcC
Q psy4417         259 LSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQNYWFTSREVMERDIQDH  338 (440)
Q Consensus       259 ~~g~~~il~~~~~g~~~l~~~l~~~~~~~~~~p~~i~i~~~~~~~f~~~~ttr~~~~~e~~g~~y~f~s~~~f~~~~~~~  338 (440)
                      ++|++|||+++++|++.|        +...++|++|         ||.|++   +..++.               +    
T Consensus       618 ~~g~~~ildi~~~~~~~l--------~~~~~~p~~i---------fi~pps---~~~L~~---------------l----  658 (721)
T 2xkx_A          618 EQGKHCILDVSANAVRRL--------QAAHLHPIAI---------FIRPRS---LENVLE---------------I----  658 (721)
T ss_pred             HCCCcEEEeCCHHHHHHH--------HhcccCCEEE---------EEeCCc---HHHHHH---------------H----
Confidence            999999999999999988        5567889777         999998   655542               0    


Q ss_pred             ceeeEEEEcCccccccHHHHHHHHhcCCeeEecCCCcHHHHHHHHHHHHHHHHHhcCCccEEEEcCCHHHHHHHHHHHHH
Q psy4417         339 KFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIVNEDFDETFRTVIELLD  418 (440)
Q Consensus       339 ~fle~~~~~~~~yGt~~~~i~~~~~~~~~~i~~~~~s~e~l~~~l~~~~~~e~~~~~~fd~vi~Nddl~~a~~~l~~~i~  418 (440)
                                ..+|                      +++++++|++++.++|+.+.+.||++|+|||+++|+++|+++|.
T Consensus       659 ----------~~R~----------------------t~~~~~~rl~~a~~~e~~~~~~fd~vi~Nd~l~~a~~~l~~~i~  706 (721)
T 2xkx_A          659 ----------NKRI----------------------TEEQARKAFDRATKLEQEFTECFSAIVEGDSFEEIYHKVKRVIE  706 (721)
T ss_pred             ----------hccC----------------------CHHHHHHHHHHHHHHHHhccccCcEEEECcCHHHHHHHHHHHHH
Confidence                      0122                      46789999999888899999999999999999999999999999


Q ss_pred             hccCCCeeeecc
Q psy4417         419 TLSNKHQVDSRP  430 (440)
Q Consensus       419 ~~~~~~~wvp~~  430 (440)
                      .++.+++|||++
T Consensus       707 ~~~~~~~Wvp~~  718 (721)
T 2xkx_A          707 DLSGPYIWVPAR  718 (721)
T ss_pred             hccCCcEEeecc
Confidence            999999999975
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2xkx_A Disks large homolog 4; structural protein, scaffold protein, membrane associated GU kinase; 22.9A {Rattus norvegicus} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>3tvt_A Disks large 1 tumor suppressor protein; DLG, SRC-homology-3, guanylate kinase, phosphorylation-depen cell membrane; 1.60A {Drosophila melanogaster} PDB: 3uat_A* Back     alignment and structure
>1kjw_A Postsynaptic density protein 95; protein-protein interaction, scaffold, neuropeptide; 1.80A {Rattus norvegicus} SCOP: b.34.2.1 c.37.1.1 PDB: 1jxm_A* 1jxo_A Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3gge_A PDZ domain-containing protein GIPC2; structural genomics, structural genomics consort protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>3ney_A 55 kDa erythrocyte membrane protein; structural genomics consortium, SGC, 55 kDa erythrocyte MEMB protein; 2.26A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>1r6j_A Syntenin 1; PDZ, membrane protein; 0.73A {Homo sapiens} SCOP: b.36.1.1 PDB: 1nte_A 1obx_A 1oby_A Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3o46_A Maguk P55 subfamily member 7; PDZ domain, structural genomics consortium, SGC, protein BIN; 1.30A {Homo sapiens} SCOP: b.36.1.0 Back     alignment and structure
>2ejy_A 55 kDa erythrocyte membrane protein; GPC, maguk, PDZ, membrane protein; NMR {Homo sapiens} PDB: 2ev8_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1kwa_A Hcask/LIN-2 protein; PDZ domain, neurexin, syndecan, receptor clustering, kinase; 1.93A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2he4_A Na(+)/H(+) exchange regulatory cofactor NHE-RF2; phosphorylation, structural genomics, structural genomics consortium, SGC, unknown function; 1.45A {Homo sapiens} PDB: 2ozf_A Back     alignment and structure
>3i4w_A Disks large homolog 4; alpha and beta protein, alternative splicing, cell junction, cell membrane, lipoprotein, membrane, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.36.1.1 PDB: 3k82_A* 3jxt_A* 2he2_A 1pdr_A 2i0i_A Back     alignment and structure
>2d92_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2dkr_A LIN-7 homolog B; LIN-7B, PDZ, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jik_A Synaptojanin-2 binding protein; transmembrane, outer membrane, mitochondria distribution, PDZ, membrane, scaffold, mitochondrion, membrane protein; 1.35A {Homo sapiens} PDB: 2jin_A Back     alignment and structure
>1g9o_A NHE-RF; PDZ domain, complex, signaling protein; 1.50A {Homo sapiens} SCOP: b.36.1.1 PDB: 1i92_A 1gq4_A 1gq5_A 2ocs_A Back     alignment and structure
>3r68_A Na(+)/H(+) exchange regulatory cofactor NHE-RF3; PDZ domain, adaptor protein, SR-BI, signaling protein; 1.30A {Mus musculus} SCOP: b.36.1.0 PDB: 3r69_A* Back     alignment and structure
>3b76_A E3 ubiquitin-protein ligase LNX; PDZ, bound ligand, structural genomics, structural genomics consortium, SGC, metal-binding; 1.75A {Homo sapiens} Back     alignment and structure
>1d5g_A Human phosphatase HPTP1E; protein-peptide complex, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 3lnx_A 3lny_A 3pdz_A 1vj6_A 1gm1_A 1ozi_A Back     alignment and structure
>2fne_A Multiple PDZ domain protein; structural protein, structural genomics, SGC, structural genomics consortium, unknown function; 1.83A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2awx_A Synapse associated protein 97; membrane protein, synaptic signaling, trafficking protein; HET: HIS; 1.80A {Rattus norvegicus} PDB: 2g2l_A 2awu_A 2aww_A 3rl8_A Back     alignment and structure
>2e7k_A Maguk P55 subfamily member 2; PDZ domain, MPP2 protein, discs large homolog 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3l4f_D SH3 and multiple ankyrin repeat domains protein 1; coiled-coil, PDZ, guanine-nucleotide releasing factor, phosphoprotein, SH3 domain; 2.80A {Rattus norvegicus} Back     alignment and structure
>1wha_A KIAA0147 protein, scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vsp_A PDZ domain-containing protein 1; membrane, cytoplasm, phosphoprotein, transport protein, CAsp; 2.60A {Homo sapiens} PDB: 2eej_A Back     alignment and structure
>1n7e_A AMPA receptor interacting protein GRIP; PDZ, protein binding; 1.50A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1n7f_A Back     alignment and structure
>2lj0_A Sorbin and SH3 domain-containing protein 1; R85FL, ponsin, CAP, signaling protein; NMR {Homo sapiens} PDB: 2lj1_A Back     alignment and structure
>2lx7_A GAS-7, growth arrest-specific protein 7; structural genomics, northeast structural genomics consortiu target HR8574A, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2ego_A General receptor for phosphoinositides 1- associated scaffold protein; PDZ domain, ligand-free, protein binding; 1.80A {Rattus norvegicus} PDB: 2egn_A 2egk_A 2pnt_A Back     alignment and structure
>1v62_A KIAA1719 protein; structural genomics, synaptic transmission, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2iwo_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP-1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.7A {Homo sapiens} PDB: 2iwp_A Back     alignment and structure
>2v90_A PDZ domain-containing protein 3; membrane, protein-binding; 2.00A {Homo sapiens} Back     alignment and structure
>2ege_A Uncharacterized protein KIAA1666; SH3 domain, KIAA1666 protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wi4_A Synip, syntaxin binding protein 4; syntaxin4-interacting protein, STXBP4 protein, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1uhp_A Hypothetical protein KIAA1095; PDZ domain, semaphorin cytoplasmic domain associated protein, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2dlu_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1ujd_A KIAA0559 protein; PDZ domain, structural genomics, human cDNA, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2opg_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2fe5_A Presynaptic protein SAP102; PDZ domain, DLG3, human, structural genomics, structural GEN consortium, SGC, structural protein; HET: GOL; 1.10A {Homo sapiens} SCOP: b.36.1.1 PDB: 2x7z_A 2oqs_A 1qlc_A 2i0l_A Back     alignment and structure
>2i1n_A Discs, large homolog 3; DLG3, PDZ, PDZ domain, signal transduction, structural genom structural genomics consortium, SGC, signaling protein; 1.85A {Homo sapiens} PDB: 2wl7_A 3rl7_B 1rgr_A* 1kef_A 1zok_A 1iu0_A 1iu2_A Back     alignment and structure
>2byg_A Channel associated protein of synapse-110; DLG2, PDZ, PDZ domain, structural genomics, structural genom consortium, SGC, phosphorylation; 1.85A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2d90_A PDZ domain containing protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3cbz_A Dishevelled-2; PDZ domain, phage derived high affinity ligand, cytoplasm, developmental protein, phosphoprotein, WNT signaling pathway; 1.38A {Homo sapiens} PDB: 3cby_A 3cc0_A 3cbx_A 2rey_A 2f0a_A 1l6o_A 3fy5_A 2kaw_A* 1mc7_A Back     alignment and structure
>2dc2_A GOPC, golgi associated PDZ and coiled-coil motif containing isoform B; GOPC PDZ domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2yt7_A Amyloid beta A4 precursor protein-binding family A member 3; neuron-specific X11L2 protein, neuronal MUNC18-1-interacting protein 3, MINT-3; NMR {Homo sapiens} Back     alignment and structure
>2db5_A INAD-like protein; PDZ domain, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1nf3_C PAR-6B; semi-CRIB motif, switch I and II, PDZ domain, GTPase binding domain, signaling protein; HET: GNP; 2.10A {Mus musculus} SCOP: b.36.1.1 PDB: 2lc6_A 1ry4_A 1x8s_A 2lc7_A 1rzx_A Back     alignment and structure
>2r4h_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; transferase, STRU genomics, structural genomics consortium, SGC, ATP-binding; HET: HIS; 2.05A {Homo sapiens} Back     alignment and structure
>2q9v_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; Cys Ser mutant, S genomics consortium, SGC, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>4e34_A Golgi-associated PDZ and coiled-coil motif-contai protein; PDZ-peptide complex, protein transport-inhibitor complex; 1.40A {Homo sapiens} PDB: 4e35_A Back     alignment and structure
>2f5y_A Regulator of G-protein signalling 3 isoform 1; PDZ domain, RGS-3, human, structural genomics, structural GE consortium, SGC, signaling protein; 2.39A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1qav_A Alpha-1 syntrophin (residues 77-171); beta-finger, heterodimer, membrane protein-oxidoreductase CO; 1.90A {Mus musculus} SCOP: b.36.1.1 PDB: 1z86_A 2pdz_A 2vrf_A Back     alignment and structure
>1wf8_A Neurabin-I; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ehr_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>2jil_A GRIP1 protein, glutamate receptor interacting protein-1; endoplasmic reticulum, postsynaptic membrane, membrane, MEMB protein; 1.5A {Homo sapiens} Back     alignment and structure
>1uju_A Scribble; PDZ domain, cellular signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1i16_A Interleukin 16, LCF; cytokine, lymphocyte chemoattractant factor, PDZ domain; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>2qg1_A Multiple PDZ domain protein; MPDZ, MUPP1, structural genomics, structural genomics consortium, SGC, signaling protein; 1.40A {Homo sapiens} Back     alignment and structure
>2daz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1wi2_A Riken cDNA 2700099C19; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1um1_A KIAA1849 protein, RSGI RUH-007; PDZ domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3axa_A Afadin, nectin-3, protein AF-6; PDZ domain, fusion protein, cell adhesion; 2.78A {Mus musculus} PDB: 1xz9_A 2exg_A* 1t2m_A 2ain_A Back     alignment and structure
>2csi_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufx_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kpk_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; PDZ domain, ATP-binding, cell junction, cell membrane; NMR {Homo sapiens} PDB: 2kpl_A Back     alignment and structure
>1ueq_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1uep_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2vwr_A Ligand of NUMB protein X 2; protein-binding, metal-binding, zinc, LNX2_human, zinc-finger, polymorphism, ring finger protein 1; 1.3A {Homo sapiens} Back     alignment and structure
>2eei_A PDZ domain-containing protein 1; regulatory factor, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1m5z_A GRIP, AMPA receptor interacting protein; six beta-strands and two alpha-helices, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>2i04_A Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1; PDZ, E6 binding, tumor suppressor, peptide binding protein; 2.15A {Mus musculus} Back     alignment and structure
>2eno_A Synaptojanin-2-binding protein; mitochondrial outer membrane protein 25, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dls_A PDZ-rhogef, RHO guanine nucleotide exchange factor 11; PDZ domain, arhgef11, KIAA0380, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2omj_A 2os6_A Back     alignment and structure
>1q7x_A PDZ2B domain of PTP-BAS (HPTP1E); phosphatase, structural proteomics in europe, spine, structural genomics, hydrolase; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2ed1_A 130 kDa phosphatidylinositol 4,5-biphosphate- dependent ARF1 GTPase-activating protein...; GTPase activation, membrane, metal-binding, SH3 domain; NMR {Homo sapiens} PDB: 2rqt_A 2rqu_A Back     alignment and structure
>1tp5_A Presynaptic density protein 95; PDZ-peptide ligand complex, peptide binding protein; 1.54A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1tp3_A 1tq3_A 1be9_A 1bfe_A Back     alignment and structure
>2uzc_A Human pdlim5, PDZ and LIM domain 5; metal-binding, enigma homolog, phosphorylation, signaling PR LIM domain, PDZ domain; 1.5A {Homo sapiens} Back     alignment and structure
>3e17_A Tight junction protein ZO-2; domain swapping, alternative promoter usage, alternative splicing, cell junction, cell membrane, disease mutation; 1.75A {Homo sapiens} Back     alignment and structure
>2la8_A Inactivation-NO-after-potential D protein, KON-TI peptide; peptide binding protein; NMR {Drosophila melanogaster} Back     alignment and structure
>3egg_C Spinophilin; PP1, serine/threonine phosphatase, post synapti density, glutametergic receptors, carbohydrate metabolism, cycle, cell division; HET: MES; 1.85A {Rattus norvegicus} PDB: 3egh_C* 3hvq_C 2fn5_A Back     alignment and structure
>2o2t_A Multiple PDZ domain protein; structural protein, structural genomics, structural genomics consortium, SGC; 2.70A {Homo sapiens} Back     alignment and structure
>2kv8_A RGS12, regulator of G-protein signaling 12; PDZ domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1b07_A Protein (proto-oncogene CRK (CRK)); SH3 domain, inhibitors, peptoids, protein-protein recognition, proline-rich motifs, signal transduction; 2.50A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2gzv_A PRKCA-binding protein; protein kinase C, PDZ domain, structural genomics, structura genomics consortium, SGC, signaling protein; 1.12A {Homo sapiens} PDB: 2pku_A Back     alignment and structure
>1uew_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1ihj_A INAD; intermolecular disulfide bond, PDZ domain, signaling protein; 1.80A {Drosophila melanogaster} SCOP: b.36.1.1 Back     alignment and structure
>3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1va8_A Maguk P55 subfamily member 5; PDZ domain, palmitoylated 5, PALS1 protein, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2vsv_A Rhophilin-2; scaffold protein, RHO GTPase binding, protein-binding, RHOB, nitration, cytoplasm, PDZ domain, CAsp8; 1.82A {Homo sapiens} Back     alignment and structure
>2fcf_A Multiple PDZ domain protein; adaptor molecule, protein linker, structural genomics, struc genomics consortium, SGC, structural protein; 1.76A {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>3hpk_A Protein interacting with PRKCA 1; oxidized, PDZ domain, kinase, protein binding; 2.20A {Rattus norvegicus} PDB: 3hpm_A Back     alignment and structure
>1tg0_A BBC1 protein, myosin tail region-interacting protein MTI1; yeast, SH3 domain, structural genomics, contractIle protein; 0.97A {Saccharomyces cerevisiae} PDB: 1zuk_A 1wdx_A Back     alignment and structure
>1zlm_A Osteoclast stimulating factor 1; beta barrel, signaling protein; 1.07A {Homo sapiens} Back     alignment and structure
>2djt_A Unnamed protein product; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jxo_A Ezrin-radixin-moesin-binding phosphoprotein 50; nherf-1, PDZ domain, PDZ2, acetylation, cell projection, membrane, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>2g5m_B Neurabin-2; spinophilin, PDZ domain, CNS, synaptic transmission, protein binding; NMR {Rattus norvegicus} Back     alignment and structure
>2gnc_A SLIT-ROBO RHO GTPase-activating protein 1; beta barrel, signaling protein; 1.80A {Mus musculus} Back     alignment and structure
>1q3o_A Shank1; PDZ, GKAP, peptide binding protein; 1.80A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1q3p_A 3qjm_A 3qjn_A 3o5n_A* Back     alignment and structure
>4amh_A Disks large homolog 1; permutation, protein folding, structural protein; 2.30A {Homo sapiens} Back     alignment and structure
>2dm8_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>1k4u_S Phagocyte NADPH oxidase subunit P67PHOX; SH3-peptide complex, helix-turn-helix, hormone/growth factor complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dmz_A INAD-like protein; PDZ domain, inadl protein, hinadl, PALS1- associated tight junction protein, protein associated to tight junctions, PATJ; NMR {Homo sapiens} Back     alignment and structure
>3ulr_B SRC substrate cortactin; SH3, protein-protein interaction, hydrolase, protein binding; 1.65A {Mus musculus} SCOP: b.34.2.0 PDB: 2d1x_A Back     alignment and structure
>3nfk_A Tyrosine-protein phosphatase non-receptor type 4; PDZ-PDZ-binding site complex, protein binding; 1.43A {Homo sapiens} SCOP: b.36.1.1 PDB: 3nfl_A 2vph_A Back     alignment and structure
>1uti_A GRB2-related adaptor protein 2; signaling protein regulator, SH3 domain/complex, adaptor protein (MONA); 1.5A {Mus musculus} SCOP: b.34.2.1 PDB: 1h3h_A 1oeb_A 2w10_A 2d0n_A Back     alignment and structure
>1w70_A Neutrophil cytosol factor 4; NADPH oxidase, P40PHOX, P47PHOX, SH3 domain, polyproline; 1.46A {Homo sapiens} PDB: 1w6x_A Back     alignment and structure
>1v6b_A Harmonin isoform A1; structural genomics, usher syndrome, USH1, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>3bpu_A Membrane-associated guanylate kinase, WW and PDZ containing protein 1; structural genomi consortium, SGC, ATP-binding, cell junction; 1.60A {Homo sapiens} Back     alignment and structure
>1jo8_A ABP1P, actin binding protein; SH3 domain actin-binding-protein, structural protein; 1.30A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 2k3b_A 2rpn_A Back     alignment and structure
>3ngh_A PDZ domain-containing protein 1; adaptor protein, SR-BI, signaling protein; 1.80A {Mus musculus} SCOP: b.36.1.0 Back     alignment and structure
>1n7t_A 99-MER peptide of densin-180-like protein; PDZ domain, C-terminal peptide complex, high affnity ligand, signaling protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2h3l_A Back     alignment and structure
>2cs5_A Tyrosine-protein phosphatase, non-receptor type 4; PDZ domain, ptpase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2drm_A Acanthamoeba myosin IB; SH3 domain, contractIle protein; 1.35A {Acanthamoeba} PDB: 2drk_A Back     alignment and structure
>1um7_A Synapse-associated protein 102; PDZ, discs large homolog 3, DLG3-human presynaptic protein, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2fei_A CD2-associated protein; CMS SH3 domain, structural protein; NMR {Homo sapiens} Back     alignment and structure
>2bz8_A SH3-domain kinase binding protein 1; SH3 domain, CIN85 adaptor protein, CBL ubiquitin ligase; 2.0A {Homo sapiens} Back     alignment and structure
>1uj0_A Signal transducing adaptor molecule (SH3 domain and ITAM motif) 2; STAM, SH3, GRB2, GADS, PXXP, HRS, endocytosis, early endosome, signaling protein/signaling protein complex; 1.70A {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>2ew3_A SH3-containing GRB2-like protein 3; SH3GL3, solution structure, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1cka_A C-CRK N-terminal SH3 domain; complex (oncogene protein/peptide); 1.50A {Mus musculus} SCOP: b.34.2.1 PDB: 1ckb_A 1m3c_A 1m30_A 1m3b_A 1m3a_A Back     alignment and structure
>2eyx_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH3, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2ak5_A RHO guanine nucleotide exchange factor 7; adaptor proteins, CIN85, PIX/COOL, protein-protein interaction, X-RAY, endocytosis; 1.85A {Rattus norvegicus} PDB: 1zsg_A Back     alignment and structure
>1sem_A SEM-5; SRC-homology 3 (SH3) domain, peptide-binding protein; 2.00A {Caenorhabditis elegans} SCOP: b.34.2.1 PDB: 2sem_A 3sem_A 1k76_A 1kfz_A Back     alignment and structure
>2pa1_A PDZ and LIM domain protein 2; PDZ domain, structural genomics, structural genomics consort metal binding protein; 1.70A {Homo sapiens} PDB: 3pdv_A Back     alignment and structure
>2z17_A Pleckstrin homology SEC7 and coiled-coil domains- binding protein; PDZ domain, cytoplasm, membrane, polymorphism, protein binding; 2.70A {Homo sapiens} Back     alignment and structure
>1wg6_A Hypothetical protein (riken cDNA 2810455B10); structural genomics, PDZ domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: b.36.1.1 PDB: 2koh_A 2k1z_A 2k20_A Back     alignment and structure
>2qkv_A Inactivation-NO-after-potential D protein; PDZ domain, scaffolding protein, membrane, sensory transduction, vision; 1.55A {Drosophila melanogaster} PDB: 2qkt_A 2qku_A Back     alignment and structure
>1wfg_A Regulating synaptic membrane exocytosis protein 2; PDZ domain, RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2css_A 1zub_A Back     alignment and structure
>2nwm_A Vinexin; cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>1rgw_A ZAsp protein; PDZ, cypher, oracle, muscle, Z-DISK, sarcomere, structural protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 1wjl_A Back     alignment and structure
>1x5q_A LAP4 protein; PDZ domain, scribble homolog protein, hscrib, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2b86_A Cytoplasmic protein NCK2; NCK SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2js2_A Back     alignment and structure
>2w4f_A Protein LAP4; structural protein, phosphoprotein, UBL conjugation, leucine-rich repeat, alternative splicing, cytoplasm, circletail, coiled coil; 1.30A {Homo sapiens} Back     alignment and structure
>2iim_A Proto-oncogene tyrosine-protein kinase LCK; beta-barrels, signaling protein; HET: PG4; 1.00A {Homo sapiens} SCOP: b.34.2.1 PDB: 1h92_A 1kik_A Back     alignment and structure
>2jre_A C60-1 PDZ domain peptide; de novo protein; NMR {Synthetic} Back     alignment and structure
>2l0a_A STAM-1, signal transducing adapter molecule 1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative; NMR {Homo sapiens} Back     alignment and structure
>1uit_A Human discs large 5 protein; PDZ domain, HDLG5, maguk family, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1zx6_A YPR154WP; SH3 domain, protein binding; 1.60A {Saccharomyces cerevisiae} PDB: 1ynz_A Back     alignment and structure
>2ke9_A Caskin-2; SH3 domain, ANK repeat, cytoplasm, phosphoprotein, protein binding; NMR {Homo sapiens} Back     alignment and structure
>2q3g_A PDZ and LIM domain protein 7; structural genomics, structural genomics consortium, SGC; 1.11A {Homo sapiens} Back     alignment and structure
>2rqv_A BUD emergence protein 1; BEM1P, SH3, CDC42P, cytoplasm, cytoskeleton, SH3 domain, SIG protein; NMR {Saccharomyces cerevisiae} PDB: 2rqw_A Back     alignment and structure
>2g6f_X RHO guanine nucleotide exchange factor 7; SH3 domain, peptide interaction, signaling protein; HET: NCO; 0.92A {Rattus norvegicus} PDB: 2df6_A* 2p4r_A 2esw_A Back     alignment and structure
>2eeg_A PDZ and LIM domain protein 4; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1mfg_A ERB-B2 interacting protein; PDZ domain, protein-peptide complex, erbin., signaling protein; 1.25A {Homo sapiens} SCOP: b.36.1.1 PDB: 1mfl_A Back     alignment and structure
>2vwf_A Growth factor receptor-bound protein 2; polymorphism, phosphoprotein, golgi apparatus, alternative splicing, HOST-virus interaction, SH3C, signaling; 1.58A {Homo sapiens} PDB: 2w0z_A 1gcq_A 1gfc_A 1gfd_A 1io6_A 2vvk_A Back     alignment and structure
>2koj_A Partitioning defective 3 homolog; PDZ domain, structural genomics, alternative splicing, cell cycle, cell division, cell junction, coiled coil; NMR {Mus musculus} PDB: 2ogp_A Back     alignment and structure
>2fpe_A C-JUN-amino-terminal kinase interacting protein 1; SRC-homology 3 (SH3) domain, all beta structure, signaling protein; HET: P6G; 1.75A {Rattus norvegicus} PDB: 2fpd_A* Back     alignment and structure
>2iwq_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, membrane, HOST- interaction, structural genomics consortium, synaptosome, T junction; 1.80A {Homo sapiens} Back     alignment and structure
>3khf_A Microtubule-associated serine/threonine-protein kinase 3; MAST3, microtubule associated serine/threonine kinase 3, PDZ domain, structural genomics; 1.20A {Homo sapiens} PDB: 2w7r_A 2kqf_A 2kyl_A 3ps4_A Back     alignment and structure
>2i0n_A Class VII unconventional myosin; beta-sheet loop, structural protein; NMR {Dictyostelium discoideum} Back     alignment and structure
>3h0h_A Proto-oncogene tyrosine-protein kinase FYN; beta barrel, transferase; HET: PG4; 1.76A {Homo sapiens} SCOP: b.34.2.1 PDB: 3h0i_A 3h0f_A* Back     alignment and structure
>2bzy_A CRK-like protein, CRKL SH3C; SH3 domain, dimer, nuclear export; 2.5A {Homo sapiens} PDB: 2bzx_A Back     alignment and structure
>2yuy_A RHO GTPase activating protein 21; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2xmf_A Myosin 1E SH3; motor protein, SH3 domain; HET: DIA; 1.50A {Mus musculus} Back     alignment and structure
>2jte_A CD2-associated protein; SH3 domain, coiled coil, cytoplasm, phosphorylation, SH3-binding, signaling protein; NMR {Mus musculus} PDB: 2kro_A Back     alignment and structure
>2yt6_A Adult MALE urinary bladder cDNA, riken FULL- length enriched library, clone:9530076O17...; SH3_1 domain; NMR {Mus musculus} Back     alignment and structure
>1y7n_A Amyloid beta A4 precursor protein-binding family A member 1; copper chaperone for superoxide dismutase, neuronal adaptor, protein transport; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} Back     alignment and structure
>2yuq_A Tyrosine-protein kinase ITK/TSK; T-cell-specific kinase, tyrosine-protein kinase LYK, kinase EMT, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cud_A SRC-like-adapter; SH3 domain, negative mitogenesis regulator, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dl4_A Protein STAC; SH3 domain, STAC protein, SRC homology 3, cysteine-rich domain protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dmo_A Neutrophil cytosol factor 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pkt_A PDZ and LIM domain protein 1; PDZ domain, structural genomics, structural genomics consort unknown function; HET: PG4; 1.50A {Homo sapiens} PDB: 2v1w_A* Back     alignment and structure
>1wie_A RIM binding protein 2; beta barrel, KIAA0318 protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1z87_A Alpha-1-syntrophin; protein binding; NMR {Mus musculus} Back     alignment and structure
>1csk_A C-SRC SH3 domain; phosphotransferase; 2.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wyx_A CRK-associated substrate; beta sheets, cell adhesion; 1.14A {Homo sapiens} Back     alignment and structure
>2k2m_A EPS8-like protein 1; alternative splicing, coiled coil, cytoplasm, SH3 domain, signaling protein; NMR {Homo sapiens} PDB: 2rol_A Back     alignment and structure
>3kzd_A TIAM-1, T-lymphoma invasion and metastasis-inducing prote; PDZ, cell junction, cell adhesion, signaling protein, nucleotide exchange factor; 1.30A {Homo sapiens} PDB: 3kze_A Back     alignment and structure
>2ydl_A SH3 domain-containing kinase-binding protein 1; signaling protein; 2.05A {Homo sapiens} PDB: 2k6d_A Back     alignment and structure
>1wf7_A Enigma homologue protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2csj_A TJP2 protein; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2d8j_A FYN-related kinase; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x6d_A Interleukin-16; PDZ domain, lymphocyte chemoattractant factor (LCF), structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.36.1.2 Back     alignment and structure
>1oot_A Hypothetical 40.4 kDa protein in PES4-His2 intergenic region; SH3 domain, sturctural genomics, structural genomics; 1.39A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1ssh_A 2a08_A Back     alignment and structure
>1x2q_A Signal transducing adapter molecule 2; SH3 domain, signal transducing adaptor molecule, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j6f_A CD2-associated protein; metal-binding, immune response, SH3, SH2 domain, SH3 zinc-finger, SH3- binding, UBL conjugation pathway; 1.7A {Homo sapiens} PDB: 2j6k_A 2j6o_A 2j7i_A 2krm_A Back     alignment and structure
>2dbk_A CRK-like protein; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x2k_A OSTF1, osteoclast stimulating factor 1; SH3 domain, human osteoclast stimulating factor 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfv_A Membrane associated guanylate kinase inverted-2; atrophin-1 interacting protein 1, activin receptor interacting protein 1; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2kym_A BUD emergence protein 1; SH3 domain, BEM1P, SH3-CI, STE20P PRR, CDC42P-interacting, S signaling protein; NMR {Lodderomyces elongisporus} Back     alignment and structure
>1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 Back     alignment and structure
>4e6r_A Cytoplasmic protein NCK2; SH3 domain, protein binding, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; HET: MLY; 2.20A {Homo sapiens} PDB: 2frw_A 2js0_A Back     alignment and structure
>2kgt_A Tyrosine-protein kinase 6; SH3 domain, SRC kinase, PTK6, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>1awj_A ITK; transferase, regulatory intramolecular complex, kinase; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 2rn8_A 2rna_A 2k79_A 2k7a_A Back     alignment and structure
>2iwn_A Multiple PDZ domain protein; SGC, MPDZ, MUPP1, MUPP- 1, HOST-virus interaction, structural genomics consortium, synaptosome, tight junction; 1.35A {Homo sapiens} Back     alignment and structure
>1x2p_A Protein arginine N-methyltransferase 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j05_A RAS GTPase-activating protein 1; GTPase activation, SH3 domain, SH2 domain, SRC homology 3, RAS signaling pathway, proto- oncogene, phosphorylation; 1.5A {Homo sapiens} PDB: 2j06_A Back     alignment and structure
>3k1r_A Harmonin; protein-protein complex, alternative splicing, coiled coil, deafness, hearing, non-syndromic deafness, polymorphism; 2.30A {Homo sapiens} PDB: 2kbq_A 2kbr_A 2lsr_A Back     alignment and structure
>3tsv_A Tight junction protein ZO-1; PDZ, scaffolding, JAM, cell adhesion; 1.99A {Homo sapiens} PDB: 3shu_A Back     alignment and structure
>2ebp_A SAM and SH3 domain-containing protein 1; proline-glutamate repeat-containing protein, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2kea_A Back     alignment and structure
>2dl8_A SLIT-ROBO RHO GTPase-activating protein 2; SH3 domain, formin-binding protein 2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ue9_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2djq_A SH3 domain containing ring finger 2; MUS musculus 0 DAY neonate head cDNA, riken FULL-length enriched library, clone:4831401O22, structural genomics; NMR {Mus musculus} Back     alignment and structure
>3c0c_A Endophilin-A2; endocytosis, SH3, voltage-gated calcium channel, endosome, L binding, membrane, phosphoprotein, proto-oncogene, SH3 DOMA; 1.70A {Rattus norvegicus} Back     alignment and structure
>1aww_A ATK, AMGX1, BPK, bruton'S tyrosine kinase; X-linked agammaglobulinemia, XLA, BTK, SH3 domain, transferase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 1awx_A 1qly_A Back     alignment and structure
>2egc_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1v5q_A GRIP1 homolog, glutamate receptor interacting protein 1A-L homolog; PDZ domain, cellular signaling, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1gl5_A Tyrosine-protein kinase TEC; transferase, ATP-binding, SH3 domain, phosphorylation; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1uez_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1y0m_A 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase gamma 1; SH3 domain, hydrolase; 1.20A {Rattus norvegicus} PDB: 1ywp_A 1ywo_A Back     alignment and structure
>2d8h_A SH3YL1 protein; SH3 domain, hypothetical protein SH3YL1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2k9g_A SH3 domain-containing kinase-binding protein 1; CIN85, adaptor protein, downregulation, CBL, apoptosis, junction, cytoplasmic vesicle, cytoskeleton; NMR {Homo sapiens} Back     alignment and structure
>3soe_A Membrane-associated guanylate kinase, WW and PDZ containing protein 3; structural genomics consortium, SGC, PDZ domain, signaling P; 1.60A {Homo sapiens} Back     alignment and structure
>1uhc_A KIAA1010 protein; beta barrel, SH3, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2h2b_A Tight junction protein ZO-1; PDZ domain, phage derived high affinity ligand, cell adhesio; 1.60A {Homo sapiens} PDB: 2h2c_A 2h3m_A 2rrm_A Back     alignment and structure
>2ysq_A RHO guanine nucleotide exchange factor 9; SH3 domain, CDC42 guanine nucleotide exchange factor (GEF) 9, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dlp_A KIAA1783 protein; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dl3_A Sorbin and SH3 domain-containing protein 1; ponsin, C-CBL-associated protein, CAP, SH3 domain protein 5 SH3P12, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dlm_A Back     alignment and structure
>2dbm_A SH3-containing GRB2-like protein 2; EC 2.3.1.-, SH3 domain protein 2A, endophilin 1, EEN-B1, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2knb_B 3iql_A Back     alignment and structure
>4glm_A Dynamin-binding protein; SH3 domain, DNMBP, structural genomics, structural genomics consortium, SGC, SRC homology 3 domains, cell junctions; 1.90A {Homo sapiens} Back     alignment and structure
>2o9s_A Ponsin; SH3 domain, signaling protein; 0.83A {Homo sapiens} PDB: 2o31_A 2o9v_A 2o2w_A Back     alignment and structure
>1vb7_A PDZ and LIM domain 2; PDZ domain PDZ-LIM protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2ed0_A ABL interactor 2; coiled coil, cytoskeleton, nuclear protein, phosphorylation, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ugv_A KIAA0621, olygophrenin-1 like protein; beta barrel, GRAF protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>3u23_A CD2-associated protein; structural genomics, structural genomics consortium, SGC, BE barrel, adaptor protein, protein binding; 1.11A {Homo sapiens} PDB: 2krn_A Back     alignment and structure
>1i07_A Epidermal growth factor receptor kinase substrate EPS8; hormone/growth factor; 1.80A {Mus musculus} SCOP: b.34.2.1 PDB: 1aoj_A 1i0c_A Back     alignment and structure
>3ngp_A Spectrin alpha chain, brain; beta barrel, structural protein; 1.08A {Gallus gallus} PDB: 1e7o_A 1e6g_A 1e6h_A 1uue_A 1h8k_A 2lj3_A 1aey_A 1m8m_A 1shg_A 1u06_A 2nuz_A 2cdt_A 1hd3_A 2f2v_A 2f2w_A 2jm8_A 2jm9_A 2jma_A 3m0r_A 3m0p_A ... Back     alignment and structure
>2cre_A HEF-like protein; SH3 domain, SRC homology 3 domain, beta barrel, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>2a28_A BZZ1 protein; SH3 domain, signaling protein; 1.07A {Saccharomyces cerevisiae} Back     alignment and structure
>2eeh_A PDZ domain-containing protein 7; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2kxd_A 11-MER peptide, SH3 domain of spectrin alpha CHAI; alpha spectrin SH3 domain, SPC-S19P20S circular permutant, S protein; NMR {Synthetic} Back     alignment and structure
>1x6g_A Megakaryocyte-associated tyrosine-protein kinase; MATK, CTK, HYL, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2eqi_A Phospholipase C, gamma 2; SH3 domain, PLCG2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2dl7_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2v1q_A SLA1, cytoskeleton assembly control protein SLA1; structural genomics, phosphorylation, structural protein, yeast, SH3 domain; 1.2A {Saccharomyces cerevisiae} PDB: 1z9z_A Back     alignment and structure
>2oaw_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.90A {Gallus gallus} PDB: 2rot_A 2rmo_A 2kr3_A Back     alignment and structure
>1z9q_A Neutrophil cytosol factor 4; oxidoreductase activator; NMR {Homo sapiens} Back     alignment and structure
>3rnj_A Brain-specific angiogenesis inhibitor 1-associate 2; structural genomics, structural genomics consortium, SGC, BE barrel; HET: EDT; 1.50A {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1yn8_A NBP2, NAP1-binding protein 2; SH3 domain, unknown function; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1zuu_A BZZ1 protein; SH3 domain, unknown function; 0.97A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>4esr_A Jouberin; AHI-1, AHI1, AHI-1 SH3 domain, SH3 domain, dynamin-2, protei binding, chronic myeloid leukemia; 1.53A {Homo sapiens} Back     alignment and structure
>2yuo_A CIP85, RUN and TBC1 domain containing 3; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2gqi_A RAS GTPase-activating protein 1; GAP, RAS P21 protein activator, P120GAP, rasgap, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>3cqt_A P59-FYN, proto-oncogene tyrosine-protein kinase FYN; beta barrel, ATP-binding, developmental protein, lipoprotein, manganese, metal-binding; 1.60A {Gallus gallus} PDB: 2l2p_A Back     alignment and structure
>2m0y_A Dedicator of cytokinesis protein 1; apoptosis; NMR {Mus musculus} Back     alignment and structure
>1ujy_A RHO guanine nucleotide exchange factor 6; structural genomics, SH3 domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2kom_A Partitioning defective 3 homolog; PAR-3B, PDZ domain, PSI, structural genomics, alternative splicing, cell cycle, cell division, cell junction; NMR {Homo sapiens} Back     alignment and structure
>1wxt_A Hypothetical protein FLJ21522; SH3 domain, EPS8-related protein 3, protein-protein interaction, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1x69_A Cortactin isoform A; SH3 domain, CTTN, oncogene EMS1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1neg_A Spectrin alpha chain, brain; SH3-domain fold, five antiparallel beta sheets, structural protein; 2.30A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>3eg3_A Proto-oncogene tyrosine-protein kinase ABL1; beta, ATP-binding, cell adhesion, cytoskeleton, LIPO magnesium, manganese, metal-binding, myristate; 1.40A {Homo sapiens} PDB: 3egu_A 3eg0_A 3eg2_A 3eg1_A 1abo_A 1abq_A 1ju5_C* 2o88_A 1bbz_A 1awo_A Back     alignment and structure
>1zuy_A Myosin-5 isoform; SH3 domain, contractIle protein; 1.39A {Saccharomyces cerevisiae} PDB: 1yp5_A Back     alignment and structure
>2kjd_A Sodium/hydrogen exchange regulatory cofactor NHE- RF1; PDZ domain, protein, acetylation, cell projection, disease mutation, membrane; NMR {Homo sapiens} Back     alignment and structure
>2lcs_A NAP1-binding protein 2; adaptor, transferase, signaling protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2edz_A PDZ domain-containing protein 1; CFTR-associated protein of 70 kDa, Na/PI cotransporter C- terminal-associated protein, NAPI-CAP1; NMR {Mus musculus} Back     alignment and structure
>2csq_A RIM-BP2, RIM binding protein 2; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vae_A Rhophilin 2, rhophilin, RHO GTPase binding protein 2; PDZ domain, intracellular signaling cascade, signal transduction; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2jw4_A Cytoplasmic protein NCK1; SH3 domain, phosphorylation, SH2 domain, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2fpf_A C-JUN-amino-terminal kinase interacting protein 1; scaffold protein 1, islet-brain-1, IB-1, mitogen-activated P kinase 8-interacting protein 1; 3.00A {Rattus norvegicus} Back     alignment and structure
>1gbq_A GRB2; complex (signal transduction/peptide), SH3 domain; NMR {Mus musculus} SCOP: b.34.2.1 PDB: 1gbr_A 2gbq_A 3gbq_A 4gbq_A Back     alignment and structure
>2dil_A Proline-serine-threonine phosphatase-interacting protein 1; SH3 domain, PEST phosphatase-interacting protein 1, CD2- binding protein 1; NMR {Homo sapiens} Back     alignment and structure
>2jt4_A Cytoskeleton assembly control protein SLA1; endocytosis, SH3, actin-binding, cytoplasm, cytoskeleton, phosphorylation, SH3 domain, DNA damage, DNA repair, nucleus; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2da9_A SH3-domain kinase binding protein 1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2jxb_A T-cell surface glycoprotein CD3 epsilon chain, cytoplasmic protein NCK2; T-cell receptor, SH3 domain, immunology, SH2 domain; NMR {Homo sapiens} Back     alignment and structure
>1uhf_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1wif_A RSGI RUH-020, riken cDNA 4930408O21; PDZ domain, structural genomics, mouse cDNA, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>2dm1_A Protein VAV-2; RHO family guanine nucleotide exchange factor, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2edv_A FERM and PDZ domain-containing protein 1; cytoskeletal-associated protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2rf0_A Mitogen-activated protein kinase kinase kinase 10; MAP3K10, MLK2, SH3 domain, TKL kinase, MKN28, structural GEN structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>3thk_A Spectrin alpha chain, brain; SH3 domain, chimera, structural protein; 1.70A {Rattus norvegicus} SCOP: b.34.2.1 Back     alignment and structure
>1x43_A Endophilin B1, SH3 domain GRB2-like protein B1; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ecz_A Sorbin and SH3 domain-containing protein 1; glycoprotein, membrane, nuclear protein, phosphorylation, polymorphism, transport, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>4f14_A Nebulette; SH3 domain, heart muscle, actin-binding protein-peptide COMP; 1.20A {Homo sapiens} PDB: 1ark_A 1neb_A 3i35_A Back     alignment and structure
>1u5s_A Cytoplasmic protein NCK2; protein-protein complex, beta barrel, beta sheet, zinc finger, metal binding protein; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2fry_A Back     alignment and structure
>1wi7_A SH3-domain kinase binding protein 1; beta barrel, SH3KBP1, RUK, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} Back     alignment and structure
>1wxb_A Epidermal growth factor receptor pathway substrate 8-like protein; SH3, EPS8, EPS8L2, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2epd_A RHO GTPase-activating protein 4; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cuc_A SH3 domain containing ring finger 2; structural genomics, ring finger 2 containing protein, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1nm7_A Peroxisomal membrane protein PAS20; yeast, PEX5P, PEX14P, PEX13P, import machine, SH3 domain, protein transport; NMR {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>2kxc_A Brain-specific angiogenesis inhibitor 1-associate 2-like protein 1; IRTKS-SH3, espfu, complex structure, protein binding; NMR {Homo sapiens} Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1spk_A RSGI RUH-010, riken cDNA 1300006M19; structural genomics, SH3 domain, five-stranded barrel, mouse cDNA; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>4ag1_C Fynomer; hydrolase-de novo protein complex, inhibitor, serine proteas; 1.40A {Synthetic construct} PDB: 4afz_C 4ag2_C* 4afq_C* 4afs_C 4afu_C 1azg_B 1nyf_A 1nyg_A 1a0n_B 3ua7_A 3ua6_A 1fyn_A 1m27_C* 1shf_A 1zbj_A 1efn_A 1avz_C 1nlo_C* 1nlp_C* 1qwe_A ... Back     alignment and structure
>1ruw_A Myosin-3 isoform, MYO3; SH3 domain, yeast, high-throughput, structural genomics, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2btt_A 1va7_A Back     alignment and structure
>2dl5_A KIAA0769 protein; SH3 domain, FCHSD2, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yun_A Nostrin; nitric oxide synthase trafficker, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x3w_D Syndapin I, protein kinase C and casein kinase substrate in N protein 1; endocytosis, N-WAsp, dynamin, pacsin I, transferase; 2.64A {Mus musculus} PDB: 2x3x_D Back     alignment and structure
>2ct3_A Vinexin; SH3 domian, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ekh_A SH3 and PX domain-containing protein 2A; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1j3t_A Intersectin 2; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2dnu_A RUH-061, SH3 multiple domains 1; RSGI, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vz5_A TAX1-binding protein 3; WNT signaling pathway, protein binding, nucleus, cytoplasm, PDZ domain; 1.74A {Homo sapiens} PDB: 3dj1_A 3diw_A 2l4s_A 2l4t_A 3gj9_A 2kg2_A 3dj3_A Back     alignment and structure
>3qik_A Phosphatidylinositol 3,4,5-trisphosphate-dependen exchanger 1 protein; PDZ domain, structural genomics consortium, SGC, hydrolase R; 2.29A {Homo sapiens} Back     alignment and structure
>2d8i_A T-cell lymphoma invasion and metastasis 1 variant; PDZ domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cub_A Cytoplasmic protein NCK1; SH3 domain, NCK1 adaptor, tyrosine kinase, signal transduction, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lob_A Golgi-associated PDZ and coiled-coil motif-contai protein; structural protein-hydrolase complex, peptide binding protei; NMR {Homo sapiens} Back     alignment and structure
>1wx6_A Cytoplasmic protein NCK2; SH3 domain, structural genomics, signal transduction, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} Back     alignment and structure
>2ega_A SH3 and PX domain-containing protein 2A; SH3 domain, KIAA0418 protein, SH3MD1, SH3 multiple domains 1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uff_A Intersectin 2; beta barrel, SH3 domain, endocytosis, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2edp_A Fragment, shroom family member 4; APX/shroom family member, KIAA1202 protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vkn_A Protein SSU81; membrane, SH3 domain, transmembrane, membrane; 2.05A {Saccharomyces cerevisiae} Back     alignment and structure
>2yup_A Vinexin; sorbin and SH3 domain-containing protein 3, SH3-containing adapter molecule 1, SCAM-1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2o2o_A SH3-domain kinase-binding protein 1; CIN85, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1x6b_A RHO guanine exchange factor (GEF) 16; SH3 domain, neuroblastoma, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2enm_A Sorting nexin-9; SH3-like barrel, protein transport, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1whd_A RGS3, regulator of G-protein signaling 3; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1udl_A Intersectin 2, KIAA1256; beta barrel, SH3 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>1hsq_A Phospholipase C-gamma (SH3 domain); phosphoric diester hydrolase; NMR {Homo sapiens} SCOP: b.34.2.1 PDB: 2hsp_A Back     alignment and structure
>2rqr_A CED-12 homolog, engulfment and cell motility protein 1, linker, D of cytokinesis protein 2; KIAA0209, KIAA0281, apoptosis, membrane, phagocytosis; NMR {Homo sapiens} Back     alignment and structure
>1s1n_A Nephrocystin 1; beta barrel, cell adhesion; NMR {Homo sapiens} Back     alignment and structure
>2ct4_A CDC42-interacting protein 4; thyroid receptor interacting protein 10, SH3 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1ujv_A Membrane associated guanylate kinase inverted-2 (MAGI-2); atrophin-1 interacting protein 1, PDZ domain, structural genomics, KIAA0705 protein; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>1v5l_A PDZ and LIM domain 3; actinin alpha 2 associated LIM protein; PDZ domain, cytoskeleton, actin binding, structural genomics; NMR {Mus musculus} SCOP: b.36.1.1 Back     alignment and structure
>1x5n_A Harmonin; PDZ domain, usher syndrome 1C protein, autoimmune enteropathy-related antigen AIE-75 ,antigen NY-CO-38/NY-CO- 37, PDZ-73 protein; NMR {Homo sapiens} SCOP: b.36.1.1 PDB: 2kbs_A Back     alignment and structure
>1bb9_A Amphiphysin 2; transferase, SH3 domain; 2.20A {Rattus norvegicus} SCOP: b.34.2.1 PDB: 1muz_A 1mv0_B Back     alignment and structure
>1qau_A Neuronal nitric oxide synthase (residues 1-130); beta-finger, oxidoreductase; 1.25A {Rattus norvegicus} SCOP: b.36.1.1 PDB: 1qav_B Back     alignment and structure
>1i1j_A Melanoma derived growth regulatory protein; SH3 subdomain, hormone/growth factor complex; 1.39A {Homo sapiens} SCOP: b.34.2.1 PDB: 1k0x_A 1hjd_A Back     alignment and structure
>2oi3_A Tyrosine-protein kinase HCK; human HCK, SH3, SRC-type tyrosine kinase, transferase; NMR {Homo sapiens} PDB: 2oj2_A 4hck_A 5hck_A Back     alignment and structure
>3qwx_X Cell death abnormality protein 2; cell engulfment, signaling protein; 2.01A {Caenorhabditis elegans} Back     alignment and structure
>3reb_B Tyrosine-protein kinase HCK; HIV-1 NEF, SH3 domain binding, signaling, HCK SH3 domain, PR binding; 3.45A {Homo sapiens} Back     alignment and structure
>3cyy_A Tight junction protein ZO-1; protein-ligand complex, cell junction, membrane, phosphoprot domain, tight junction, transmembrane; 2.40A {Homo sapiens} Back     alignment and structure
>2eaq_A LIM domain only protein 7; conserved hypothetical protein, structural genomics, NPPSFA; 1.46A {Homo sapiens} Back     alignment and structure
>1jqq_A PEX13P, peroxisomal membrane protein PAS20, PAS20P, roxin-13; compact beta-barrel of five anti-parrallel beta-strands; 2.65A {Saccharomyces cerevisiae} SCOP: b.34.2.1 PDB: 1n5z_A Back     alignment and structure
>3sfj_A TAX1-binding protein 3; PDZ:peptide complex, signaling protein-inhibitor complex; 1.24A {Homo sapiens} PDB: 3dj3_A Back     alignment and structure
>1wh1_A KIAA1095 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2v1r_A Peroxisomal membrane protein PAS20; protein transport, translocation, transmembrane, peptide COM structural genomics, peroxisome; 2.1A {Saccharomyces cerevisiae} SCOP: b.34.2.1 Back     alignment and structure
>1b8q_A Protein (neuronal nitric oxide synthase); PDZ domain, NNOS, nitric oxide synthase, oxidoreductase; NMR {Rattus norvegicus} SCOP: b.36.1.1 Back     alignment and structure
>1u3o_A Huntingtin-associated protein-interacting protein; SH3, CIS-proline,, signaling protein; NMR {Rattus norvegicus} Back     alignment and structure
>1wxu_A Peroxisomal biogenesis factor 13; SH3 domain, PEX13, protein-protein interaction, structural genomics; NMR {Mus musculus} Back     alignment and structure
>2e5k_A Suppressor of T-cell receptor signaling 1; SH3 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>2krg_A Na(+)/H(+) exchange regulatory cofactor NHE-RF1; acetylation, cell projection, disease mutation, membrane, phosphoprotein, polymorphism; NMR {Homo sapiens} Back     alignment and structure
>4d8k_A Tyrosine-protein kinase LCK; protein kinases, SH2 domain, SH3 domain, structural genomics center for structural genomics, JCSG; 2.36A {Homo sapiens} PDB: 1lck_A* 1x27_A* Back     alignment and structure
>3gsl_A Disks large homolog 4; PDZ domain, tandem, PSD-95, DLG4, SAP-90, GLUR6, cell juncti membrane, lipoprotein, membrane, palmitate, phosphoprotein; 2.05A {Rattus norvegicus} PDB: 3zrt_A 2ka9_A Back     alignment and structure
>1k1z_A VAV; SH3, proto-oncogene, signaling protein; NMR {Mus musculus} SCOP: b.34.2.1 Back     alignment and structure
>1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2qbw_A PDZ-fibronectin fusion protein; fibronectin PDZ, unknown function; 1.80A {Homo sapiens} PDB: 3ch8_A Back     alignment and structure
>1lvg_A Guanylate kinase, GMP kinase; transferase; HET: ADP 5GP; 2.10A {Mus musculus} SCOP: c.37.1.1 Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2kbt_A Chimera of proto-oncogene VAV, linker, immunoglobulin G-binding protein G; sortase, protein ligation, intein, inset, solubility enhancement; NMR {Mus musculus} Back     alignment and structure
>2rcz_A Tight junction protein ZO-1; PDZ, domain-swapping, cell junction, membrane, phosphorylati domain, protein binding; 1.70A {Homo sapiens} PDB: 2jwe_A 2osg_A Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>3i5r_A Phosphatidylinositol 3-kinase regulatory subunit alpha; SH3 domain, peptide complex, alternative splicing, disease mutation, HOST-virus interaction, phosphoprotein, polymorphism; 1.70A {Homo sapiens} SCOP: b.34.2.1 PDB: 3i5s_A 1pht_A 1pnj_A 2pni_A 1pks_A 1pkt_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3o5z_A Phosphatidylinositol 3-kinase regulatory subunit; SRC homology 3 domain, protein binding; 2.01A {Homo sapiens} SCOP: b.34.2.0 PDB: 2kt1_A Back     alignment and structure
>1gcq_C VAV proto-oncogene; SH3 domain, protein-protein complex, GRB2,VAV, signaling protein/signaling protein complex; 1.68A {Mus musculus} SCOP: b.34.2.1 PDB: 1gcp_A Back     alignment and structure
>2dvj_A V-CRK sarcoma virus CT10 oncogene homolog, isoform A; SH3, SH2, signal transduction, adapter molecule, signaling protein; HET: PTR; NMR {Homo sapiens} PDB: 2eyy_A 2eyv_A 2eyw_A Back     alignment and structure
>3r0h_A INAD, inactivation-NO-after-potential D protein; protein-protein complex, PDZ domain, peptide binding protein; 2.60A {Drosophila melanogaster} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>1uf1_A KIAA1526 protein; PDZ domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.36.1.1 Back     alignment and structure
>2qt5_A Glutamate receptor-interacting protein 1; PDZ-peptide complex, PDZ tandem, alternative splicing, cell junction, cytoplasm; 2.30A {Rattus norvegicus} Back     alignment and structure
>1g2b_A Spectrin alpha chain; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton, metal binding protein; 1.12A {Gallus gallus} SCOP: b.34.2.1 PDB: 1tud_A Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2yub_A LIMK-2, LIM domain kinase 2; PDZ domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3a98_A DOCK2, dedicator of cytokinesis protein 2; protein-protein complex, DOCK2, ELMO1, SH3 domain, PH domain bundle, proline-rich sequence, cytoskeleton; 2.10A {Homo sapiens} Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>3jv3_A Intersectin-1; SH3 domain, DH domain, guanine nucleotide exchange factor, autoinhibition, domain-swapped, cell junction, cell project endocytosis; 2.40A {Mus musculus} PDB: 3gf9_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 Back     alignment and structure
>1ng2_A Neutrophil cytosolic factor 1; P47PHOX, autoinhibited, SH3 domain, NADPH oxidase, oxidoredu activator; 1.70A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 PDB: 1uec_A 1ov3_A 1wlp_B Back     alignment and structure
>1tuc_A Alpha-spectrin; capping protein, calcium-binding, duplication, repeat, SH3 domain, cytoskeleton; 2.02A {Gallus gallus} SCOP: b.34.2.1 Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>2pz1_A RHO guanine nucleotide exchange factor 4; helical bundle, beta barrel, beta sandwich, signaling protei; 2.25A {Homo sapiens} PDB: 2dx1_A 3nmz_D 3nmx_D Back     alignment and structure
>1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... Back     alignment and structure
>1p1d_A PDZ45, glutamate receptor interacting protein; PDZ domain, tandem repeats, scaffold protein, protein binding; NMR {Rattus norvegicus} SCOP: b.36.1.1 b.36.1.1 PDB: 1p1e_A 1x5r_A Back     alignment and structure
>1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A Back     alignment and structure
>2eyz_A V-CRK sarcoma virus CT10 oncogene homolog isoform A; SH2, SH3, signaling protein; NMR {Homo sapiens} PDB: 2l3s_A 2l3p_A 2l3q_A 2ggr_A Back     alignment and structure
>3tsz_A Tight junction protein ZO-1; PDZ3-SH3-GUK, scaffolding, JAM, tight junction, cell adhesio; 2.50A {Homo sapiens} PDB: 3tsw_A 3lh5_A Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>2jmc_A Spectrin alpha chain, brain and P41 peptide chimera; SPC-SH3, signaling protein; NMR {Gallus gallus} Back     alignment and structure
>3lnc_A Guanylate kinase, GMP kinase; ALS collaborative crystallography, emerald biostructures, ATP-binding, cytoplasm, nucleotide-binding; HET: 5GP; 1.95A {Anaplasma phagocytophilum} Back     alignment and structure
>1gri_A Growth factor bound protein 2; SH2, SH3, signal transduction adaptor; 3.10A {Homo sapiens} SCOP: b.34.2.1 b.34.2.1 d.93.1.1 PDB: 1aze_A 2a37_A 2azv_A 2a36_A 2azs_A Back     alignment and structure
>3shw_A Tight junction protein ZO-1; PDZ-SH3-GUK supramodule, cell adhesion; 2.90A {Homo sapiens} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2de0_X Alpha-(1,6)-fucosyltransferase; FUT8, glycosyltransferase, N-glycan, COR SH3 domain; 2.61A {Homo sapiens} Back     alignment and structure
>1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A Back     alignment and structure
>3i18_A LMO2051 protein; alpha-beta protein, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 1.70A {Listeria monocytogenes} PDB: 2kjk_A 3i1e_A Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>2pzd_A Serine protease HTRA2; PDZ domain, apoptosis, mitochondria, peptid module, hydrolase; 2.75A {Homo sapiens} SCOP: b.36.1.4 Back     alignment and structure
>1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B Back     alignment and structure
>2kjp_A Uncharacterized protein YLBL; mixed alpha-beta protein, cell membrane, hydrolase, membrane, protease, serine protease, transmembrane; NMR {Bacillus subtilis} Back     alignment and structure
>2l97_A HTRA, putative serine protease; HTRA-PDZ, protein binding; NMR {Streptococcus pneumoniae} Back     alignment and structure
>2lqn_A CRK-like protein; SH2, SH3, V-CRK sarcoma virus CT10 oncogene homolog (avian)- signaling protein; NMR {Homo sapiens} PDB: 2lqw_A* Back     alignment and structure
>2kl1_A YLBL protein; structure genomics, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium; NMR {Geobacillus thermodenitrificans} Back     alignment and structure
>3id1_A Regulator of sigma E protease; hydrolase, cell inner membrane, cell membrane, membrane, metal-binding, metalloprotease, transmembrane; 1.67A {Escherichia coli k-12} PDB: 2zpl_A Back     alignment and structure
>2i6v_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.63A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>1ri9_A FYN-binding protein; SH3-like, helically extended, signaling protein; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>2p3w_A Probable serine protease HTRA3; PDZ domain, phage derived high affinity ligand, protein BIND; 1.70A {Homo sapiens} Back     alignment and structure
>3suz_A Amyloid beta A4 precursor protein-binding family 2; APP binding; 2.70A {Rattus norvegicus} PDB: 1u3b_A 1u39_A 1x45_A 1u37_A 1u38_A 2yt8_A Back     alignment and structure
>2zpm_A Regulator of sigma E protease; metalloproteinase, membrane protein, PDZ domain, hydrolase, inner membrane, membrane, metal-binding; HET: MLY MSE; 0.98A {Escherichia coli} PDB: 3id2_A 3id3_A 3id4_A Back     alignment and structure
>1w9e_A Syntenin 1; cell adhesion, adhesion/complex, PDZ domain, scaffolding protein signaling protein; 1.56A {Homo sapiens} SCOP: b.36.1.1 b.36.1.1 PDB: 1n99_A 1v1t_A 1obz_A 1w9o_A 1w9q_A 1ybo_A Back     alignment and structure
>3haj_A Human pacsin2 F-BAR; pacsin,syndapin,FAP52,F-BAR, alternative splicing, coiled coil, cytoplasmic vesicle, endocytosis, phosphoprotein, polymorphism; 2.78A {Homo sapiens} Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>2gtj_A FYN-binding protein; SH3, redox, signaling protein; NMR {Homo sapiens} PDB: 2gto_A Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>3qwy_A Cell death abnormality protein 2; cell engulfment, signaling protein; 2.52A {Caenorhabditis elegans} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} Back     alignment and structure
>1te0_A Protease DEGS; two domains, serine protease, PDZ, alpha-beta protein, hydro; 2.20A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3gdv_A* 3gcn_A* 3gds_A* 3gdu_A* 3gco_A* 1sot_A 1soz_A 1vcw_A 2r3y_A Back     alignment and structure
>2i4s_A General secretion pathway protein C; EPSC, GSPC, PDZ domain, type 2 secretion system, protein transport, membrane protein; 1.92A {Vibrio cholerae} SCOP: b.36.1.5 Back     alignment and structure
>2hga_A Conserved protein MTH1368; GFT structural genomics, PSI, protein structure initiative; NMR {Methanothermobacterthermautotrophicus} SCOP: b.36.1.6 Back     alignment and structure
>1y8t_A Hypothetical protein RV0983; serine protease, structural genomics, PSI, protein structure initiative; 2.00A {Mycobacterium tuberculosis} SCOP: b.36.1.4 b.47.1.1 PDB: 2z9i_A Back     alignment and structure
>3stj_A Protease DEGQ; serine protease, PDZ domain, protease, chaperone, DEGP, DEGQ hydrolase; 2.60A {Escherichia coli} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>1fc6_A Photosystem II D1 protease; D1 C-terminal processing protease, serine protease, serine- lysine catalytic DYAD, PDZ domain, photosynthesis; 1.80A {Scenedesmus obliquus} SCOP: b.36.1.3 c.14.1.2 PDB: 1fc9_A 1fc7_A 1fcf_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>4fgm_A Aminopeptidase N family protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, peptidase_M61, PDZ; 2.39A {Idiomarina loihiensis L2TR} Back     alignment and structure
>3rle_A Golgi reassembly-stacking protein 2; PDZ, tether, golgin, membrane protein; 1.65A {Homo sapiens} PDB: 4edj_A Back     alignment and structure
>3k50_A Putative S41 protease; structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>1lcy_A HTRA2 serine protease; apoptosis, PDZ domain, caspase activation, binding, hydrolase; 2.00A {Homo sapiens} SCOP: b.36.1.4 b.47.1.1 Back     alignment and structure
>3qo6_A Protease DO-like 1, chloroplastic; protease, HTRA, PH-sensor, hydrolase, photosynthesis; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3pvl_A Myosin VIIA isoform 1; protein complex, novel folding, protein cargo binding, cargo proteins, motor protein-protein transport complex; 2.80A {Mus musculus} Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3pe0_A Plectin; cytoskeleton, plakin, spectrin repeat, SH3, structural prote intermediate filament, crosslinking; 2.95A {Homo sapiens} Back     alignment and structure
>3pv2_A DEGQ; trypsin fold, PDZ domain, chaperone protease, hydrolase; 2.15A {Legionella fallonii} PDB: 3pv3_A 3pv5_A 3pv4_A Back     alignment and structure
>4a8c_A Periplasmic PH-dependent serine endoprotease DEGQ; chaperone, hydrolase; 7.50A {Escherichia coli} PDB: 4a8a_A 4a8b_A 4a9g_A Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3num_A Serine protease HTRA1; DEGP, hydrolase; 2.75A {Homo sapiens} PDB: 3nzi_A 2ytw_A 2joa_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>1ky9_A Protease DO, DEGP, HTRA; protein quality control, serine protease, trypsin, chaperone, PDZ, ATP-independent, temperature-regulated, periplasm; 2.80A {Escherichia coli} SCOP: b.36.1.4 b.47.1.1 PDB: 3ou0_A 4a8d_A 3otp_A 3mh7_A 3mh4_A 3mh5_A* 3mh6_A* 3cs0_A 2zle_A Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2dyb_A Neutrophil cytosol factor 4; P40(PHOX), NADPH oxidase, oxidoreductase; HET: CAF; 3.15A {Homo sapiens} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>3r6n_A Desmoplakin; spectrin repeat, SH3 domain, cell adhesion, desmosome; 2.95A {Homo sapiens} Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>1ug1_A KIAA1010 protein; structural genomics, SH3 domain, hypothetical protein BAA76854.1, riken structural genomics/proteomics initiative RSGI; NMR {Homo sapiens} SCOP: b.34.2.1 Back     alignment and structure
>4fln_A Protease DO-like 2, chloroplastic; protease, DEG, PDZ, hydrolase; 2.80A {Arabidopsis thaliana} Back     alignment and structure
>3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* Back     alignment and structure
>3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A Back     alignment and structure
>3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A Back     alignment and structure
>3kfv_A Tight junction protein ZO-3; structural genomics consortium, SGC, cell junction, cell membrane, membrane, SH3 domain; 2.80A {Homo sapiens} Back     alignment and structure
>3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>4dey_A Voltage-dependent L-type calcium channel subunit; maguk, voltage dependent calcium channel, transport protein; 1.95A {Oryctolagus cuniculus} PDB: 4dex_A 1t3l_A 1t3s_A 1vyv_A 1vyu_A 1vyt_A 1t0h_B 1t0j_B 1t0h_A 1t0j_A Back     alignment and structure
>1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 Back     alignment and structure
>3dl0_A Adenylate kinase; phosphotransferase, zinc coordination, ATP-binding, binding, nucleotide biosynthesis, nucleotide-binding, trans; HET: AP5; 1.58A {Bacillus subtilis} PDB: 1p3j_A* 2ori_A* 2eu8_A* 2oo7_A* 2p3s_A* 2qaj_A* 2osb_A* 3dkv_A* 1zin_A* 1zio_A* 1zip_A* 1s3g_A* Back     alignment and structure
>3d3q_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2; 2.70A {Staphylococcus epidermidis atcc 12228} Back     alignment and structure
>3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A Back     alignment and structure
>3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} Back     alignment and structure
>2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A Back     alignment and structure
>1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 Back     alignment and structure
>4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 440
d1t0ha_96 b.34.2.1 (A:) SH3-like domain of the L-type calciu 2e-21
d1vyua1136 b.34.2.1 (A:39-174) SH3-like domain of the L-type 4e-20
d1vyva1145 b.34.2.1 (A:71-215) SH3-like domain of the L-type 3e-19
d1kjwa196 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicu 1e-14
d1kjwa2199 c.37.1.1 (A:526-724) Guanylate kinase-like domain 2e-14
d1kjwa2199 c.37.1.1 (A:526-724) Guanylate kinase-like domain 7e-07
d1kgda_178 c.37.1.1 (A:) Guanylate kinase-like domain of Cask 4e-13
d1kgda_178 c.37.1.1 (A:) Guanylate kinase-like domain of Cask 2e-06
d1udla_98 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 3e-09
d1ckaa_57 b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse 9e-09
d1gcqa_56 b.34.2.1 (A:) Growth factor receptor-bound protein 1e-08
d1kwaa_88 b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [Ta 2e-08
d1awwa_67 b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Hom 2e-08
d1s96a_205 c.37.1.1 (A:) Guanylate kinase {Escherichia coli [ 3e-08
d1n7ea_95 b.36.1.1 (A:) Glutamate receptor-interacting prote 4e-08
d1k4us_62 b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId 5e-08
d1sema_58 b.34.2.1 (A:) Growth factor receptor-bound protein 6e-08
d1utia_57 b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona 1e-07
d1gkya_186 c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Sac 2e-07
d1spka_72 b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RI 2e-07
d1u06a155 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chic 3e-07
d2hspa_71 b.34.2.1 (A:) Phospholipase C, SH3 domain {Human ( 4e-07
d1jo8a_58 b.34.2.1 (A:) Actin binding protein ABP1 {Baker's 6e-07
d1uj0a_58 b.34.2.1 (A:) Signal transducing adaptor molecule 8e-07
d1k9aa171 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (cs 9e-07
d1arka_60 b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo 9e-07
d1wiea_96 b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human 1e-06
d1ng2a2118 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic 1e-06
d1ujya_76 b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens 1e-06
d1lcya1100 b.36.1.4 (A:226-325) Mitochondrial serine protease 1e-06
d1lvga_190 c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculu 2e-06
d1lvga_190 c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculu 3e-04
d1fmka164 b.34.2.1 (A:82-145) c-src protein tyrosine kinase 2e-06
d1va8a1100 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {M 3e-06
d1gl5a_67 b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musc 4e-06
d2v1ra167 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pe 7e-06
d1ugva_72 b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA062 7e-06
d1t2ma192 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [Ta 7e-06
d2rn8a153 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus 8e-06
d1ky9b288 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-t 9e-06
d1u5sa171 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [Tax 1e-05
d1efna_57 b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, 1e-05
d1ujda_117 b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human 2e-05
d2iima162 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 d 2e-05
d1v62a_117 b.36.1.1 (A:) Glutamate receptor interacting prote 2e-05
d1wh1a_124 b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human 3e-05
d1x45a185 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protei 3e-05
d1ueqa_123 b.36.1.1 (A:) Membrane associated guanylate kinase 4e-05
d1x5ra199 b.36.1.1 (A:8-106) Glutamate receptor interacting 4e-05
d1ue9a_80 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 5e-05
d2fcfa196 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein 6e-05
d1bb9a_83 b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicu 1e-04
d1qcfa165 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Hu 1e-04
d1wfwa_74 b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [Ta 1e-04
d1gria156 b.34.2.1 (A:1-56) Growth factor receptor-bound pro 1e-04
d1wifa_126 b.36.1.1 (A:) hypothetical PDZ domain containing p 1e-04
d1uhfa_69 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 2e-04
d1uhca_79 b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIA 2e-04
d1zuua156 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyc 2e-04
d1g9oa_91 b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, 2e-04
d2cssa1108 b.36.1.1 (A:8-115) Regulating synaptic membrane ex 2e-04
d2fnea188 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein 3e-04
d1ycsb263 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [ 3e-04
d1ihja_94 b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanoga 3e-04
d1qava_90 b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [Ta 3e-04
d1k32a191 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Th 3e-04
d1gcqc_69 b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mu 4e-04
d1wi4a196 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mou 4e-04
d1ng2a158 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic 5e-04
d2i6va187 b.36.1.5 (A:219-305) General secretion pathway pro 5e-04
d2f5ya177 b.36.1.1 (A:19-95) Regulator of G-protein signalin 6e-04
d1j3ta_74 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 6e-04
d1rzxa_98 b.36.1.1 (A:) GTPase-binding domain of the cell po 8e-04
d1v5la_103 b.36.1.1 (A:) Alpha-actinin-2 associated LIM prote 9e-04
d1oota_58 b.34.2.1 (A:) Hypothetical protein YFR024c {Baker' 0.001
d1whaa_105 b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sap 0.001
d2fe5a192 b.36.1.1 (A:223-314) Synapse-associated protein 10 0.001
d1v5qa_122 b.36.1.1 (A:) Glutamate receptor interacting prote 0.001
d1ufxa_103 b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapien 0.001
d1vb7a_94 b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus 0.001
d1i07a_59 b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus 0.001
d1y7na179 b.36.1.1 (A:12-90) Amyloid beta A4 precursor prote 0.002
d1r6ja_82 b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [Ta 0.002
d2z9ia188 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium 0.002
d1wg6a_127 b.36.1.1 (A:) Partitioning-defective 3-like protei 0.002
d1m5za_91 b.36.1.1 (A:) Glutamate receptor interacting prote 0.003
d1uffa_93 b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Hom 0.004
d1uita_117 b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Huma 0.004
d1v6ba_118 b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxI 0.004
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 96 Back     information, alignment and structure

class: All beta proteins
fold: SH3-like barrel
superfamily: SH3-domain
family: SH3-domain
domain: SH3-like domain of the L-type calcium channel
species: Rabbit (Oryctolagus cuniculus) [TaxId: 9986]

 Score = 86.5 bits (214), Expect = 2e-21
 Identities = 18/75 (24%), Positives = 35/75 (46%), Gaps = 2/75 (2%)

Query: 93  PIKPV-CYMRCLFTYDPKEDSLLPCKEIGLAFNHGDILQILNQKDPNWWQAQLIEPTGPM 151
             KPV   +R    Y   ++  +P   + ++F   D L +  + + +WW  +L++    +
Sbjct: 16  KTKPVAFAVRTNVRYSAAQEDDVPVPGMAISFEAKDFLHVKEKFNNDWWIGRLVKEGCEI 75

Query: 152 GLVPS-QELEERRKA 165
           G +PS  +LE  R  
Sbjct: 76  GFIPSPVKLENMRLQ 90
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 136 Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 145 Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 96 Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 199 Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 199 Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Length = 178 Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 67 Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 95 Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Length = 58 Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 186 Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Length = 72 Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Length = 55 Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Length = 58 Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 118 Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Length = 190 Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 64 Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Length = 67 Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 67 Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Length = 53 Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 88 Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 71 Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 57 Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Length = 62 Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Length = 123 Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 83 Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Length = 74 Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 126 Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 69 Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 63 Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 94 Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 91 Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 69 Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Length = 58 Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Length = 87 Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 74 Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 98 Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 103 Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 58 Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Length = 105 Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Length = 92 Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 122 Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 59 Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Length = 88 Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Length = 127 Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 91 Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Length = 117 Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query440
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 100.0
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 100.0
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 100.0
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 99.96
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 99.95
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 99.95
d1s96a_205 Guanylate kinase {Escherichia coli [TaxId: 562]} 99.81
d1kgda_178 Guanylate kinase-like domain of Cask {Human (Homo 99.72
d1t0ha_96 SH3-like domain of the L-type calcium channel {Rab 99.71
d1vyua1136 SH3-like domain of the L-type calcium channel {Rat 99.69
d1kjwa2199 Guanylate kinase-like domain of Psd-95 {Rat (Rattu 99.67
d1vyva1145 SH3-like domain of the L-type calcium channel {Rat 99.66
d1gkya_186 Guanylate kinase {Baker's yeast (Saccharomyces cer 99.63
d1kjwa196 Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} 99.61
d1lvga_190 Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 99.6
d1tp5a1102 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.59
d1kwaa_88 Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} 99.57
d1znwa1182 Guanylate kinase {Mycobacterium tuberculosis [TaxI 99.55
d2fcfa196 Multiple PDZ domain protein {Human (Homo sapiens) 99.54
d1g9oa_91 Na+/H+ exchanger regulatory factor, NHERF {Human ( 99.53
d1ozia_99 Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 1 99.52
d1r6ja_82 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.52
d1n7ea_95 Glutamate receptor-interacting protein 1, GRIP1 {R 99.5
d1uhpa_107 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.5
d1qava_90 Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} 99.5
d2fnea188 Multiple PDZ domain protein {Human (Homo sapiens) 99.5
d1rgra_93 Synaptic protein PSD-95 {Rat (Rattus norvegicus) [ 99.49
d1um1a_110 Hypothetical protein KIAA1849 {Human (Homo sapiens 99.48
d2fe5a192 Synapse-associated protein 102 {Human (Homo sapien 99.47
d1whaa_105 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.47
d1uita_117 Discs large 5 protein KIAA0583 {Human (Homo sapien 99.47
d1ujua_111 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.45
d1rzxa_98 GTPase-binding domain of the cell polarity protein 99.45
d1wf8a194 Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} 99.44
d1t2ma192 Afadin {Human (Homo sapiens) [TaxId: 9606]} 99.42
d1va8a1100 Maguk p55 subfamily member 5 {Mouse (Mus musculus) 99.42
d1p1da299 Glutamate receptor interacting protein {Rat (Rattu 99.41
d1m5za_91 Glutamate receptor interacting protein {Rat (Rattu 99.4
d1x6da1107 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.4
d1rgwa_85 Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [Tax 99.39
d1ihja_94 Inad {Fruit fly (Drosophila melanogaster) [TaxId: 99.38
d1wi2a_104 PDZ domain containing protein 11, Pdzk11 {Mouse (M 99.37
d1y7na179 Amyloid beta A4 precursor protein-binding family A 99.37
d1uepa_103 Membrane associated guanylate kinase inverted-2 (M 99.37
d1uewa_114 Membrane associated guanylate kinase inverted-2 (M 99.37
d1w9ea185 Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} 99.37
d1wfva_103 Membrane associated guanylate kinase inverted-2 (M 99.36
d1q3oa_104 Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId 99.35
d1i16a_130 Interleukin 16 {Human (Homo sapiens) [TaxId: 9606] 99.35
d1wi4a196 Syntaxin binding protein 4 {Mouse (Mus musculus) [ 99.35
d1x5qa197 Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 99.35
d2f5ya177 Regulator of G-protein signaling 3, RGS3 {Human (H 99.34
d1v62a_117 Glutamate receptor interacting protein 2, GRIP2 (K 99.34
d1qaua_112 Neuronal nitric oxide synthase, NNOS {Rat (Rattus 99.34
d2f0aa192 Segment polarity protein dishevelled homolog Dvl-2 99.33
d1x45a185 Amyloid beta A4 precursor protein-binding family A 99.33
d1ueqa_123 Membrane associated guanylate kinase inverted-2 (M 99.32
d1ujda_117 Hypothetical protein KIAA0559 {Human (Homo sapiens 99.31
d1vb7a_94 PDZ-LIM protein mystique {Mouse (Mus musculus) [Ta 99.31
d1x5na1101 Harmonin {Human (Homo sapiens) [TaxId: 9606]} 99.31
d1ueza_101 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.3
d1v6ba_118 Harmonin {Mouse (Mus musculus) [TaxId: 10090]} 99.29
d1uf1a_128 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.28
d1vaea_111 Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} 99.27
d1ckaa_57 C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) 99.27
d2h3la1103 Erbin {Human (Homo sapiens) [TaxId: 9606]} 99.27
d1ufxa_103 KIAA1526 protein {Human (Homo sapiens) [TaxId: 960 99.27
d1x5ra199 Glutamate receptor interacting protein 2, GRIP2 (K 99.26
d1gcqa_56 Growth factor receptor-bound protein 2 (GRB2), N- 99.25
d2cs5a1106 Tyrosine-protein phosphatase non-receptor type 4, 99.24
d1v5qa_122 Glutamate receptor interacting protein {Mouse (Mus 99.23
d2csja1104 Tight junction protein ZO-2, Tjp2 {Mouse (Mus musc 99.22
d2rn8a153 Bruton's tyrosine kinase {Mus musculus [TaxId: 100 99.21
d1k4us_62 p67phox {Human (Homo sapiens) [TaxId: 9606]} 99.21
d1wf7a_103 Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 1 99.21
d1v5la_103 Alpha-actinin-2 associated LIM protein {Mouse (Mus 99.2
d2cssa1108 Regulating synaptic membrane exocytosis protein 1, 99.2
d1sema_58 Growth factor receptor-bound protein 2 (GRB2), N- 99.19
d1utia_57 Grb2-related adaptor protein 2 (Mona/Gads) {Mouse 99.19
d1wifa_126 hypothetical PDZ domain containing protein Uqcrc2 99.19
d1jo8a_58 Actin binding protein ABP1 {Baker's yeast (Sacchar 99.18
d1u06a155 alpha-Spectrin, SH3 domain {Chicken (Gallus gallus 99.17
d1uj0a_58 Signal transducing adaptor molecule Stam2 {Mouse ( 99.15
d1wh1a_124 Hypothetical protein KIAA1095 {Human (Homo sapiens 99.14
d1wg6a_127 Partitioning-defective 3-like protein, PAR3-L (RIK 99.14
d1ng2a158 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.11
d1udla_98 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.1
d1arka_60 SH3 domain from nebulin {Human (Homo sapiens) [Tax 99.09
d2hspa_71 Phospholipase C, SH3 domain {Human (Homo sapiens) 99.05
d1ujya_76 Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606 99.04
d1efna_57 Fyn proto-oncogene tyrosine kinase, SH3 domain {Hu 99.04
d1awwa_67 Bruton's tyrosine kinase {Human (Homo sapiens) [Ta 99.04
d1wfwa_74 Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} 99.03
d1wlpb153 p47pox (neutrophil cytosolic factor 1) {Human (Hom 99.03
d1gl5a_67 tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 99.02
d1zuua156 BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.02
d1i07a_59 EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 1009 99.01
d1ue9a_80 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 99.01
d1ycsb263 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.0
d2v1ra167 Peroxisomal membrane protein Pex13p {Baker's yeast 98.99
d1j3ta_74 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.98
d2iima162 p56-lck tyrosine kinase, SH3 domain {Human (Homo s 98.95
d1qcfa165 Hemapoetic cell kinase Hck {Human (Homo sapiens) [ 98.95
d1fmka164 c-src protein tyrosine kinase {Human (Homo sapiens 98.95
d1gria156 Growth factor receptor-bound protein 2 (GRB2), N- 98.94
d1wiea_96 RIM binding protein 2, RIMBP2 {Human (Homo sapiens 98.93
d1ujva_96 Membrane associated guanylate kinase inverted-2 (M 98.92
d1opka157 Abl tyrosine kinase, SH3 domain {Mouse (Mus muscul 98.91
d1ng2a2118 p47pox (neutrophil cytosolic factor 1) {Human (Hom 98.9
d1oota_58 Hypothetical protein YFR024c {Baker's yeast (Sacch 98.9
d1spka_72 BAI1-associated protein 2-like 1 (RIKEN cDNA 13000 98.9
d1fc6a392 Photosystem II D1 C-terminal processing protease { 98.89
d1ugva_72 Olygophrenin-1 like protein (KIAA0621) {Human (Hom 98.88
d1uhfa_69 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.88
d1uffa_93 Intersectin 2 (KIAA1256) {Human (Homo sapiens) [Ta 98.85
d1uhca_79 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.85
d1k9aa171 Carboxyl-terminal src kinase (csk) {Human (Homo sa 98.84
d1u5sa171 Nck-2 {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1i1ja_106 Melanoma inhibitory activity protein {Human (Homo 98.75
d1ug1a_92 Hypothetical protein Baa76854.1 (KIAA1010) {Human 98.75
d1bb9a_83 Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 101 98.74
d1phta_83 Phosphatidylinositol 3-kinase (p85-alpha subunit, 98.71
d2z9ia188 Protease PepD {Mycobacterium tuberculosis [TaxId: 98.68
d1gcqc_69 Vav N-terminal SH3 domain {Mouse (Mus musculus) [T 98.68
d1ky9b288 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.53
d1lcya1100 Mitochondrial serine protease HtrA2 {Human (Homo s 98.32
d1k32a191 Tricorn protease {Archaeon Thermoplasma acidophilu 98.28
d1ky9a194 Protease Do (DegP, HtrA), C-terminal domains {Esch 98.08
d2hgaa1103 Uncharacterized protein MTH1368 {Methanobacterium 98.04
d1sota199 Stress sensor protease DegS, C-terminal domain {Es 98.02
d2i6va187 General secretion pathway protein C, EpsC {Vibrio 97.89
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Nucleotide and nucleoside kinases
domain: Guanylate kinase-like domain of Psd-95
species: Rat (Rattus norvegicus) [TaxId: 10116]

Probab=100.00  E-value=2.1e-36  Score=278.13  Aligned_cols=186  Identities=29%  Similarity=0.482  Sum_probs=159.9

Q ss_pred             hcccCCCcccccccccccccccccccccccccccCcccccCCCCCCCCCccCCCcceec-CHHHHHHhhhcCCeeEEEEE
Q psy4417         164 KAFVPPEADYVHKIGICGTRYIKQYNTLQYNSTLMSRSFPDTTRPMRELEENGQNYWFT-SREVMERDIQDHKFLEYGEH  242 (440)
Q Consensus       164 ~~~~~~~~~~~gk~~~~~~~~~~~~~~~~~~~~~~~~~~~~ttr~~r~~e~~g~~y~fv-s~~~f~~~i~~~~fle~~~~  242 (440)
                      +.+++.||   ||.++...|++.....+.       .+++||||+||++|++|.+|||+ ++++|++++++|.|+||+++
T Consensus        10 Rpivi~Gp---~K~ti~~~L~~~~p~~f~-------~~is~TTR~~R~~E~dG~dY~Fv~~~e~F~~~i~~~~fiE~~~~   79 (199)
T d1kjwa2          10 RPIIILGP---TKDRANDDLLSEFPDKFG-------SCVPHTTRPKREYEIDGRDYHFVSSREKMEKDIQAHKFIEAGQY   79 (199)
T ss_dssp             CCEEEEST---THHHHHHHHHHHCTTTEE-------CCCCEECSCCCTTCCBTTTBEECSCHHHHHHHHHTTCEEEEEEE
T ss_pred             CCEEEECc---CHHHHHHHHHHhCcccee-------ecccccccCCCCCCCCCcccchhhhHHHHHHHHhhccceeeeee
Confidence            34555666   588888887766555665       49999999999999999999998 78899999999999999999


Q ss_pred             cCCccccchhhHHHHHhcCCeEEeecCcchhhhhhhhhccccccccCCCceEEecCCCccceeecCCCcccchhhccCcc
Q psy4417         243 NGHLYGTHLDSIREVILSGKICVLDCSPVGLFTFLLGLIEGTVTAKLIPYTYSIPICSWSSFFASDTTRPMRELEENGQN  322 (440)
Q Consensus       243 ~g~~yg~~~~~i~~v~~~g~~~il~~~~~g~~~l~~~l~~~~~~~~~~p~~i~i~~~~~~~f~~~~ttr~~~~~e~~g~~  322 (440)
                      +|++|||+.++|+.++++|++||++++++|+.+|        +...+.|++|         ||.|++   ...++...  
T Consensus        80 ~g~~YGt~~~~i~~~~~~gk~~lldid~~g~~~l--------k~~~~~~i~I---------fI~pps---~e~l~~l~--  137 (199)
T d1kjwa2          80 NSHLYGTSVQSVREVAEQGKHCILDVSANAVRRL--------QAAHLHPIAI---------FIRPRS---LENVLEIN--  137 (199)
T ss_dssp             TTEEEEEEHHHHHHHHHTTCEEEECCCTTHHHHH--------HHTTCCCEEE---------EECCSS---HHHHHHHC--
T ss_pred             cCCccceeeeEEEehhcCCCcccccccchHHhhh--------hhhccceeEE---------eecccc---HHHHHhhh--
Confidence            9999999999999999999999999999999999        4455677776         999887   43332100  


Q ss_pred             ccccCHHHHHHHHHcCceeeEEEEcCccccccHHHHHHHHhcCCeeEecCCCcHHHHHHHHHHHHHHHHHhcCCccEEEE
Q psy4417         323 YWFTSREVMERDIQDHKFLEYGEHNGHLYGTHLDSIREVILSGKICVLDCSPVEEDIKRTLEESACLQRSYERFIDKVIV  402 (440)
Q Consensus       323 y~f~s~~~f~~~~~~~~fle~~~~~~~~yGt~~~~i~~~~~~~~~~i~~~~~s~e~l~~~l~~~~~~e~~~~~~fd~vi~  402 (440)
                                                 .                      ..+.+++++|+..+.++++++.+.||++|+
T Consensus       138 ---------------------------k----------------------r~~~~~i~~r~~~~~~~e~~~~~~fd~vI~  168 (199)
T d1kjwa2         138 ---------------------------K----------------------RITEEQARKAFDRATKLEQEFTECFSAIVE  168 (199)
T ss_dssp             ---------------------------T----------------------TSCHHHHHHHHHHHHHHHHHHGGGCSEEEC
T ss_pred             ---------------------------c----------------------cccHHHHHHHHHHHHHHHHHhhccCCEEEE
Confidence                                       0                      126889999999999999999999999999


Q ss_pred             cCCHHHHHHHHHHHHHhccCCCeeeecc
Q psy4417         403 NEDFDETFRTVIELLDTLSNKHQVDSRP  430 (440)
Q Consensus       403 Nddl~~a~~~l~~~i~~~~~~~~wvp~~  430 (440)
                      |||+++|+++|+++|.+++.+++|||+.
T Consensus       169 Nddle~a~~~l~~iI~~~~~~~~WvP~~  196 (199)
T d1kjwa2         169 GDSFEEIYHKVKRVIEDLSGPYIWVPAR  196 (199)
T ss_dssp             CSSHHHHHHHHHHHHHHHSCSEEEEECS
T ss_pred             CcCHHHHHHHHHHHHHHhcCCCeeecCc
Confidence            9999999999999999999999999963
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ha_ b.34.2.1 (A:) SH3-like domain of the L-type calcium channel {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1vyua1 b.34.2.1 (A:39-174) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kjwa2 c.37.1.1 (A:526-724) Guanylate kinase-like domain of Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1vyva1 b.34.2.1 (A:71-215) SH3-like domain of the L-type calcium channel {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kjwa1 b.34.2.1 (A:430-525) Psd-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tp5a1 b.36.1.1 (A:302-403) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kwaa_ b.36.1.1 (A:) Cask/Lin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2fcfa1 b.36.1.1 (A:1148-1243) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g9oa_ b.36.1.1 (A:) Na+/H+ exchanger regulatory factor, NHERF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozia_ b.36.1.1 (A:) Phosphatase hPTP1e {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1r6ja_ b.36.1.1 (A:) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ea_ b.36.1.1 (A:) Glutamate receptor-interacting protein 1, GRIP1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uhpa_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qava_ b.36.1.1 (A:) Syntrophin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fnea1 b.36.1.1 (A:1955-2042) Multiple PDZ domain protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgra_ b.36.1.1 (A:) Synaptic protein PSD-95 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1um1a_ b.36.1.1 (A:) Hypothetical protein KIAA1849 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fe5a1 b.36.1.1 (A:223-314) Synapse-associated protein 102 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whaa_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uita_ b.36.1.1 (A:) Discs large 5 protein KIAA0583 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujua_ b.36.1.1 (A:) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rzxa_ b.36.1.1 (A:) GTPase-binding domain of the cell polarity protein par6 (Par-6B) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wf8a1 b.36.1.1 (A:8-101) Neurabin-i {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t2ma1 b.36.1.1 (A:2-93) Afadin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1va8a1 b.36.1.1 (A:8-107) Maguk p55 subfamily member 5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p1da2 b.36.1.1 (A:115-213) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m5za_ b.36.1.1 (A:) Glutamate receptor interacting protein {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1x6da1 b.36.1.2 (A:8-114) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rgwa_ b.36.1.1 (A:) Zasp (Cypher, Oracle 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihja_ b.36.1.1 (A:) Inad {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1wi2a_ b.36.1.1 (A:) PDZ domain containing protein 11, Pdzk11 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1y7na1 b.36.1.1 (A:12-90) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uepa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uewa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w9ea1 b.36.1.1 (A:110-194) Syntenin 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q3oa_ b.36.1.1 (A:) Shank1, PDZ domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i16a_ b.36.1.2 (A:) Interleukin 16 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi4a1 b.36.1.1 (A:8-103) Syntaxin binding protein 4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5qa1 b.36.1.1 (A:8-104) Scribble (KIAA0147) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5ya1 b.36.1.1 (A:19-95) Regulator of G-protein signaling 3, RGS3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v62a_ b.36.1.1 (A:) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qaua_ b.36.1.1 (A:) Neuronal nitric oxide synthase, NNOS {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2f0aa1 b.36.1.1 (A:251-342) Segment polarity protein dishevelled homolog Dvl-2 {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1x45a1 b.36.1.1 (A:8-92) Amyloid beta A4 precursor protein-binding family A member 1 (APBA1, X11) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueqa_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujda_ b.36.1.1 (A:) Hypothetical protein KIAA0559 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vb7a_ b.36.1.1 (A:) PDZ-LIM protein mystique {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5na1 b.36.1.1 (A:8-108) Harmonin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ueza_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ba_ b.36.1.1 (A:) Harmonin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uf1a_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vaea_ b.36.1.1 (A:) Rhophilin-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ckaa_ b.34.2.1 (A:) C-Crk, N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2h3la1 b.36.1.1 (A:1310-1412) Erbin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufxa_ b.36.1.1 (A:) KIAA1526 protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ra1 b.36.1.1 (A:8-106) Glutamate receptor interacting protein 2, GRIP2 (KIAA1719) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gcqa_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs5a1 b.36.1.1 (A:8-113) Tyrosine-protein phosphatase non-receptor type 4, PTPN4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5qa_ b.36.1.1 (A:) Glutamate receptor interacting protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2csja1 b.36.1.1 (A:8-111) Tight junction protein ZO-2, Tjp2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rn8a1 b.34.2.1 (A:176-228) Bruton's tyrosine kinase {Mus musculus [TaxId: 10090]} Back     information, alignment and structure
>d1k4us_ b.34.2.1 (S:) p67phox {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf7a_ b.36.1.1 (A:) Enigma homolog ENH {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v5la_ b.36.1.1 (A:) Alpha-actinin-2 associated LIM protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cssa1 b.36.1.1 (A:8-115) Regulating synaptic membrane exocytosis protein 1, RIMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sema_ b.34.2.1 (A:) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Caenorhabditis elegans, SEM-5 [TaxId: 6239]} Back     information, alignment and structure
>d1utia_ b.34.2.1 (A:) Grb2-related adaptor protein 2 (Mona/Gads) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wifa_ b.36.1.1 (A:) hypothetical PDZ domain containing protein Uqcrc2 (4930408O21Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jo8a_ b.34.2.1 (A:) Actin binding protein ABP1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u06a1 b.34.2.1 (A:7-61) alpha-Spectrin, SH3 domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1uj0a_ b.34.2.1 (A:) Signal transducing adaptor molecule Stam2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wh1a_ b.36.1.1 (A:) Hypothetical protein KIAA1095 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg6a_ b.36.1.1 (A:) Partitioning-defective 3-like protein, PAR3-L (RIKEN cDNA 2810455b10) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a1 b.34.2.1 (A:157-214) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1udla_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1arka_ b.34.2.1 (A:) SH3 domain from nebulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hspa_ b.34.2.1 (A:) Phospholipase C, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujya_ b.34.2.1 (A:) Rac/CDC42 GEF 6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1efna_ b.34.2.1 (A:) Fyn proto-oncogene tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awwa_ b.34.2.1 (A:) Bruton's tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfwa_ b.34.2.1 (A:) Kalirin-9a {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wlpb1 b.34.2.1 (B:229-281) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl5a_ b.34.2.1 (A:) tyrosine kinase tec {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zuua1 b.34.2.1 (A:2-57) BZZ1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1i07a_ b.34.2.1 (A:) EPS8 SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ue9a_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ycsb2 b.34.2.1 (B:457-519) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1ra1 b.34.2.1 (A:10-76) Peroxisomal membrane protein Pex13p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j3ta_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iima1 b.34.2.1 (A:58-119) p56-lck tyrosine kinase, SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qcfa1 b.34.2.1 (A:80-145) Hemapoetic cell kinase Hck {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fmka1 b.34.2.1 (A:82-145) c-src protein tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gria1 b.34.2.1 (A:1-56) Growth factor receptor-bound protein 2 (GRB2), N- and C-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiea_ b.34.2.1 (A:) RIM binding protein 2, RIMBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ujva_ b.36.1.1 (A:) Membrane associated guanylate kinase inverted-2 (MAGI-2, KIAA0705) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1opka1 b.34.2.1 (A:83-139) Abl tyrosine kinase, SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ng2a2 b.34.2.1 (A:215-332) p47pox (neutrophil cytosolic factor 1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oota_ b.34.2.1 (A:) Hypothetical protein YFR024c {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1spka_ b.34.2.1 (A:) BAI1-associated protein 2-like 1 (RIKEN cDNA 1300006m19) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fc6a3 b.36.1.3 (A:157-248) Photosystem II D1 C-terminal processing protease {Algae (Scenedesmus obliquus) [TaxId: 3088]} Back     information, alignment and structure
>d1ugva_ b.34.2.1 (A:) Olygophrenin-1 like protein (KIAA0621) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhfa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uffa_ b.34.2.1 (A:) Intersectin 2 (KIAA1256) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhca_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k9aa1 b.34.2.1 (A:6-76) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u5sa1 b.34.2.1 (A:1-71) Nck-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i1ja_ b.34.2.1 (A:) Melanoma inhibitory activity protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ug1a_ b.34.2.1 (A:) Hypothetical protein Baa76854.1 (KIAA1010) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bb9a_ b.34.2.1 (A:) Amphiphysin 2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1phta_ b.34.2.1 (A:) Phosphatidylinositol 3-kinase (p85-alpha subunit, pi3k), SH3 domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2z9ia1 b.36.1.4 (A:227-314) Protease PepD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1gcqc_ b.34.2.1 (C:) Vav N-terminal SH3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ky9b2 b.36.1.4 (B:359-446) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lcya1 b.36.1.4 (A:226-325) Mitochondrial serine protease HtrA2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a1 b.36.1.3 (A:763-853) Tricorn protease {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ky9a1 b.36.1.4 (A:260-353) Protease Do (DegP, HtrA), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hgaa1 b.36.1.6 (A:23-125) Uncharacterized protein MTH1368 {Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1sota1 b.36.1.4 (A:255-353) Stress sensor protease DegS, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2i6va1 b.36.1.5 (A:219-305) General secretion pathway protein C, EpsC {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure